Basic Information | |
---|---|
Family ID | F022529 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 214 |
Average Sequence Length | 43 residues |
Representative Sequence | NSLIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWS |
Number of Associated Samples | 170 |
Number of Associated Scaffolds | 214 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.47 % |
% of genes near scaffold ends (potentially truncated) | 97.20 % |
% of genes from short scaffolds (< 2000 bps) | 89.72 % |
Associated GOLD sequencing projects | 144 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (57.477 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (30.374 % of family members) |
Environment Ontology (ENVO) | Unclassified (80.374 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.850 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 214 Family Scaffolds |
---|---|---|
PF11351 | GTA_holin_3TM | 4.67 |
PF00959 | Phage_lysozyme | 2.34 |
PF10614 | CsgF | 0.93 |
PF03237 | Terminase_6N | 0.93 |
PF08291 | Peptidase_M15_3 | 0.47 |
PF13539 | Peptidase_M15_4 | 0.47 |
PF12789 | PTR | 0.47 |
PF04773 | FecR | 0.47 |
PF13884 | Peptidase_S74 | 0.47 |
PF09327 | DUF1983 | 0.47 |
PF00476 | DNA_pol_A | 0.47 |
PF00565 | SNase | 0.47 |
PF06356 | DUF1064 | 0.47 |
COG ID | Name | Functional Category | % Frequency in 214 Family Scaffolds |
---|---|---|---|
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.47 |
COG4733 | Phage-related protein, tail protein J | Mobilome: prophages, transposons [X] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 57.48 % |
All Organisms | root | All Organisms | 42.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000116|DelMOSpr2010_c10082206 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300000117|DelMOWin2010_c10012555 | All Organisms → cellular organisms → Bacteria | 4721 | Open in IMG/M |
3300000117|DelMOWin2010_c10215794 | Not Available | 581 | Open in IMG/M |
3300001419|JGI11705J14877_10026942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2211 | Open in IMG/M |
3300001419|JGI11705J14877_10197311 | Not Available | 518 | Open in IMG/M |
3300001460|JGI24003J15210_10006296 | All Organisms → Viruses → Predicted Viral | 5000 | Open in IMG/M |
3300001472|JGI24004J15324_10006948 | All Organisms → cellular organisms → Bacteria | 4245 | Open in IMG/M |
3300001718|JGI24523J20078_1027792 | Not Available | 657 | Open in IMG/M |
3300002483|JGI25132J35274_1000998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7528 | Open in IMG/M |
3300002483|JGI25132J35274_1041053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1023 | Open in IMG/M |
3300005512|Ga0074648_1194280 | Not Available | 571 | Open in IMG/M |
3300005520|Ga0066864_10178752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
3300005596|Ga0066834_10254763 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005611|Ga0074647_1028373 | Not Available | 813 | Open in IMG/M |
3300005912|Ga0075109_1118048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 891 | Open in IMG/M |
3300006025|Ga0075474_10244298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
3300006026|Ga0075478_10135669 | Not Available | 773 | Open in IMG/M |
3300006027|Ga0075462_10027433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1839 | Open in IMG/M |
3300006029|Ga0075466_1000152 | All Organisms → cellular organisms → Bacteria | 24369 | Open in IMG/M |
3300006164|Ga0075441_10062719 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
3300006165|Ga0075443_10049278 | Not Available | 1414 | Open in IMG/M |
3300006399|Ga0075495_1106555 | Not Available | 596 | Open in IMG/M |
3300006735|Ga0098038_1163635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 735 | Open in IMG/M |
3300006737|Ga0098037_1200758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 653 | Open in IMG/M |
3300006750|Ga0098058_1069295 | Not Available | 975 | Open in IMG/M |
3300006752|Ga0098048_1153984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 685 | Open in IMG/M |
3300006753|Ga0098039_1115960 | Not Available | 920 | Open in IMG/M |
3300006789|Ga0098054_1110161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 1028 | Open in IMG/M |
3300006802|Ga0070749_10709209 | Not Available | 537 | Open in IMG/M |
3300006803|Ga0075467_10390045 | Not Available | 726 | Open in IMG/M |
3300006810|Ga0070754_10200853 | Not Available | 929 | Open in IMG/M |
3300006810|Ga0070754_10486204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300006810|Ga0070754_10493385 | Not Available | 528 | Open in IMG/M |
3300006810|Ga0070754_10500490 | Not Available | 523 | Open in IMG/M |
3300006868|Ga0075481_10063385 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300006868|Ga0075481_10330342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300006869|Ga0075477_10277784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
3300006870|Ga0075479_10195187 | Not Available | 814 | Open in IMG/M |
3300006874|Ga0075475_10281755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
3300006916|Ga0070750_10215507 | Not Available | 844 | Open in IMG/M |
3300006919|Ga0070746_10035958 | All Organisms → Viruses → Predicted Viral | 2641 | Open in IMG/M |
3300006919|Ga0070746_10197374 | Not Available | 960 | Open in IMG/M |
