| Basic Information | |
|---|---|
| Family ID | F022508 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 214 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDSAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPETVRMR |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 214 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.33 % |
| % of genes near scaffold ends (potentially truncated) | 97.66 % |
| % of genes from short scaffolds (< 2000 bps) | 89.72 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.131 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.505 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.374 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 26.09% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 214 Family Scaffolds |
|---|---|---|
| PF01734 | Patatin | 60.28 |
| PF09335 | SNARE_assoc | 4.67 |
| PF13419 | HAD_2 | 2.34 |
| PF13561 | adh_short_C2 | 0.47 |
| PF04366 | Ysc84 | 0.47 |
| PF02321 | OEP | 0.47 |
| PF01087 | GalP_UDP_transf | 0.47 |
| PF01850 | PIN | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 214 Family Scaffolds |
|---|---|---|---|
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 60.28 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 60.28 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 60.28 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 4.67 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 4.67 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 4.67 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.13 % |
| Unclassified | root | N/A | 1.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_102637914 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300001137|JGI12637J13337_1005930 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300001471|JGI12712J15308_10122313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300003152|Ga0052254_1015526 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300003219|JGI26341J46601_10220532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300004157|Ga0062590_100997970 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005174|Ga0066680_10536141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300005175|Ga0066673_10134844 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300005332|Ga0066388_100770523 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300005334|Ga0068869_100456036 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300005439|Ga0070711_100463119 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005554|Ga0066661_10519594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300005555|Ga0066692_10140482 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300005569|Ga0066705_10021991 | All Organisms → cellular organisms → Bacteria | 3307 | Open in IMG/M |
| 3300005587|Ga0066654_10186820 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005764|Ga0066903_103395222 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300006032|Ga0066696_10451870 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300006047|Ga0075024_100566421 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006050|Ga0075028_100097380 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300006172|Ga0075018_10803144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300006175|Ga0070712_101138087 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006914|Ga0075436_100717474 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300007255|Ga0099791_10602671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300007258|Ga0099793_10230793 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300007265|Ga0099794_10029933 | All Organisms → cellular organisms → Bacteria | 2539 | Open in IMG/M |
| 3300007265|Ga0099794_10115719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300009038|Ga0099829_10914255 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009038|Ga0099829_11427285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300009088|Ga0099830_10831073 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009088|Ga0099830_11536618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300009089|Ga0099828_10253580 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300009089|Ga0099828_10310186 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300009090|Ga0099827_10036176 | All Organisms → cellular organisms → Bacteria | 3613 | Open in IMG/M |
| 3300009090|Ga0099827_10173960 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300009090|Ga0099827_11131900 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300009137|Ga0066709_100410506 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300009792|Ga0126374_10798111 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300009792|Ga0126374_11370408 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010043|Ga0126380_10787514 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010048|Ga0126373_12322736 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010322|Ga0134084_10147079 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300010329|Ga0134111_10228126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300010336|Ga0134071_10767341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300010339|Ga0074046_10795812 | Not Available | 553 | Open in IMG/M |