3300006926|Ga0098057_1130947 | Not Available | 612 | Open in IMG/M |
3300006927|Ga0098034_1189603 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300006927|Ga0098034_1239324 | Not Available | 503 | Open in IMG/M |
3300006947|Ga0075444_10283791 | Not Available | 642 | Open in IMG/M |
3300006990|Ga0098046_1059440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
3300007113|Ga0101666_1047217 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300007231|Ga0075469_10036924 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
3300007236|Ga0075463_10075361 | Not Available | 1088 | Open in IMG/M |
3300007276|Ga0070747_1291544 | Not Available | 562 | Open in IMG/M |
3300007276|Ga0070747_1293314 | Not Available | 560 | Open in IMG/M |
3300007345|Ga0070752_1342610 | Not Available | 562 | Open in IMG/M |
3300007345|Ga0070752_1385443 | Not Available | 520 | Open in IMG/M |
3300007346|Ga0070753_1132165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 955 | Open in IMG/M |
3300007538|Ga0099851_1063866 | Not Available | 1434 | Open in IMG/M |
3300007539|Ga0099849_1006165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium | 5473 | Open in IMG/M |
3300007539|Ga0099849_1102342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1141 | Open in IMG/M |
3300007540|Ga0099847_1050806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-3 | 1305 | Open in IMG/M |
3300007540|Ga0099847_1197095 | Not Available | 588 | Open in IMG/M |
3300007640|Ga0070751_1211594 | Not Available | 749 | Open in IMG/M |
3300007960|Ga0099850_1074396 | Not Available | 1422 | Open in IMG/M |
3300007960|Ga0099850_1408136 | Not Available | 502 | Open in IMG/M |
3300008012|Ga0075480_10158056 | Not Available | 1225 | Open in IMG/M |
3300008012|Ga0075480_10186691 | Not Available | 1104 | Open in IMG/M |
3300009079|Ga0102814_10844390 | Not Available | 507 | Open in IMG/M |
3300009149|Ga0114918_10422478 | Not Available | 723 | Open in IMG/M |
3300009172|Ga0114995_10254767 | Not Available | 969 | Open in IMG/M |
3300009173|Ga0114996_11019259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 587 | Open in IMG/M |
3300009420|Ga0114994_10256551 | Not Available | 1169 | Open in IMG/M |
3300009422|Ga0114998_10176647 | Not Available | 1020 | Open in IMG/M |
3300009428|Ga0114915_1228243 | Not Available | 505 | Open in IMG/M |
3300009437|Ga0115556_1370124 | Not Available | 502 | Open in IMG/M |
3300009443|Ga0115557_1403320 | Not Available | 502 | Open in IMG/M |
3300009472|Ga0115554_1257173 | Not Available | 697 | Open in IMG/M |
3300009507|Ga0115572_10566102 | All Organisms → Viruses | 627 | Open in IMG/M |
3300009507|Ga0115572_10735415 | Not Available | 535 | Open in IMG/M |
3300009512|Ga0115003_10909064 | Not Available | 511 | Open in IMG/M |
3300009529|Ga0114919_10975830 | Not Available | 570 | Open in IMG/M |
3300009606|Ga0115102_10234373 | Not Available | 570 | Open in IMG/M |
3300009622|Ga0105173_1065267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 632 | Open in IMG/M |
3300009703|Ga0114933_10960852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 541 | Open in IMG/M |
3300010148|Ga0098043_1164543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 623 | Open in IMG/M |
3300010151|Ga0098061_1205712 | Not Available | 697 | Open in IMG/M |
3300010296|Ga0129348_1306120 | Not Available | 530 | Open in IMG/M |
3300010299|Ga0129342_1305520 | Not Available | 546 | Open in IMG/M |
3300010300|Ga0129351_1085108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52 | 1276 | Open in IMG/M |
3300010300|Ga0129351_1200814 | Not Available | 774 | Open in IMG/M |
3300010368|Ga0129324_10295280 | Not Available | 638 | Open in IMG/M |
3300010368|Ga0129324_10310900 | Not Available | 618 | Open in IMG/M |
3300010368|Ga0129324_10324423 | Not Available | 602 | Open in IMG/M |
3300010883|Ga0133547_11954931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1076 | Open in IMG/M |
3300012418|Ga0138261_1675867 | Not Available | 554 | Open in IMG/M |
3300012528|Ga0129352_10602851 | Not Available | 531 | Open in IMG/M |
3300012967|Ga0129343_1263897 | Not Available | 509 | Open in IMG/M |
3300013010|Ga0129327_10298598 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300013010|Ga0129327_10471244 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300013010|Ga0129327_10915465 | Not Available | 504 | Open in IMG/M |
3300016741|Ga0182079_1110334 | Not Available | 609 | Open in IMG/M |
3300016742|Ga0182052_1259601 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300016751|Ga0182062_1401906 | Not Available | 675 | Open in IMG/M |
3300017697|Ga0180120_10164664 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300017710|Ga0181403_1018104 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
3300017710|Ga0181403_1055420 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300017718|Ga0181375_1016227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1285 | Open in IMG/M |
3300017719|Ga0181390_1080458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
3300017726|Ga0181381_1081279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 693 | Open in IMG/M |
3300017750|Ga0181405_1052170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1075 | Open in IMG/M |
3300017750|Ga0181405_1123134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 647 | Open in IMG/M |
3300017755|Ga0181411_1072484 | Not Available | 1040 | Open in IMG/M |
3300017771|Ga0181425_1081622 | Not Available | 1040 | Open in IMG/M |
3300017783|Ga0181379_1254887 | Not Available | 604 | Open in IMG/M |
3300017818|Ga0181565_10114615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1901 | Open in IMG/M |
3300017957|Ga0181571_10751073 | Not Available | 581 | Open in IMG/M |
3300017964|Ga0181589_10330766 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
3300018413|Ga0181560_10559572 | Not Available | 518 | Open in IMG/M |
3300018421|Ga0181592_10656356 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 705 | Open in IMG/M |
3300019122|Ga0188839_1015429 | Not Available | 832 | Open in IMG/M |
3300019283|Ga0182058_1601008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
3300019459|Ga0181562_10218584 | Not Available | 987 | Open in IMG/M |
3300020165|Ga0206125_10109120 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300020251|Ga0211700_1012290 | Not Available | 976 | Open in IMG/M |
3300020347|Ga0211504_1023756 | Not Available | 1608 | Open in IMG/M |
3300020358|Ga0211689_1001502 | Not Available | 12858 | Open in IMG/M |
3300020358|Ga0211689_1224821 | Not Available | 505 | Open in IMG/M |
3300021356|Ga0213858_10335178 | Not Available | 718 | Open in IMG/M |
3300021356|Ga0213858_10512362 | Not Available | 553 | Open in IMG/M |
3300021365|Ga0206123_10441492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
3300021957|Ga0222717_10628230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300021958|Ga0222718_10199960 | Not Available | 1092 | Open in IMG/M |
3300021964|Ga0222719_10739260 | Not Available | 550 | Open in IMG/M |
3300022057|Ga0212025_1065772 | Not Available | 626 | Open in IMG/M |
3300022065|Ga0212024_1038369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 827 | Open in IMG/M |
3300022069|Ga0212026_1078220 | Not Available | 503 | Open in IMG/M |
3300022071|Ga0212028_1048527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
3300022072|Ga0196889_1014432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1695 | Open in IMG/M |
3300022074|Ga0224906_1206323 | Not Available | 534 | Open in IMG/M |
3300022168|Ga0212027_1011018 | Not Available | 1243 | Open in IMG/M |
3300022187|Ga0196899_1163989 | Not Available | 609 | Open in IMG/M |
3300022187|Ga0196899_1199113 | Not Available | 531 | Open in IMG/M |
3300022198|Ga0196905_1174956 | Not Available | 545 | Open in IMG/M |
3300022200|Ga0196901_1065553 | Not Available | 1324 | Open in IMG/M |
3300022225|Ga0187833_10153045 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300022922|Ga0255779_1050718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 2621 | Open in IMG/M |
3300022929|Ga0255752_10369148 | Not Available | 578 | Open in IMG/M |
3300023087|Ga0255774_10053757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2438 | Open in IMG/M |
3300023116|Ga0255751_10135875 | Not Available | 1467 | Open in IMG/M |
3300023176|Ga0255772_10081526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 2100 | Open in IMG/M |
3300024301|Ga0233451_10121810 | Not Available | 1248 | Open in IMG/M |
(restricted) 3300024518|Ga0255048_10641683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 513 | Open in IMG/M |
(restricted) 3300024529|Ga0255044_10352465 | Not Available | 609 | Open in IMG/M |
3300025071|Ga0207896_1016941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1276 | Open in IMG/M |
3300025084|Ga0208298_1055680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 766 | Open in IMG/M |
3300025097|Ga0208010_1040822 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300025101|Ga0208159_1035897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
3300025101|Ga0208159_1079467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 622 | Open in IMG/M |
3300025103|Ga0208013_1161774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED256 | 527 | Open in IMG/M |
3300025109|Ga0208553_1053155 | Not Available | 998 | Open in IMG/M |
3300025114|Ga0208433_1146931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
3300025120|Ga0209535_1002748 | All Organisms → cellular organisms → Bacteria | 11437 | Open in IMG/M |
3300025120|Ga0209535_1149513 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300025137|Ga0209336_10000748 | Not Available | 16424 | Open in IMG/M |
3300025138|Ga0209634_1002963 | Not Available | 11682 | Open in IMG/M |
3300025138|Ga0209634_1020037 | Not Available | 3745 | Open in IMG/M |
3300025151|Ga0209645_1003213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7524 | Open in IMG/M |
3300025151|Ga0209645_1003512 | All Organisms → cellular organisms → Bacteria | 7139 | Open in IMG/M |
3300025168|Ga0209337_1084003 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300025241|Ga0207893_1032661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 738 | Open in IMG/M |
3300025266|Ga0208032_1050945 | Not Available | 973 | Open in IMG/M |
3300025266|Ga0208032_1078822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
3300025276|Ga0208814_1094906 | Not Available | 762 | Open in IMG/M |
3300025276|Ga0208814_1139344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp. | 558 | Open in IMG/M |
3300025543|Ga0208303_1098011 | Not Available | 624 | Open in IMG/M |