| 3300010339|Ga0074046_10803487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300010341|Ga0074045_11075000 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010359|Ga0126376_11055490 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300010359|Ga0126376_11097371 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010360|Ga0126372_10086023 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300010361|Ga0126378_11925629 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010361|Ga0126378_12652077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010366|Ga0126379_11191996 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300010376|Ga0126381_100678439 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300010376|Ga0126381_103147672 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010880|Ga0126350_10952794 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300011271|Ga0137393_10777444 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300011271|Ga0137393_11687461 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012096|Ga0137389_10255437 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300012096|Ga0137389_11575786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300012189|Ga0137388_10636718 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012200|Ga0137382_10713047 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012202|Ga0137363_10180162 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300012202|Ga0137363_10838428 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012203|Ga0137399_10058692 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300012203|Ga0137399_10215551 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300012203|Ga0137399_11504004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012205|Ga0137362_11763990 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012206|Ga0137380_10457529 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300012209|Ga0137379_10300788 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300012209|Ga0137379_10360348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
| 3300012209|Ga0137379_10704005 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012210|Ga0137378_11147276 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012357|Ga0137384_11508047 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012361|Ga0137360_10022117 | All Organisms → cellular organisms → Bacteria | 4264 | Open in IMG/M |
| 3300012361|Ga0137360_10336687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300012363|Ga0137390_11920690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012582|Ga0137358_10693191 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012683|Ga0137398_10034218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2906 | Open in IMG/M |
| 3300012683|Ga0137398_10356562 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012918|Ga0137396_10985811 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012922|Ga0137394_10418268 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300012923|Ga0137359_10974432 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012925|Ga0137419_11596421 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012944|Ga0137410_10307045 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300012948|Ga0126375_12059998 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012972|Ga0134077_10035003 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300012977|Ga0134087_10619883 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300015052|Ga0137411_1105399 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300015241|Ga0137418_10875933 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015241|Ga0137418_10880753 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300016270|Ga0182036_10838886 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300016294|Ga0182041_10679361 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300016357|Ga0182032_11294654 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300016357|Ga0182032_11350217 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300016422|Ga0182039_11357057 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300017932|Ga0187814_10434125 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300017932|Ga0187814_10437351 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300017933|Ga0187801_10210087 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300017934|Ga0187803_10304796 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300017994|Ga0187822_10014946 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300018060|Ga0187765_11286272 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300018086|Ga0187769_10143802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1742 | Open in IMG/M |