3300025655|Ga0208795_1025016 | Not Available | 1932 | Open in IMG/M |
3300025671|Ga0208898_1003981 | All Organisms → cellular organisms → Bacteria | 8580 | Open in IMG/M |
3300025674|Ga0208162_1060488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1233 | Open in IMG/M |
3300025674|Ga0208162_1071600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1095 | Open in IMG/M |
3300025674|Ga0208162_1128874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 717 | Open in IMG/M |
3300025674|Ga0208162_1165986 | Not Available | 591 | Open in IMG/M |
3300025687|Ga0208019_1116742 | Not Available | 796 | Open in IMG/M |
3300025759|Ga0208899_1010089 | Not Available | 5312 | Open in IMG/M |
3300025769|Ga0208767_1008398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 6653 | Open in IMG/M |
3300025769|Ga0208767_1210381 | Not Available | 644 | Open in IMG/M |
3300025771|Ga0208427_1181805 | Not Available | 677 | Open in IMG/M |
3300025771|Ga0208427_1268571 | Not Available | 519 | Open in IMG/M |
3300025806|Ga0208545_1141184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
3300025809|Ga0209199_1115762 | Not Available | 1069 | Open in IMG/M |
3300025853|Ga0208645_1095161 | Not Available | 1248 | Open in IMG/M |
3300025853|Ga0208645_1114890 | Not Available | 1085 | Open in IMG/M |
3300025860|Ga0209119_1295112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 577 | Open in IMG/M |
3300025873|Ga0209757_10163546 | Not Available | 700 | Open in IMG/M |
3300025897|Ga0209425_10267180 | Not Available | 874 | Open in IMG/M |
3300026210|Ga0208642_1091106 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300027522|Ga0209384_1112961 | Not Available | 632 | Open in IMG/M |
3300027612|Ga0209037_1072645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 846 | Open in IMG/M |
3300027668|Ga0209482_1204431 | Not Available | 544 | Open in IMG/M |
3300027704|Ga0209816_1010198 | Not Available | 5545 | Open in IMG/M |
3300027704|Ga0209816_1278442 | Not Available | 515 | Open in IMG/M |
3300031519|Ga0307488_10848077 | Not Available | 501 | Open in IMG/M |
3300031539|Ga0307380_10855618 | Not Available | 744 | Open in IMG/M |
3300031569|Ga0307489_10491523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 833 | Open in IMG/M |
3300031569|Ga0307489_10692608 | Not Available | 710 | Open in IMG/M |
3300031598|Ga0308019_10351324 | Not Available | 539 | Open in IMG/M |
3300031605|Ga0302132_10084129 | Not Available | 1619 | Open in IMG/M |
3300031612|Ga0308009_10172063 | Not Available | 815 | Open in IMG/M |
3300031621|Ga0302114_10232734 | Not Available | 756 | Open in IMG/M |
3300031669|Ga0307375_10344797 | Not Available | 941 | Open in IMG/M |
3300032151|Ga0302127_10095580 | Not Available | 1494 | Open in IMG/M |
3300032151|Ga0302127_10309974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
3300033742|Ga0314858_106506 | Not Available | 713 | Open in IMG/M |
3300033742|Ga0314858_111216 | Not Available | 698 | Open in IMG/M |
3300033742|Ga0314858_161863 | Not Available | 575 | Open in IMG/M |
3300033742|Ga0314858_206736 | Not Available | 503 | Open in IMG/M |
3300034418|Ga0348337_122799 | Not Available | 792 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 30.37% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.43% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.48% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.61% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.14% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.14% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.80% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.80% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.87% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.40% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.40% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.40% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.93% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.93% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.93% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.93% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.93% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.47% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.47% |
Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.47% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.47% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.47% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.47% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.47% |
Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.47% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.47% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.47% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.47% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
3300005520 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 | Environmental | Open in IMG/M |
3300005596 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B | Environmental | Open in IMG/M |
3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016742 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016751 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025241 | Marine viral communities from the Deep Pacific Ocean - MSP-121 (SPAdes) | Environmental | Open in IMG/M |
3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
3300026210 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 (SPAdes) | Environmental | Open in IMG/M |
3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
3300031612 | Marine microbial communities from water near the shore, Antarctic Ocean - #127 | Environmental | Open in IMG/M |
3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300032151 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCM | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_100822061 | 3300000116 | Marine | GDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE* |
DelMOWin2010_100125551 | 3300000117 | Marine | GDETADEAKARVEANRTAKVQGQIDRAATTASGVPWS* |
DelMOWin2010_102157944 | 3300000117 | Marine | NDVLGWVYDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS* |
JGI11705J14877_100269421 | 3300001419 | Saline Water And Sediment | WVYNSLVEGEETPEEAKARIEADRTAKVQKQIDRANSESSGMPWVANA* |
JGI11705J14877_101973113 | 3300001419 | Saline Water And Sediment | NWVYASLVEGEETPAEAKARVEANRTAKVQGQIDRANSQSDGMPWA* |
JGI24003J15210_100062961 | 3300001460 | Marine | ETATKAKARIEANRTARVQNQIDRAATQATGVPWAV* |
JGI24004J15324_100069487 | 3300001472 | Marine | WIYDSIKEGEETAAEAKKRVEDNRTARVQGQMDRASTQAEGLPWSS* |
JGI24523J20078_10277921 | 3300001718 | Marine | ETAAEAKKRIEDERTAKVQGQIDRAAAXSSGVPW* |
JGI25132J35274_10009981 | 3300002483 | Marine | EGDETADEAKARVEADRDAKVQGQIDRAASQSDGVPWSS* |
JGI25132J35274_10410533 | 3300002483 | Marine | EGDETADEAKARVEADRDAKVQGQIDRAASQSDGLPWSS* |
Ga0074648_11942803 | 3300005512 | Saline Water And Sediment | LTEADVLNWVYASLVEGEETPAEAKARVEANRTAKVQGQIDRANSQSDGMPWA* |
Ga0066864_101787523 | 3300005520 | Marine | LKEGEETADEAKARVEANRTQRVQNQIDAAATEAEGVPW* |
Ga0066834_102547633 | 3300005596 | Marine | PYDDLTEPDVLNWIYESLKKGEETADEAKARVEANRTQRVQNQIDAAATETEGLPWSSEAA* |
Ga0074647_10283731 | 3300005611 | Saline Water And Sediment | DETADEAKARIEADRTAKVQGQIDRAASDSTGVPWS* |
Ga0075109_11180483 | 3300005912 | Saline Lake | AAEAKARVEADRDSKVQKQIDAAATTESGVPWTTPTP* |
Ga0075474_102442983 | 3300006025 | Aqueous | DETPAEAKARVEADRTAKVQGQIDRANSQSTGLPWAQSA* |
Ga0075478_101356691 | 3300006026 | Aqueous | DVLGWVYDSLIEGDETAAEAKARVEADRDGKVQKQIDAAATTASGVPWSS* |
Ga0075462_100274331 | 3300006027 | Aqueous | QVLGWVYNSLIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE* |
Ga0075466_10001521 | 3300006029 | Aqueous | YNSLIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE* |
Ga0075441_100627195 | 3300006164 | Marine | IYDSLKVDSETAAQAKKRIEDNRKARVQGQIDRALTQDTGVPW* |
Ga0075443_100492786 | 3300006165 | Marine | LKTGDETAAEAKKRIEDERTAKVQGQIDRAAADSTGVPW* |
Ga0075495_11065552 | 3300006399 | Aqueous | EATVLGWVYNSLIEGEETAEEAKARIEADRTAKVQKQIDAAATTASGTPW* |
Ga0098038_11636355 | 3300006735 | Marine | DETAEEYKARIETDRTAYVQAKIDRNATQASGVPW* |
Ga0098037_12007581 | 3300006737 | Marine | NKEGDETADEYKARIEANRTARVQSQIDRAATQATGVPW* |
Ga0098058_10692954 | 3300006750 | Marine | WIYESLKEGEETADEAKARVEANRTQRVQNQIDAAATEAEGLPWSSEAA* |
Ga0098048_11539841 | 3300006752 | Marine | KAEDETAEEYKARIETDRTAYVQSQIDRAATQATGVPW* |
Ga0098039_11159601 | 3300006753 | Marine | ESLKKGEETADEAKARVEANRTQRVQNQIDAAATEAEGVPW* |
Ga0098054_11101614 | 3300006789 | Marine | DSLIEGDETAAEAKARVEADRDAKVQKQIDAAATEAKGVPW* |
Ga0070749_107092091 | 3300006802 | Aqueous | KARVEANRTAKVQGQIDRANTQADGLPWAPEPEPNP* |
Ga0075467_103900454 | 3300006803 | Aqueous | DETAAEAKARVEADRDGKVQKQIDAATTTATGVPW* |
Ga0070754_102008531 | 3300006810 | Aqueous | YDSLKKDDETAAEAKKRIEDERTAKVQGQIDRAAANSSGVPW* |
Ga0070754_104862041 | 3300006810 | Aqueous | VLGWVYNSLIEGDETADEAKARVEANRTAKVQGQIDRAASDSSGVPW* |
Ga0070754_104933851 | 3300006810 | Aqueous | ETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE* |
Ga0070754_105004901 | 3300006810 | Aqueous | SLVEGDETPAEAKARVEANRTAKVQGQIDRANTQADGLPWAPEPEPNP* |
Ga0075481_100633856 | 3300006868 | Aqueous | DETAAEAKARVEADRDGKVQKQIDAAATTASGVPWSS* |
Ga0075481_103303421 | 3300006868 | Aqueous | LVEGDETPDEAKARVEANRTAKVQGQIDRANTQADGLPWSA* |
Ga0075477_102777841 | 3300006869 | Aqueous | TEADVLNWVYASLVEGDETPAEAKARVEADRTAKVQGQIDRANSQSTGLPWAQSA* |
Ga0075479_101951874 | 3300006870 | Aqueous | WVYDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS* |
Ga0075475_102817551 | 3300006874 | Aqueous | EGDETPAEAKARVEADRTAKVQGQIDRANSQSTGLPWAQSA* |
Ga0070750_102155075 | 3300006916 | Aqueous | WVYASLVEGEETPEEAKARVEADRSAKVQKQIDRANSESSGMPWAAAS* |
Ga0070746_100359581 | 3300006919 | Aqueous | YDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS* |
Ga0070746_101973744 | 3300006919 | Aqueous | DVLGWVYASLVEGDETPDEAKARVEANRTAKVQGQIDRANSESSGMPWAAAS* |
Ga0098057_11309471 | 3300006926 | Marine | EGEETADEAKARVEANRTQRVQNQIDAAATETEGVPW* |
Ga0098034_11896033 | 3300006927 | Marine | SLKEGEETADEAKARVEANRTQRVQNQIDAAATEAEGLPWSSEAA* |
Ga0098034_12393243 | 3300006927 | Marine | WIYESLKEGEETADEAKARVEANRTQRVQNQIDAAATETEGVPWAA* |
Ga0075444_102837911 | 3300006947 | Marine | LIEGEETAAEAKARVEANRTARVEGQIDRATSEATGVPW* |
Ga0098046_10594401 | 3300006990 | Marine | DVLGWVYNSLIEGDETADQAKARVEADRTAKVQGQIDRAATQSDGLPWAATPNP* |
Ga0101666_10472174 | 3300007113 | Volcanic Co2 Seep Seawater | DETAAEYKARIEAERTAKVQAQIDRKATQATGVPW* |
Ga0075469_100369246 | 3300007231 | Aqueous | YDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTASGVPWSS* |