| 3300018468|Ga0066662_11226808 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300019788|Ga0182028_1334423 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300019789|Ga0137408_1251995 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300020140|Ga0179590_1070068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300020170|Ga0179594_10358208 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300020199|Ga0179592_10481177 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300020581|Ga0210399_10251211 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300020581|Ga0210399_11070504 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300020582|Ga0210395_10701750 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300020583|Ga0210401_10436951 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300021086|Ga0179596_10080139 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300021088|Ga0210404_10425385 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300021088|Ga0210404_10543568 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300021088|Ga0210404_10664600 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300021170|Ga0210400_10030456 | All Organisms → cellular organisms → Bacteria | 4188 | Open in IMG/M |
| 3300021170|Ga0210400_11424915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300021171|Ga0210405_10207126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1554 | Open in IMG/M |
| 3300021171|Ga0210405_10873983 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300021180|Ga0210396_10601297 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300021388|Ga0213875_10405716 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300021401|Ga0210393_10132688 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300021401|Ga0210393_11172162 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300021401|Ga0210393_11444405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300021404|Ga0210389_10258802 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300021406|Ga0210386_11768110 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300021432|Ga0210384_10569740 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300021433|Ga0210391_10291876 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300021477|Ga0210398_11514508 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300021478|Ga0210402_10176364 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300021478|Ga0210402_11786633 | Not Available | 541 | Open in IMG/M |
| 3300021479|Ga0210410_10001807 | All Organisms → cellular organisms → Bacteria | 19646 | Open in IMG/M |
| 3300021479|Ga0210410_10105828 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300022840|Ga0224549_1032166 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300024232|Ga0247664_1155400 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300024288|Ga0179589_10028619 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300024330|Ga0137417_1456827 | Not Available | 1676 | Open in IMG/M |
| 3300024331|Ga0247668_1036372 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300024331|Ga0247668_1105281 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025917|Ga0207660_10088778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2287 | Open in IMG/M |
| 3300025924|Ga0207694_10752398 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300026088|Ga0207641_12522700 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026300|Ga0209027_1099701 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300026318|Ga0209471_1018876 | All Organisms → cellular organisms → Bacteria | 3496 | Open in IMG/M |
| 3300026318|Ga0209471_1096170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
| 3300026330|Ga0209473_1281248 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300026333|Ga0209158_1095004 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300026371|Ga0257179_1022269 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026499|Ga0257181_1009715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1263 | Open in IMG/M |
| 3300026538|Ga0209056_10720598 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026557|Ga0179587_10341840 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300026557|Ga0179587_10617968 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300026921|Ga0207860_1012042 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300026945|Ga0207743_1030650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300027034|Ga0209730_1032565 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027376|Ga0209004_1083962 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027381|Ga0208983_1098042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300027605|Ga0209329_1052160 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300027645|Ga0209117_1128741 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027645|Ga0209117_1131420 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027669|Ga0208981_1120533 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027727|Ga0209328_10068125 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300027765|Ga0209073_10416354 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300027768|Ga0209772_10191935 | Not Available | 646 | Open in IMG/M |