Ga0075463_100753611 | 3300007236 | Aqueous | ETPEEAKLRVEANRTAKVQGQIDRANTQADGLPWSA* |
Ga0070747_12915443 | 3300007276 | Aqueous | YDSLISGDETAAEAKARIEEDRTSKVQKQIDAATATSSGTPLSSSEEHLVAP* |
Ga0070747_12933143 | 3300007276 | Aqueous | LGWVYNSLIEGDETADEAKARIEANRTGKVQGQIDRAATTASGTPWAAE* |
Ga0070752_13426101 | 3300007345 | Aqueous | YASLVEGDETPDEAKARVEANRTAKVQGQIDRANTESSGMPWAAAS* |
Ga0070752_13854433 | 3300007345 | Aqueous | LGWIYDSLKEGEETAAEAKKRVEDNRKARVQGQIDRASTQAEGLPWA* |
Ga0070753_11321654 | 3300007346 | Aqueous | IEGDETAAEAKARVEADRDGKVQKQIDAAATTASGVPWSS* |
Ga0099851_10638661 | 3300007538 | Aqueous | PEEAKARVEADRSAKVQKQIDRANSESSGMPWAAAS* |
Ga0099849_10061655 | 3300007539 | Aqueous | DVLGWVYADLAEGDETPEEAKARIEENRIGKVQGQIDRASSQSSGVPW* |
Ga0099849_11023423 | 3300007539 | Aqueous | VLGWVYNSLIEGDETADEAKARVEADRDAKVQGQIDRAASQSDGVPW* |
Ga0099847_10508064 | 3300007540 | Aqueous | CLIEVDETAAEAKARVEADRDAKVQKQIDAAATTASGVPWTTPTP* |
Ga0099847_11970952 | 3300007540 | Aqueous | LGWVYTSLIEGEETADEAKARIETDRASKVQKQIDAAATTATGVPW* |
Ga0070751_12115941 | 3300007640 | Aqueous | ETPDEAKARVEADRDAKVQKQIDAAATTASGVPW* |
Ga0099850_10743965 | 3300007960 | Aqueous | WVYASLVEGDETPEEAKTRIENDRIAKVQKQIDRANTESSGVPWASAS* |
Ga0099850_14081363 | 3300007960 | Aqueous | DETPDEAKARVEANRTAKVQGQIDRANSESSGMPWANAS* |
Ga0075480_101580561 | 3300008012 | Aqueous | EADVLAWVYASLVQGDETPDEAKARVEADRTAKVQGQIERANSQSTGLPWAQSA* |
Ga0075480_101866914 | 3300008012 | Aqueous | VDDETAAEAKARIEVDRTAKVQKQIDAAATTASGVPW* |
Ga0102814_108443903 | 3300009079 | Estuarine | LGWVYDSLIEGDETAAEAKARVEANRTAKVQGQIDRAATTESGVPWSS* |
Ga0114918_104224781 | 3300009149 | Deep Subsurface | DVLEWVYTSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTASGVPWTTPTP* |
Ga0114995_102547671 | 3300009172 | Marine | LGWIYDSLKEGSETAAEAKARIEANRTSRVQGQIDRAATQDTGVPW* |
Ga0114996_110192591 | 3300009173 | Marine | NDVLGWVYDSLIEDDETAAEAKARVETRWIAKVQGQIDSTAVNSSGVPW* |
Ga0114994_102565513 | 3300009420 | Marine | YDSLIEGDETAAEAKARVEADRTAKVQKQIDAAATTESGVPWAAE* |
Ga0114998_101766474 | 3300009422 | Marine | GWVYSSLIQGDETAAEAKARMEAERTAKVQGQKDRAAANSSGVPW* |
Ga0114915_12282433 | 3300009428 | Deep Ocean | KEGSETAVQAKARIEDNRKARVQGQIDRATTQAEGVPW* |
Ga0115556_13701241 | 3300009437 | Pelagic Marine | KEGDETAAEAKKRIEDERTAKVQSQIDSASANSSGVPW* |
Ga0115557_14033202 | 3300009443 | Pelagic Marine | LIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE* |
Ga0115554_12571731 | 3300009472 | Pelagic Marine | NDVLGWVYDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWA* |
Ga0115572_105661024 | 3300009507 | Pelagic Marine | DETATEAKTRIETERAAKVQGQIDRASSESTGVPW* |
Ga0115572_107354152 | 3300009507 | Pelagic Marine | GWVYDSLIEGEETAEEAKARIEANRSGKVQGQIDRANSTVSGTPWTTE* |
Ga0115003_109090643 | 3300009512 | Marine | DSLIVGDETATEAKARVEADRTAKVQKQIDAAATTATGVPW* |
Ga0114919_109758303 | 3300009529 | Deep Subsurface | ESLVQGEETPEEAKARVEADRTAKVQGQIDRAATQSGGLPWDA* |
Ga0115102_102343731 | 3300009606 | Marine | IEGDETAAEAKARVEANRTAKVQGQIDRAATTESGVPWSS* |
Ga0105173_10652672 | 3300009622 | Marine Oceanic | GWIYTSLIEDDETAAEAKARIEANRTARVQGQIDRAATQAEGFPWDAEQEAA* |
Ga0114933_109608523 | 3300009703 | Deep Subsurface | EANKEGDETADEYKARIEAERTAKVQAQIDRAATQATGVPW* |
Ga0098043_11645434 | 3300010148 | Marine | EGDETAEEYKARIEAERTAKVQAQIDRKATQATGVPW* |
Ga0098061_12057121 | 3300010151 | Marine | ETADEAKARVEANRTQRVQNQIDAAATETEGVPW* |
Ga0129348_13061203 | 3300010296 | Freshwater To Marine Saline Gradient | IEGDETADEAKARVEADRDAKVQGQIDRAASQSDGVPW* |
Ga0129342_13055201 | 3300010299 | Freshwater To Marine Saline Gradient | GEETPEEAKARVEADRSAKVQKQIDRANSESSGMPWANAS* |
Ga0129351_10851082 | 3300010300 | Freshwater To Marine Saline Gradient | GWVYASLVEGDETPDEAKARIEENRTGKVQGQIDRANSQADGLPWAVTGA* |
Ga0129351_12008141 | 3300010300 | Freshwater To Marine Saline Gradient | TADEAKARIEANRTAKVDAQIAKNNDTASGMPWVA* |
Ga0129324_102952803 | 3300010368 | Freshwater To Marine Saline Gradient | DVLNWVYASLVEGDETPAEAKARVEANRTAKVQGQIDRANTQADGLPWEPEQPV* |
Ga0129324_103109003 | 3300010368 | Freshwater To Marine Saline Gradient | ESDVLGWVYDSLKEGEETADDAKARIEANRTQRVQNQIDAAATEAEGVPW* |
Ga0129324_103244233 | 3300010368 | Freshwater To Marine Saline Gradient | LIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS* |
Ga0133547_119549311 | 3300010883 | Marine | SLIEDEETAAEAKARIEANRTSRVQGQIDRAATQATGVPWSE* |
Ga0138261_16758673 | 3300012418 | Polar Marine | DGSDETAAEAKARIEAERTAKVQGQIDRAAANSSGVPW* |
Ga0129352_106028511 | 3300012528 | Aqueous | ETAEEAKARIEANRSGKVQGQIDRANSDASGLPWAAGE* |
Ga0129343_12638973 | 3300012967 | Aqueous | VYASLVEGEETPEEAKARVEADRSAKVQKQIDRANSESSGMPWAAAS* |
Ga0129327_102985981 | 3300013010 | Freshwater To Marine Saline Gradient | NSLIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE* |
Ga0129327_104712441 | 3300013010 | Freshwater To Marine Saline Gradient | NSLIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWS* |
Ga0129327_109154652 | 3300013010 | Freshwater To Marine Saline Gradient | LIEGEETADEAKARIETDRASKVQKQIDAAATTATGVPW* |
Ga0182079_11103341 | 3300016741 | Salt Marsh | WVYASLVEGDETPAEAKARVEANRTAKVQGQIDRANSQSDGMPWVPVEPTP |
Ga0182052_12596013 | 3300016742 | Salt Marsh | VYNSLIEGDETADEAKARIEANRTAKVQGQIDRAASDSSGVPW |
Ga0182062_14019063 | 3300016751 | Salt Marsh | VYNSLIEGDETATEAKARVEANRTAKVQGQIDRAASDSSGVPW |
Ga0180120_101646641 | 3300017697 | Freshwater To Marine Saline Gradient | LGWVYNSLIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE |
Ga0181403_10181041 | 3300017710 | Seawater | DETAAEAKKRIEDERTAKVQGQIDRAAANSNGVPW |
Ga0181403_10554201 | 3300017710 | Seawater | VLGWVYDSLIEGDETAAEAKARVEADRDSKVQKQIDAAATTASGVPWSS |
Ga0181375_10162271 | 3300017718 | Marine | TADEAKARVEANRTQRVQNQIDAAATETEGVPWAA |
Ga0181390_10804581 | 3300017719 | Seawater | GWVYDSLIEGDETAAEAKARVEANRTAKVQGQIDRAATTASGVPWS |
Ga0181381_10812791 | 3300017726 | Seawater | DETADEYKARIEAERTEKVQAQIDRAATQATGVPW |
Ga0181405_10521701 | 3300017750 | Seawater | AEGETADEYKAGIEANRTARVQSQIDRAATQATGVPW |
Ga0181405_11231344 | 3300017750 | Seawater | EGDETADEYKARIEAERTAKVQAQIDRAATQATGVPW |
Ga0181411_10724844 | 3300017755 | Seawater | IYDSLKEDGETAAQAKKRVEDNRKARVQGQIDRAATQAGGVPW |
Ga0181425_10816223 | 3300017771 | Seawater | WVYDSLIVGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS |
Ga0181379_12548871 | 3300017783 | Seawater | SLKEGDETAAEAKARIEAERTAKVQGQIDRAAANSHGVPW |
Ga0181565_101146151 | 3300017818 | Salt Marsh | EGDETPAEAKARVEANRTAKVQGQIDRANSQSDGMPWAS |
Ga0181571_107510731 | 3300017957 | Salt Marsh | DETPAEAKARVEANRTAKVQGQIDRANTQSDGMPWAS |
Ga0181589_103307664 | 3300017964 | Salt Marsh | ADVLNWVYASLVEGDETPDEAKLRVEANRTAKVQGQIDRASSQSSGIPWAA |
Ga0181560_105595721 | 3300018413 | Salt Marsh | LVEGDETPTEAKARVEANRTAKVQGQIDRANTQADGLPWAS |
Ga0181592_106563564 | 3300018421 | Salt Marsh | EGDETKAQAKARIEAERVAKVQGQIDRAAATADGVPWTS |
Ga0188839_10154293 | 3300019122 | Freshwater Lake | GWVYNSLITGDETAAEAKARVEADRTAKVQKQIDAAATTASGTPWAAE |
Ga0182058_16010083 | 3300019283 | Salt Marsh | GDETPAEAKARVEANRTAKVQGQIDRANSQSDGMPWAS |
Ga0181562_102185845 | 3300019459 | Salt Marsh | YTSLIEGDETAAEAKARVEADRDEKVQKQIDAATTTAMGVPW |
Ga0206125_101091205 | 3300020165 | Seawater | WVYDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS |
Ga0211700_10122901 | 3300020251 | Marine | VEDDETANEAKARIETDRTAKVQGQIDSAGSNAKGVPWT |
Ga0211504_10237567 | 3300020347 | Marine | AEAKARVEADRDAKVQKQIDAAATTESGVPWTAPVPE |
Ga0211689_10015021 | 3300020358 | Marine | LSQADVLSWIWTSLIEGEETADEAKKRIEDNRTARVQGQIDRATTQNTGVPW |
Ga0211689_12248213 | 3300020358 | Marine | LSQADVLSWIWTSLIEGEETADEAKARIEANRTARVQGQIDRAATQATGLPWSE |
Ga0213858_103351783 | 3300021356 | Seawater | TPEQAKARVEYERVAKVYAQIERANSQSTGLPWEA |
Ga0213858_105123621 | 3300021356 | Seawater | DVLGWVYDSLIEGDETADEAKARIEADRTAKVNAQITKNASEASGMPW |
Ga0206123_104414922 | 3300021365 | Seawater | EGEETADEAKERIEANRTGKVQGQIDRASAQAEGMPWVA |
Ga0222717_106282303 | 3300021957 | Estuarine Water | VLGWVYDSLIVGDETADEAKARVEADRTAKVQGQIDRAATTESGMPWVS |
Ga0222718_101999601 | 3300021958 | Estuarine Water | YASLVEGEETPDEAKARVEADRDAKVQKQIDAAATQASGVPW |
Ga0222719_107392601 | 3300021964 | Estuarine Water | DVLNWVYASLVEGEETPAEAKARVEADRTAKVQGQIDRANSQSDGMPWA |
Ga0212025_10657723 | 3300022057 | Aqueous | SLVEGDETPAEAKARVEADRTAKVQGQIDRANSQSTGLPWAQSA |
Ga0212024_10383693 | 3300022065 | Aqueous | DVLGWVYNSLIEGDETADEAKARVEADRDAKVQGQIDRAASQSDGVPWSA |
Ga0212026_10782201 | 3300022069 | Aqueous | YASLVEGDETPDEAKARVEANRTAKVQGQIDRANSESSGMPWAAAS |
Ga0212028_10485273 | 3300022071 | Aqueous | GWVYASLVEGDETPDEAKARVEANRTAKVQGQIDRANTQADGLPWAATP |
Ga0196889_10144327 | 3300022072 | Aqueous | GDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTASGVPWSS |
Ga0224906_12063232 | 3300022074 | Seawater | ENDVLGWVYDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS |
Ga0212027_10110181 | 3300022168 | Aqueous | YASLVEGDETPAEAKARVEANRTSKVQGQIDRANSQSDGMPWAS |
Ga0196899_11639891 | 3300022187 | Aqueous | WVYASLVEGDETPDEAKARVEANRTAKVQGQIDRANTQADGLPWAATP |
Ga0196899_11991133 | 3300022187 | Aqueous | ETPEEAKLRIEADRDGKVQKQIDAAATTASGVPWSS |
Ga0196905_11749563 | 3300022198 | Aqueous | VEGEETPEEAKARVEADRSAKVQKQIDRANSESSGMPWANAS |
Ga0196901_10655531 | 3300022200 | Aqueous | EADVLAWVYASLVQGEETPDEAKARVEADRTAKVQGQIDRANTQSDGMPWAQSA |
Ga0187833_101530454 | 3300022225 | Seawater | VLNWIYESLKKGEETADEAKARVEANRTQRVQNQIDAAATETEGLPWAA |
Ga0255779_10507181 | 3300022922 | Salt Marsh | TSLIEGEETADEAKARIETDRASKVQKQIDRAASQSSGVPW |
Ga0255752_103691481 | 3300022929 | Salt Marsh | GWVYDSLIEGDETADEAKARVEADRTAKVQGQIDRAASDSNGLPWAS |
Ga0255774_100537571 | 3300023087 | Salt Marsh | GDETATEAKARVEANRTAKVQGQIDRAASDSSGVPW |
Ga0255751_101358751 | 3300023116 | Salt Marsh | SLVEGDETPEEAKLRVEADRTAKVQKQIDAAATTASGVPW |
Ga0255772_100815267 | 3300023176 | Salt Marsh | LGWVYNSLIEGDETADEAKARVEANRTAKVQGQIDRAASDSSGVPWS |
Ga0233451_101218101 | 3300024301 | Salt Marsh | YNSLIEGDETATEAKTRIETERTAKVQGQIDRASSESTGVPW |
(restricted) Ga0255048_106416831 | 3300024518 | Seawater | DETADEAKARVEASGTAKVQAQIDAAATTESGMPWIS |
(restricted) Ga0255044_103524651 | 3300024529 | Seawater | DLTENDVLGWVYDSLIEGDETAAEAKARVEADRTAKVQGQIDRAATTASGVP |
Ga0207896_10169411 | 3300025071 | Marine | IYDSLKEGEETAAEAKKRVEDNRTARVQGQIDRASTQAEGLPWSS |
Ga0208298_10556801 | 3300025084 | Marine | ETAAEAKARVEANRTAKVQGQIDRAATTASGVPWS |
Ga0208010_10408225 | 3300025097 | Marine | SLKEGEETADEAKARVEANRTQRVQNQIDAAATEAEGLPWSSEAA |
Ga0208159_10358976 | 3300025101 | Marine | KEGDETADEYKARIEANRTARVQSQIDRAATQATGVPW |
Ga0208159_10794674 | 3300025101 | Marine | DETAAEYKARIEAERTAKVQAQIDRKATQATGVPW |
Ga0208013_11617741 | 3300025103 | Marine | DSLIEGDETAAEAKARVEADRDAKVQKQIDAAATEAKGVPW |