| 3300027846|Ga0209180_10048344 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300027862|Ga0209701_10744232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300027867|Ga0209167_10665579 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027867|Ga0209167_10780727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300027875|Ga0209283_10401752 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300027903|Ga0209488_10424397 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300027903|Ga0209488_10925500 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027905|Ga0209415_10139733 | All Organisms → cellular organisms → Bacteria | 2477 | Open in IMG/M |
| 3300028536|Ga0137415_10653818 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300028536|Ga0137415_11002475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300029636|Ga0222749_10345120 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300029817|Ga0247275_1129870 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300030737|Ga0302310_10719803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031122|Ga0170822_16945110 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031231|Ga0170824_103038349 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031564|Ga0318573_10605470 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031640|Ga0318555_10490346 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031679|Ga0318561_10577587 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031713|Ga0318496_10203527 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300031718|Ga0307474_10000704 | All Organisms → cellular organisms → Bacteria | 23934 | Open in IMG/M |
| 3300031719|Ga0306917_10682089 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031720|Ga0307469_10798485 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031720|Ga0307469_12195873 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031740|Ga0307468_101826162 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031753|Ga0307477_10256402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300031753|Ga0307477_10888440 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031779|Ga0318566_10602278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300031819|Ga0318568_10490794 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031823|Ga0307478_10722324 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300031879|Ga0306919_10544447 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300031942|Ga0310916_10195957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300031954|Ga0306926_10016329 | All Organisms → cellular organisms → Bacteria | 8406 | Open in IMG/M |
| 3300031954|Ga0306926_12775304 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031959|Ga0318530_10467001 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031962|Ga0307479_10187693 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300031962|Ga0307479_11971803 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032001|Ga0306922_11091061 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300032041|Ga0318549_10384364 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300032066|Ga0318514_10583547 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032076|Ga0306924_11285024 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300032160|Ga0311301_10065341 | All Organisms → cellular organisms → Bacteria | 7832 | Open in IMG/M |
| 3300032180|Ga0307471_100019251 | All Organisms → cellular organisms → Bacteria | 4939 | Open in IMG/M |
| 3300032261|Ga0306920_100297752 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300032893|Ga0335069_10212897 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300032893|Ga0335069_10704846 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300032895|Ga0335074_10755643 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300032955|Ga0335076_11704051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300033289|Ga0310914_10083375 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
| 3300033290|Ga0318519_10804949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.40% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.47% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.47% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1026379142 | 3300000955 | Soil | MDTAYQPWIGQAVVLQVELGDLKVPLRARLLKDGGETLRVRIGDGW |
| JGI12637J13337_10059301 | 3300001137 | Forest Soil | MDSAYATWLGQAVVLQVALGDIKVPLRGTLLKDGDETVRMRIGDGWDVD |
| JGI12712J15308_101223132 | 3300001471 | Forest Soil | MENAYKAWVGQSVLLQVALGDIKVPLRGTLLKNGSETIRMRIG |
| Ga0052254_10155261 | 3300003152 | Sediment | MHNASNSSLRGTMEAGFNAWLGHAVVLQVALGDIKVPLRGKLLKEGGETVRMRIGEGWDV |
| JGI26341J46601_102205322 | 3300003219 | Bog Forest Soil | MTEAFNTWVGREVVLQVALGDIKVPLRGRLLKDSEETVRM |
| Ga0062590_1009979702 | 3300004157 | Soil | MDSAYAPWIGQQVVLQVALGEIKVPLRGTLLKDGGETVRMKIGEGWDVD |
| Ga0066680_105361411 | 3300005174 | Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKVGDETVRMRIGDGWDV |
| Ga0066673_101348441 | 3300005175 | Soil | MDSAFEAWIGQPVVLQVALGNIKVPLRGKLLKDGGETVRMRIGD |