Ga0208553_10531553 | 3300025109 | Marine | NWIYESLKEGEETADEAKARVEANRTQRVQNQIDAAATEAEGVPW |
Ga0208433_11469311 | 3300025114 | Marine | YESLKKGEETADEAKARVEANRTQRVQNQIDAAATEAEGVPW |
Ga0209535_10027481 | 3300025120 | Marine | KEGEETAAEAKKRVEDNRKARVQGQIDRASTQAEGLPWA |
Ga0209535_11495131 | 3300025120 | Marine | VLGWIYDSLKEGEETAAEAKKRVEDNRKARVQGQIDRASTQATGVPWS |
Ga0209336_100007481 | 3300025137 | Marine | KEGEETAAEAKKRVEDNRKARVQGQIDRASTQATGVPWS |
Ga0209634_10029631 | 3300025138 | Marine | YDSLKEDGETAAQAKKRIEDNRKARVQGQIDRAATQAGGVPW |
Ga0209634_10200377 | 3300025138 | Marine | YSSLIVDDETAAEAKARIEANRTAKVQGQIDRAAANSSGVPWAAE |
Ga0209645_10032131 | 3300025151 | Marine | GDETADEAKARVEADRDAKVQGQIDRAASQSDGVPWSS |
Ga0209645_100351211 | 3300025151 | Marine | GDETADEAKARVEADRDAKVQGQIDRAASQSDGLPWSS |
Ga0209337_10840036 | 3300025168 | Marine | LGWVYTSLIEGDETAAEAKARVEADRDSKVQKQIDAAATTASGVPWS |
Ga0207893_10326613 | 3300025241 | Deep Ocean | EGEETAAEAKARIEANRTARVQGQIDRAATQAEGFPWDAEQEAA |
Ga0208032_10509454 | 3300025266 | Deep Ocean | YNSLIEGEETAAEAKARVEANRTARVEGQIDRATSEATGVPW |
Ga0208032_10788221 | 3300025266 | Deep Ocean | VYDSLIEGTETAAEAKARVEADRDSKVQKQIAAAATTASGVPWS |
Ga0208814_10949064 | 3300025276 | Deep Ocean | SETAAQAKKRIEDNRKARVQGQIDRAATQAEGVPW |
Ga0208814_11393441 | 3300025276 | Deep Ocean | GSETANQAKKRIEDNRKARVQGQIDRATTQAEGVPW |
Ga0208303_10980111 | 3300025543 | Aqueous | VLGWVYNSLIEGEETAEEAKARIEADRTAKVQKQIDAAATTATGTPW |
Ga0208795_10250161 | 3300025655 | Aqueous | ETPDEAKARVEANRTAKVQGQIDRANTQADGLPWA |
Ga0208898_10039819 | 3300025671 | Aqueous | LIEGDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE |
Ga0208162_10604881 | 3300025674 | Aqueous | VLGWVYADLAEGDETPEEAKARIEENRIGKVQGQIDRASSQSSGVPW |
Ga0208162_10716003 | 3300025674 | Aqueous | WVYNSLIEGDETADEAKARVEADRDAKVQGQIDRAASQSDGVPWSA |
Ga0208162_11288743 | 3300025674 | Aqueous | VLGWVYNSLIEGDETADEAKARVEADRDAKVQGQIDRAASQSDGVPW |
Ga0208162_11659861 | 3300025674 | Aqueous | SLVEGDETPEEAKARIEANRTAKVAAQIERANADASGLPWSA |
Ga0208019_11167421 | 3300025687 | Aqueous | TESDVLGWVYADLAEGDETPEEAKARIEENRTGKVQGQIDRANSQADGLPWA |
Ga0208899_10100891 | 3300025759 | Aqueous | GEETADEAKARIEANRTQRVQNQIDAAATTESGVPW |
Ga0208767_10083987 | 3300025769 | Aqueous | LIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS |
Ga0208767_12103813 | 3300025769 | Aqueous | LGWVYDSLIEGDETAAEAKARVEADRDGKVQKQIDAAATTESGVPWS |
Ga0208427_11818053 | 3300025771 | Aqueous | TEADVLNWVYASLVEGDETPAEAKARVEADRTAKVQGQIDRANSQSTGLPWAQSA |
Ga0208427_12685711 | 3300025771 | Aqueous | EGDETPEEAKARVEANRTAKVQGQIDRAASDSSGVPWAS |
Ga0208545_11411843 | 3300025806 | Aqueous | TENDVLGWVYDSLIEGDETAAEAKARVEADRDAKVQKQIDAAATTESGVPWAS |
Ga0209199_11157621 | 3300025809 | Pelagic Marine | ETADEAKARVEADRTAKVQKQIDAAATTESGMPWVS |
Ga0208645_10951611 | 3300025853 | Aqueous | VLGWVYNSLIEGDETADEAKARVEANRTAKVQGQIDRAASDSSGVPW |
Ga0208645_11148903 | 3300025853 | Aqueous | TPDEAKARVEADRDAKVQKQIDAAATTESGVPWAS |
Ga0209119_12951123 | 3300025860 | Pelagic Marine | GDETADEAKARVEANRTAKVQGQIDRAATTASGTPWAAE |
Ga0209757_101635461 | 3300025873 | Marine | DETAAEAKARIEANRTARVQSQIDRAATQAEGVPW |
Ga0209425_102671804 | 3300025897 | Pelagic Marine | WVYTSLIGGDETADEAKARVEADRTAKVQKQIDAAATTESGVPW |
Ga0208642_10911063 | 3300026210 | Marine | YNDLTESDVLNWIYESLKEGEETADEAKARVEANRTQRVQNQIDAAATEAEGVPW |
Ga0209384_11129611 | 3300027522 | Marine | EETAAEAKARVEANRTARVEGQIDRATSEATGVPW |
Ga0209037_10726451 | 3300027612 | Marine | DQVLGWVYNSLIEGDETADEAKARVEADRTAKVQGQIDRAATTASGVPWS |
Ga0209482_12044313 | 3300027668 | Marine | LIEGEETAAEAKARVEANRTARVEGQIDRATSEATGVPW |
Ga0209816_101019811 | 3300027704 | Marine | SLIEGEETAAEAKARVEANRTARVEGQIDRATSEATGVPW |
Ga0209816_12784423 | 3300027704 | Marine | LIVDDETAAEAKARIEAERTAKVQGQIDRAAADSTGVPW |
Ga0307488_108480771 | 3300031519 | Sackhole Brine | LTEADVLGWIWTNLIDGEETAEEAKARIEANRTARVQNQIDRAATQATGVPWAV |
Ga0307380_108556184 | 3300031539 | Soil | TADEAKARIETDRDAKVQKQIDAAATTASGLPWKVELI |
Ga0307489_104915231 | 3300031569 | Sackhole Brine | LIEDEETAAEAKARIEANRTARVQGQIDRAATQAAGVPW |
Ga0307489_106926084 | 3300031569 | Sackhole Brine | VLGWIYTSLIEDGETAAEAKARVEANRTARVQGQIDRAASQTTGVPW |
Ga0308019_103513243 | 3300031598 | Marine | ADVLGWIWTSLIEGEETAAEAKARIEANRTSRVQGQIDRAATQATGLPWATTP |
Ga0302132_100841294 | 3300031605 | Marine | DETAVEAKARVEADRDGKVQKQIDAAATTASGVPW |
Ga0308009_101720634 | 3300031612 | Marine | SLKEGSETAAQAKARIEANRTARVQNQIDRATAQATGVPW |
Ga0302114_102327343 | 3300031621 | Marine | WVYTSLIEGDETAAEAKARIEVDRDAKVQKQIDAASTTASGVPW |
Ga0307375_103447974 | 3300031669 | Soil | ADVLDWVYASLVEGDETPAEAKARIEANRTAKVQGQIDRANSQSSGTPWS |
Ga0302127_100955801 | 3300032151 | Marine | TESDVLGWIYTSLIVDDETAAEAKARVEANRTARVQGQIDRAATQAEGVPW |
Ga0302127_103099741 | 3300032151 | Marine | EDAETAAEAKARIEANRTSRVQGQIDRAATQAAGVPW |
Ga0314858_106506_580_711 | 3300033742 | Sea-Ice Brine | GDNSLIEGEETAEEAKARIEADRTGKVQGQIDRAASQSSGVPW |
Ga0314858_111216_551_676 | 3300033742 | Sea-Ice Brine | LIEGDETAAEAKARVEADRDGKVQKQIDAAATTASGVPWSS |
Ga0314858_161863_52_183 | 3300033742 | Sea-Ice Brine | VYDSLKEGDETAAEAKKRIEDERTAKVQDQIDRASANSSGVPW |
Ga0314858_206736_239_358 | 3300033742 | Sea-Ice Brine | LIEGDETAAEAKARVEADRDSKVQKQIDAAATTESGVPW |
Ga0348337_122799_7_126 | 3300034418 | Aqueous | LVEGEETPDEAKARVEADRDAKVQKQIDAAATTASGVPW |
⦗Top⦘ |