| Ga0066388_1007705231 | 3300005332 | Tropical Forest Soil | MQNGYNVWLGHAVVLQVALGDIQVPLRGKLLKEGGDTVRM |
| Ga0068869_1004560362 | 3300005334 | Miscanthus Rhizosphere | MDSGYSAWIGLPVVLQVVLGDIKVPLRGKLLKEAGDTVRMRIGDG |
| Ga0070711_1004631192 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MASLRGYMEIGYNSWMGHSVVLQVALGDIRVPLRGKLLKE |
| Ga0066661_105195942 | 3300005554 | Soil | MTDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKDGGETIRMRIGDG |
| Ga0066692_101404821 | 3300005555 | Soil | MDSAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPE |
| Ga0066705_100219911 | 3300005569 | Soil | MDDTFKAWIGQPVLLQVALGEIKVPLRGKLLKDGGE |
| Ga0066654_101868202 | 3300005587 | Soil | MDSAFAPWIGLPVILQVALGDIKVPLRGRLLKDSGET |
| Ga0066903_1033952221 | 3300005764 | Tropical Forest Soil | MQNGYAVWLGQAVVLKVELGDIQVPLRGKLLKENSETVR |
| Ga0066696_104518701 | 3300006032 | Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKDGDD |
| Ga0075024_1005664212 | 3300006047 | Watersheds | MDSAYATWIGQPVVLQLALGDIKVPLRGKLLKDGGETV |
| Ga0075028_1000973803 | 3300006050 | Watersheds | MDSGYSAWIGLPVVLQVALGDIKVPLRGKLLKDGGDTVRMRIGDGWD |
| Ga0075018_108031441 | 3300006172 | Watersheds | MDMAYASWIGLPVVLQVVSGDIKVPLRGKLLKDKGDTVRIRIDGSDIDIY |
| Ga0070712_1011380872 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTAYLAWIGQAVVLQVALGDVKVPLRGRLLKDGGETLRMRIG |
| Ga0075436_1007174742 | 3300006914 | Populus Rhizosphere | MDSAYQPWIGQAVVLQVALGELRVPLRGRLMKDGGETLRMRI |
| Ga0099791_106026712 | 3300007255 | Vadose Zone Soil | MDAEFKAWIGQPVVLQVARGNVKVPLRGKLLKDGSDTI |
| Ga0099793_102307931 | 3300007258 | Vadose Zone Soil | MDSAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPETVRMRI |
| Ga0099794_100299334 | 3300007265 | Vadose Zone Soil | VDKAFKTWIGHPVVLQVALGDIKVPLRGRLLKEGGETVRMRIGDG |
| Ga0099794_101157191 | 3300007265 | Vadose Zone Soil | MHSAFAAWIGHPVVLQVALGDIKVPLRGKLLKEGGDTLRMRIGEGWDVD |
| Ga0099829_109142551 | 3300009038 | Vadose Zone Soil | MDSAFKAWVGHPVVLQVALGNIKVPLRGKLLKEGGETV |
| Ga0099829_114272852 | 3300009038 | Vadose Zone Soil | MDGAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGGETIRMRIGDGWDI |
| Ga0099830_108310731 | 3300009088 | Vadose Zone Soil | MDSAFKAWVGQPVVLQVALGNIKVPLRGKLLKEGGETV |
| Ga0099830_115366182 | 3300009088 | Vadose Zone Soil | MDNAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGDETVRMRIGDGWDV |
| Ga0099828_102535802 | 3300009089 | Vadose Zone Soil | MDGAFKAWIGHPVVLQVALGNIKVPLRGKLLKDGG* |
| Ga0099828_103101863 | 3300009089 | Vadose Zone Soil | MDSAYATWIGQPVVLQLALGDIKVPLRGKLLKDGGETVRMRIGDGWDV |
| Ga0099827_100361765 | 3300009090 | Vadose Zone Soil | MNNAFKTWIGHPVVLQVALGDIKVPLRGKLLKDGGETV |
| Ga0099827_101739603 | 3300009090 | Vadose Zone Soil | MDSAFKAWVGQPVILQVALGDIKVPLRGKLLKDGDETVRMRIG |
| Ga0099827_111319002 | 3300009090 | Vadose Zone Soil | MDNAFAPWIGQAVVLQVALGEGKVALRGKLVKDCG |
| Ga0066709_1004105064 | 3300009137 | Grasslands Soil | MDIAYQTWIGQAVVLQVALGDIKVPLRGRVMKDGGETVRMR |
| Ga0126374_107981112 | 3300009792 | Tropical Forest Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLMKDGSDTVRMRIGE |
| Ga0126374_113704082 | 3300009792 | Tropical Forest Soil | MESAFKAWIGHPVVLQVALGDIRVPLRGRLLKDGSDTV |
| Ga0126380_107875142 | 3300010043 | Tropical Forest Soil | MDSAYQPWIGQAVVLQVVLGELKVPLRGRVLKDGGE |
| Ga0126373_123227361 | 3300010048 | Tropical Forest Soil | MDSAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGSDTVRMRIG |
| Ga0134084_101470791 | 3300010322 | Grasslands Soil | MESAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGSDTVRM |
| Ga0134111_102281261 | 3300010329 | Grasslands Soil | MDSAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPETVRMRIGEG* |
| Ga0134071_107673412 | 3300010336 | Grasslands Soil | MDDAFAPWIGQAVVLQVALGEGKVALRGKLVKDCGEAVRVRLGENNGQGW |
| Ga0074046_107958122 | 3300010339 | Bog Forest Soil | MQTGYNVWMGHAVVLQVALGDIQVPLRGKLLKEAGDTVRMRIGEGWD |
| Ga0074046_108034871 | 3300010339 | Bog Forest Soil | MNTGYANWMGHAVVLQVELGDIKVPLRGKLLKENRETVRMRIGEGWD |
| Ga0074045_110750001 | 3300010341 | Bog Forest Soil | MNTGYTNWLGHAVVLHVEVGDIKVPLRGKLLKENPET |
| Ga0126376_110554902 | 3300010359 | Tropical Forest Soil | MDTAYQTWIGESVVLQVALGDIKVPLKGKLLKDGGETIRMRVGDGWDIDIYK |
| Ga0126376_110973711 | 3300010359 | Tropical Forest Soil | MQSAFATWIGQPVVLQVALGDIKVPLRGKLLKEGGDTLRVR |
| Ga0126372_100860231 | 3300010360 | Tropical Forest Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLMKDGSDTVRMRIGEGW |
| Ga0126378_119256292 | 3300010361 | Tropical Forest Soil | MQKGYEVWLGQAVVLKVELGDIQVPLRGKLLKENSETVRMRIGEG |
| Ga0126378_126520771 | 3300010361 | Tropical Forest Soil | MRQILLEGSPMEAGYNAWLGHAVVLQVALGDIKVPLRGKLLKEGGETVRMR |
| Ga0126379_111919962 | 3300010366 | Tropical Forest Soil | MKSAFKAWVGQPVVLQVALGDIKVPLRGKLMKDGS |
| Ga0126381_1006784391 | 3300010376 | Tropical Forest Soil | MESAFKAWIGHPVVLQVALGDIKVPLRGRLLKDGSDTV |
| Ga0126381_1031476722 | 3300010376 | Tropical Forest Soil | MQNGYTVWLGQAVVLKVELGDIQVPLRGKLLKENSETVRMRIGEGWDV |
| Ga0126350_109527941 | 3300010880 | Boreal Forest Soil | MENAYKAWVGQSVLLQVALGDIKVPLRGTLLKDGSETIRMRIG |
| Ga0137393_107774442 | 3300011271 | Vadose Zone Soil | MDSAFKAWVGQPVVLQVALGNIKVPLRGKLLKEGGETVRM |
| Ga0137393_116874612 | 3300011271 | Vadose Zone Soil | MDSAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPETVRMR |
| Ga0137389_102554371 | 3300012096 | Vadose Zone Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKVGDKTIRMRIGDGWD |
| Ga0137389_115757861 | 3300012096 | Vadose Zone Soil | MENGFKAWVGQPVVLQVALGDIKVPLRGKLLKDGDETVRMRIGD |
| Ga0137388_106367181 | 3300012189 | Vadose Zone Soil | METAFKAWIGQRVVLQVALGDIRVPLRGKLLKDGDDTV |
| Ga0137382_107130471 | 3300012200 | Vadose Zone Soil | MDTAYQPWIGQAVVLQVALGDVKVPLRGRLLKDAGETL |
| Ga0137363_101801624 | 3300012202 | Vadose Zone Soil | MDSAYTAWIGQPVVLQVALGDIKVPLRGKLLKDGGE |
| Ga0137363_108384281 | 3300012202 | Vadose Zone Soil | MDDAFKAWVGQPVVLQVALGDIKVPLRGRLLKDGDD |
| Ga0137399_100586924 | 3300012203 | Vadose Zone Soil | VDNAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGGETVRMRIGEGWDV |
| Ga0137399_102155513 | 3300012203 | Vadose Zone Soil | VDKAFKTWIGHPVVLQVALGDIKVPLRGKLLKDGGETVRM |
| Ga0137399_115040041 | 3300012203 | Vadose Zone Soil | MDAEFKAWIGQPVVLQVALGNVKVPLRGKLLKDGGETIRMRIGEGWDV |
| Ga0137362_117639901 | 3300012205 | Vadose Zone Soil | LSGRTIEGAKVDKAFKTWIGHPVVLQVALGDIKVPLRGRLLKEGGETVRMRIGDG |
| Ga0137380_104575291 | 3300012206 | Vadose Zone Soil | MESAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPETVRMRIG |
| Ga0137379_103007881 | 3300012209 | Vadose Zone Soil | MDDAFKAWIGQPVVLQVALGEIKVPLRGKLLKDGSETVRMRIGEGWDV |
| Ga0137379_103603483 | 3300012209 | Vadose Zone Soil | MDSAFKVWIGQPVVLQVALGEVKVPLRGKLLKDSGETV |
| Ga0137379_107040052 | 3300012209 | Vadose Zone Soil | MDTAYQPWIGQAVVLQVALGDVKVPLRGRLLMDGGETLRMRIGDG |
| Ga0137378_111472762 | 3300012210 | Vadose Zone Soil | MESAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPETVRMR |
| Ga0137384_115080471 | 3300012357 | Vadose Zone Soil | MDSAFKTWIGQPVVLQVALGDIKVPLRGKLLKDGPET |
| Ga0137360_100221176 | 3300012361 | Vadose Zone Soil | VDNAFKAWIGQPVVLQVALGDIKVPLRGRLLKDGEEN |
| Ga0137360_103366871 | 3300012361 | Vadose Zone Soil | MDSAFATWIGRPVVLQVALGESRVGVRGILLRDGADTLRVRL |
| Ga0137390_119206901 | 3300012363 | Vadose Zone Soil | MDKSFTAWVGQPVVLQVALGDIKVPLRGKLLKVGGETV |
| Ga0137358_106931912 | 3300012582 | Vadose Zone Soil | LDSADQPWIGHAVVLPVAVGDIKVPLRGRSLRDGG |
| Ga0137398_100342181 | 3300012683 | Vadose Zone Soil | MDDAFKAWIGQPVVLQVALGEIKVPLRGKLLKDGAETVRMRIGEGWD |
| Ga0137398_103565621 | 3300012683 | Vadose Zone Soil | MTDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKDGGETIRMR |
| Ga0137396_109858111 | 3300012918 | Vadose Zone Soil | VDKAFKTWIGHPVVLQVALGDIKVPLRGRLLKEGG |
| Ga0137394_104182682 | 3300012922 | Vadose Zone Soil | MPSVFATWIGQPVVLQVALGDIRVPLRGKLLKEGGD |
| Ga0137359_109744322 | 3300012923 | Vadose Zone Soil | MDTAYLAWIGQAVVLQVALGDVKVPLRGRLLKDGGETLRMRIGD |
| Ga0137419_115964211 | 3300012925 | Vadose Zone Soil | LDSAYQPWIGHAVVLQVALGDIKVPLRGRILRDGGET |
| Ga0137410_103070451 | 3300012944 | Vadose Zone Soil | MPSVFATWIGQPVVLQVALGDIRVPLRGKLLKEGCDTLKM |
| Ga0126375_120599981 | 3300012948 | Tropical Forest Soil | MESAFKAWVGHPVVLQVALGDIKVPLRGKLMKDGSDTVRMRIGE |
| Ga0134077_100350033 | 3300012972 | Grasslands Soil | MDSAFKAWVGQPVVLQVDLGDIKVPLRGKLLKDGED |
| Ga0134087_106198831 | 3300012977 | Grasslands Soil | MDDTFKAWIGQPVLLQVALGEIKVPLRGKLLKDGGETVRMRIGEGWDVD |
| Ga0137411_11053992 | 3300015052 | Vadose Zone Soil | MDSAFEAWIGQPVVLQVALGNIKVPLRGKLLKDGGETVRMRIGDGWD |
| Ga0137418_108759332 | 3300015241 | Vadose Zone Soil | MDIAYQPWIGQAVVLQVALGDIKVPLRGRVMKDGGETVRMRIGD |
| Ga0137418_108807532 | 3300015241 | Vadose Zone Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKDGDDTV |
| Ga0182036_108388862 | 3300016270 | Soil | MQNGYTVWLGQAVVLKVELGDIQVPLRGKLLKENSETVRMR |
| Ga0182041_106793612 | 3300016294 | Soil | MDTAYKPWIGQAVVLQVALGDIKVPLRGRLLKDGGETMRMSIGEG |
| Ga0182032_112946542 | 3300016357 | Soil | MQNGYKVWLGQAVVLKVELGDIQVPLRGKLLKENSETVRMRIG |
| Ga0182032_113502171 | 3300016357 | Soil | MEAGFNAWVGHAVVLQVALGDIKVPLRGKLLREGGETVRMRIGEGWDVD |
| Ga0182039_113570572 | 3300016422 | Soil | MQTGYNVWLGHAVVLQVALGDIQVPLRGKLLKESGDTVRMRIGDGWDVD |
| Ga0187814_104341251 | 3300017932 | Freshwater Sediment | MDNAFKSWIGHPVVLQVALGDIKVPLRGKLLKDGGETVR |
| Ga0187814_104373512 | 3300017932 | Freshwater Sediment | MQTGFNSWLGHAVVLQVALGNIQVPLRGKLLKEGGDT |
| Ga0187801_102100871 | 3300017933 | Freshwater Sediment | MQTGFNVWLGHAVVLQVALGDIQVPLRGKLLKESGDTVRMRI |
| Ga0187803_103047962 | 3300017934 | Freshwater Sediment | MDRAYTAWIGHPVVLQVALGDIKVPLRGKLLKDGGDTV |
| Ga0187822_100149461 | 3300017994 | Freshwater Sediment | MDTAYQPWIGQAVVRQVALGDIKVPLRGRLLRDGGETLRMRIG |
| Ga0187765_112862721 | 3300018060 | Tropical Peatland | MDTAYQPWIGESVVLQVALGDIKVPLRGKLLKDGGETIRMRV |
| Ga0187769_101438023 | 3300018086 | Tropical Peatland | MESAFKSWIGHPVVLQVALGDIKVPLRGKLLKDGDD |
| Ga0066662_112268081 | 3300018468 | Grasslands Soil | MDSGYSDWIGLPVVLQVALGDIKVPLRGKLLKEAGDTVRMR |
| Ga0182028_13344234 | 3300019788 | Fen | MNTGYTNWLGHAVVLHVELGDIKVPLRGKLLKENRERCG |
| Ga0137408_12519952 | 3300019789 | Vadose Zone Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKVGDETVR |
| Ga0179590_10700683 | 3300020140 | Vadose Zone Soil | MDSAFATWIGRPVVLQVALGESRVGVRGMLLRDGADTLRVR |
| Ga0179594_103582081 | 3300020170 | Vadose Zone Soil | VDKAFKTWIGHPVVLQVALGDIKVPLRGRLLKEGGETVRMRIG |
| Ga0179592_104811771 | 3300020199 | Vadose Zone Soil | MPSVFATWIGQPVVLQVALGDIRVPLRGKLLKEGG |
| Ga0210399_102512111 | 3300020581 | Soil | MDSAYATWLGHSVVLQVALGDIKVPLRGTLLKDGEDTVRMRIGEG |
| Ga0210399_110705042 | 3300020581 | Soil | MDSAYATWLGQPVVLQVALGDIKVPLRGTLLKDGGET |
| Ga0210395_107017502 | 3300020582 | Soil | MEIGYNGWMGHSVVLQVALGDIRVPLRGKLLKENGDS |
| Ga0210401_104369511 | 3300020583 | Soil | MESGYNAWVGQPVVLQVALGDIKVPLRGKLLKEGGDTVR |
| Ga0179596_100801391 | 3300021086 | Vadose Zone Soil | MPSAFATWIGQPVVLQVALGDIRVPLRGKLLKEGC |
| Ga0210404_104253852 | 3300021088 | Soil | MDSAFEAWIGQPVVLQVALGNIKVPLRGKLLKDGGETVR |
| Ga0210404_105435682 | 3300021088 | Soil | MDMAYASWIGLPVVLQVVLGDIKVPLRGKLLKDKGETVRIRIDGSDIDI |
| Ga0210404_106646001 | 3300021088 | Soil | MEAGYNAWLGQAVVLQVALGDIKVPLRGRLLKEGGE |
| Ga0210400_100304566 | 3300021170 | Soil | MDGAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGG |
| Ga0210400_114249152 | 3300021170 | Soil | MHSAFAPWIGHPVVLQVALGDIKVPLRGKLLKEGGDTLRMRIG |
| Ga0210405_102071263 | 3300021171 | Soil | MESAFALWVGRPVVLRVALGDCKVGVRGTLLKDGTETLK |
| Ga0210405_108739831 | 3300021171 | Soil | MQPSAFAMWIGQPVVLQVALGDIRVPLRGKLLKEG |
| Ga0210396_106012971 | 3300021180 | Soil | MDSAYKSWVGLPVVLRVALGDIKVPLRGKMLKDGGDTIRM |
| Ga0213875_104057162 | 3300021388 | Plant Roots | MDMAYASWIGLPVVLQVVLGDIKVPLRGKLLKDKGETV |
| Ga0210393_101326883 | 3300021401 | Soil | MDSAYATWLGQSVVLQVALGDIKVPLRGTLLKDGEDTVRMRI |
| Ga0210393_111721622 | 3300021401 | Soil | MEAGYNAWLGQAVVLQVALGDIKVPLRGRLLKEGGETV |
| Ga0210393_114444051 | 3300021401 | Soil | MIDAFQPWVGQSVVLQVALGDIKVPLRGKLLRDSEETVRMRIGEGWDV |
| Ga0210389_102588023 | 3300021404 | Soil | MDMAYASWIGLPVVLQVVLGDIKVPLRGKLLKDKGET |
| Ga0210386_117681101 | 3300021406 | Soil | MESAYATWLGQPVVLQVALGDIKVPLRGTLLKDGDDTVRVRIGDGWD |
| Ga0210384_105697401 | 3300021432 | Soil | MDSAYQPWIGQPVVLQVALGDIRVPLRGKLLKDGGETV |
| Ga0210391_102918761 | 3300021433 | Soil | MDSAYEAWMGQPVVLQVALGDIKVPLRGTLLKDGG |
| Ga0210398_115145081 | 3300021477 | Soil | MEAGYNAWLGQAVVLQVALGDIKVPLRGRLLKEGG |
| Ga0210402_101763641 | 3300021478 | Soil | MDSGYSAWIGLPVVLQVALGDIKVPLRGKLLKDGGDTVRM |
| Ga0210402_117866332 | 3300021478 | Soil | MEAGFNAYLGHAVVLQVALGEIRVPLRGKLLKEGGETV |
| Ga0210410_100018071 | 3300021479 | Soil | VDSAFKSWIGQPVVLQVALGDIKVPLRGKLLKDGG |
| Ga0210410_101058285 | 3300021479 | Soil | MDSAYATWLGQSVVLQVALGDIKVPLRGTLLKDGDETVRMRI |
| Ga0224549_10321661 | 3300022840 | Soil | MKSGYEAWIGVPVVLQVALGDSKVPLRGKLLKESVDTVR |
| Ga0247664_11554002 | 3300024232 | Soil | MDAAYQPWIGQAVVLQVALGELKVPLRGRLLKDDGETLRMKV |
| Ga0179589_100286191 | 3300024288 | Vadose Zone Soil | MDSAFEAWIGQPVVLQVALGNIKVPLRGKLLKDGGETVRMRI |
| Ga0137417_14568273 | 3300024330 | Vadose Zone Soil | MTDSAFKAWVGQPVVLQVRWETSSAATRELLKDGGETVRMRIGDGWDVESIGHDFGG |
| Ga0247668_10363721 | 3300024331 | Soil | MDAAYQPWIGQAVVLQVALGELKVPLRGRLLKDDG |
| Ga0247668_11052812 | 3300024331 | Soil | MDIAYQPWIGQAVVLQVALGDIKVPLRGRVMKDGGDTVRMRIGD |
| Ga0207660_100887784 | 3300025917 | Corn Rhizosphere | MDSAYAPWIGQQVVLQVALGEIKVPLRGTLLKDGGETVRMKIGEG |
| Ga0207694_107523982 | 3300025924 | Corn Rhizosphere | MDLAYASWIGLPVVLQVVSGDIKVPLRGKLLKDKGD |
| Ga0207641_125227002 | 3300026088 | Switchgrass Rhizosphere | MDTAYQPWVGQAVVLQVALGDIMVPLRGRLLKDGGE |
| Ga0209027_10997012 | 3300026300 | Grasslands Soil | MDSAFAPWIGLPVILQVALGDIKVPLRGRLLKDSG |
| Ga0209471_10188765 | 3300026318 | Soil | MDSTFKPWIGQPVMLQVALGEIKVPLRGKLLKDGGETVRMRIGEGWDV |
| Ga0209471_10961702 | 3300026318 | Soil | MDSAFEAWIGQPVVLQVALGNIKVPLRGKLLKDGEDTV |
| Ga0209473_12812482 | 3300026330 | Soil | MESAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGSDTV |
| Ga0209158_10950041 | 3300026333 | Soil | MDSAFKAWVGQPVVLQVALGDIKVPLRGKLLKDGEDTVRMRIGDGW |
| Ga0257179_10222692 | 3300026371 | Soil | MDAEFKAWIGQPVVLQVALGNVKVPLRGKLLKDGGETIRM |
| Ga0257181_10097151 | 3300026499 | Soil | MDSAFKAWIGQPVVLQVAVGDIKVPLRGKLLKDGGETVRMRIGE |
| Ga0209056_107205982 | 3300026538 | Soil | MDTAYQPWIGQAVVLQVALGEVKVPLRGRLLKDGGETLRMRIGDG |
| Ga0179587_103418402 | 3300026557 | Vadose Zone Soil | MPSVFATWIGQPVVLQVALGDIRVPLRGKLLKEGGDT |
| Ga0179587_106179682 | 3300026557 | Vadose Zone Soil | MDSAYATWLGQSVVLQVALGDIKVPLRGTLLKDGEDTVRMRIGEGW |
| Ga0207860_10120421 | 3300026921 | Tropical Forest Soil | MQTGYNVWLGHAVVLQVALGDIQVPLRGKLLKESGDT |
| Ga0207743_10306501 | 3300026945 | Tropical Forest Soil | MQTGFNGWLGHAVILQVALGDIKVPLRGKLLKENGETVRMRIGEGW |
| Ga0209730_10325652 | 3300027034 | Forest Soil | MDGAFKAWVGQPVVLQLALGDIKVPLRGKLLKDGNDT |
| Ga0209004_10839621 | 3300027376 | Forest Soil | MQTGYNVWLGQAVVLQVALGDIKVPLRGRLLKEGGE |
| Ga0208983_10980421 | 3300027381 | Forest Soil | MDSAFATWIGRPVVLQVALGESRVGVRGMLLRDGADTLRV |
| Ga0209329_10521601 | 3300027605 | Forest Soil | MDSAFEAWIGQPVVLQVALGNIKVPLRGKLLKDGGETVRMRIGDGWDVD |
| Ga0209117_11287411 | 3300027645 | Forest Soil | MLTGYNDWLGHAVVLQVALGDIQVPLRGKLLKEGGDTVRMRIG |
| Ga0209117_11314201 | 3300027645 | Forest Soil | VDNAFKAWIGQPVVLQVALGDIKVPLRGKLLKDGGETVR |
| Ga0208981_11205331 | 3300027669 | Forest Soil | MPSAFATWIGQPVVLQVALGDIRVPLRGKLLKEGCDTLKM |
| Ga0209328_100681251 | 3300027727 | Forest Soil | MDTAYRVWMGHAVVLQVAVGDIKVPLRGRLLKEAGET |
| Ga0209073_104163542 | 3300027765 | Agricultural Soil | MESAFKAWIGHPVVLQVALGDIKVPLRGKLLKDGSDTVR |
| Ga0209772_101919351 | 3300027768 | Bog Forest Soil | MEAGYNAYLGHAVVLQVALGEIQVPLRGRLLKEGGETVRM |
| Ga0209180_100483441 | 3300027846 | Vadose Zone Soil | MVEAAYAPWIGQAVVLQVALGDIKVPLRGRVLEDSGTA |
| Ga0209701_107442322 | 3300027862 | Vadose Zone Soil | MDSAFEAWIGQPVVLQVALGNIKVPLRGKLLKDGGETVRM |
| Ga0209167_106655791 | 3300027867 | Surface Soil | MESAYATWIGRPVVLQLALGDIKVPLRGKLLKEGGDTVR |
| Ga0209167_107807271 | 3300027867 | Surface Soil | MDSAYETWVGQPVVLQVALGDIKVPLRGTMLKDGGETVRMRIGEGWDVD |
| Ga0209283_104017522 | 3300027875 | Vadose Zone Soil | MDGAFKAWIGHPVVLQVELGNIKVPLRGKLLKDGGETV |
| Ga0209488_104243971 | 3300027903 | Vadose Zone Soil | MHSAFAAWIGQPVVLQIALGDIKVPLRGKLLKEGG |
| Ga0209488_109255002 | 3300027903 | Vadose Zone Soil | MDTAYQPWIGQAVVLQVALGEVKVPLRGRLLMDGGETLRM |
| Ga0209415_101397334 | 3300027905 | Peatlands Soil | MNSAYATWLGQSVVLQVALGDIKVPLRGTLLRDGEDTVRMRIGEGW |
| Ga0137415_106538182 | 3300028536 | Vadose Zone Soil | MDSAFKAWIGQPVVLQVALGEIKVPLRGKLLKDGGETVRMRIGE |
| Ga0137415_110024752 | 3300028536 | Vadose Zone Soil | VDNAFKAWVGQPVVLQVALGDIKVPLRGKLLKDGDDTIRMR |
| Ga0222749_103451202 | 3300029636 | Soil | MESAYTTWVGQPVVLQVALGDIKLPLRGTLLKDGAETV |
| Ga0247275_11298701 | 3300029817 | Soil | MNTGYTNWLGHAVVLQVELGDIKVPLRGKLLKENRETV |
| Ga0302310_107198032 | 3300030737 | Palsa | MKSGYEAWIGVPVVLQVALGDSKVPLRGKLLKESVDTVRMRIGDGWD |
| Ga0170822_169451101 | 3300031122 | Forest Soil | MDTAYLAWIGQAVVLQVALGDVKVPLRGRLLKDSGETLRMRI |
| Ga0170824_1030383492 | 3300031231 | Forest Soil | MDTAYLAWIGQAVVLQVALGDVKVPLRGRLLKDSGE |
| Ga0318573_106054701 | 3300031564 | Soil | MEAGFNAWVGHAVVLQVALGDIKVPLRGKLLREGG |
| Ga0318555_104903462 | 3300031640 | Soil | MDSAFKAWIGHPVVLQVALGDIKVPLRGKLLKDGSDT |
| Ga0318561_105775871 | 3300031679 | Soil | MDNPYQTWIGESVVLQVALGDIRVPLRGRLLKDGGKT |
| Ga0318496_102035271 | 3300031713 | Soil | MQNGYAVWLGQAVVLKVELGDIQVPLRGKLLKENSETVRMRIGEGWDVD |
| Ga0307474_100007041 | 3300031718 | Hardwood Forest Soil | MPSVFAMWIGQPVVLQVALGDIRVPLRGKLLKEGGD |
| Ga0306917_106820891 | 3300031719 | Soil | MQNGYTVWLGQAVVLKVELGDIQVPLRGKLLKENSDTVRMRIGEGWDV |
| Ga0307469_107984851 | 3300031720 | Hardwood Forest Soil | MDTAYQPWIGQAVVLQVALGEVKVPLRGRLLMDGGETLRMRIGDG |
| Ga0307469_121958732 | 3300031720 | Hardwood Forest Soil | MEIGYNGWMGHSVVLQVALGDIRVPLRGKLLKENGD |
| Ga0307468_1018261621 | 3300031740 | Hardwood Forest Soil | MDTAYQPWIGQAVVLQVALGEVKVPLRGRLLMDGGETL |
| Ga0307477_102564022 | 3300031753 | Hardwood Forest Soil | MDSAFKAWVGHPVVLQVALGDIKVPLRGKLLKVGDKT |
| Ga0307477_108884402 | 3300031753 | Hardwood Forest Soil | MDSAYATWLGQSVVLQVALGDIKVPLRGTLLKDGEDTVRMRIGE |
| Ga0318566_106022781 | 3300031779 | Soil | MQTGYNVWLGQAVVLQVALGDIKVPLRGKLLKENGDTVRMRI |
| Ga0318568_104907942 | 3300031819 | Soil | MQTGYNVWLGQAVVLQVALGDIKVPLRGKLLKENGDTVR |
| Ga0307478_107223242 | 3300031823 | Hardwood Forest Soil | MDTAYLAWIGQAVVLQVALGDVKVPLRGRLLKDGGETLRMRIGDG |
| Ga0306919_105444471 | 3300031879 | Soil | MQNGYTVWLGQAVVLKVELGDIQVPLRGKLLKENSDTVRMRIGEGWD |
| Ga0310916_101959571 | 3300031942 | Soil | MQNGYAVWLGQAVVLKVELGDIQVPLRGKLLKENSETVRMRIGEGW |
| Ga0306926_1001632910 | 3300031954 | Soil | MKNGYEVWLGQAVVLKVELGDIQVPLRGRLLKENSE |
| Ga0306926_127753042 | 3300031954 | Soil | MEAGYNAWLGHAVVLQVALGDIKVPLRGKLLKEGGETVRMR |
| Ga0318530_104670011 | 3300031959 | Soil | MDSAFKAWIGHPVVLQVVLGDIKVPLRGRLLKDGGDTV |
| Ga0307479_101876933 | 3300031962 | Hardwood Forest Soil | MDKAFKAWIGQPVVLQVALGDIKVPLRGKLLKVGVETVRMRI |
| Ga0307479_119718032 | 3300031962 | Hardwood Forest Soil | MDTAYLAWIGQAVVLQVALGDVKVPLRGRLLKDSGETLRMRIGD |
| Ga0306922_110910612 | 3300032001 | Soil | MDAAYQPWIGQAVVLQVALGDVKVPLRGRLLRDSGET |
| Ga0318549_103843642 | 3300032041 | Soil | MQNGYAVWLGQAVVLKVELGDIQVPLRGKLLKENSETVRMRI |
| Ga0318514_105835471 | 3300032066 | Soil | MQKGYEVWLGQAVVLKVELGDIQVPLRGKLLKENSDTVRMRIGEGWD |
| Ga0306924_112850241 | 3300032076 | Soil | MDAAYQPWIGQAVVLQVALGDVKVPLRGRLLRDSGE |
| Ga0311301_1006534110 | 3300032160 | Peatlands Soil | MTTGYSNWLGRAVVLHVEVGDIKVPLRGKRLKENPETVRVR |
| Ga0307471_1000192511 | 3300032180 | Hardwood Forest Soil | MEAGYNAWLGQAVVLQVALGDIKVPLRGRLLKEGGET |
| Ga0306920_1002977524 | 3300032261 | Soil | MQTAYNVWVGQPVVLQVALGNIKVPLRGKLLKEAGDTVRMRIGDGWDV |
| Ga0335069_102128971 | 3300032893 | Soil | MEAGYNAWLGHAVVLQVALGDIKVPLRGKLLKEGGETVRMRIGEG |
| Ga0335069_107048461 | 3300032893 | Soil | MEAGFNAWLGHAVVLQVALGDIKVPLRGKLLKEGGETVRMRIGEGWD |
| Ga0335074_107556431 | 3300032895 | Soil | MQTGYEMWVGQPVVLQVTLGDIQVPLRGKLLKEGGDTV |
| Ga0335076_117040512 | 3300032955 | Soil | MDMAYASWIGLPVVLQVVSGDIKVPLRGKLLKDKGETVRIRI |
| Ga0310914_100833754 | 3300033289 | Soil | MQKGYEVWLGQAVVLKVELGDIQVPLRGKLLKENSDTVRMRI |
| Ga0318519_108049492 | 3300033290 | Soil | MQTGYNVWLGQAVVLQVALGDIKVPLRGKLLKENGDTVRMRIGEGWDVD |
| ⦗Top⦘ |