| Basic Information | |
|---|---|
| Family ID | F022471 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 214 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MDVVTIAVVGVILVSYLVGSLTSSVETEQELPHRY |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 214 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.16 % |
| % of genes near scaffold ends (potentially truncated) | 14.49 % |
| % of genes from short scaffolds (< 2000 bps) | 60.75 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.804 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (20.093 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.168 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.009 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.03% β-sheet: 0.00% Coil/Unstructured: 53.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 214 Family Scaffolds |
|---|---|---|
| PF00719 | Pyrophosphatase | 30.37 |
| PF02687 | FtsX | 5.14 |
| PF03814 | KdpA | 3.27 |
| PF00072 | Response_reg | 2.34 |
| PF12710 | HAD | 2.34 |
| PF01979 | Amidohydro_1 | 1.87 |
| PF13424 | TPR_12 | 1.40 |
| PF00263 | Secretin | 1.40 |
| PF01039 | Carboxyl_trans | 1.40 |
| PF04020 | Phage_holin_4_2 | 1.40 |
| PF02590 | SPOUT_MTase | 0.93 |
| PF07687 | M20_dimer | 0.93 |
| PF00990 | GGDEF | 0.93 |
| PF02410 | RsfS | 0.93 |
| PF02321 | OEP | 0.47 |
| PF00584 | SecE | 0.47 |
| PF01053 | Cys_Met_Meta_PP | 0.47 |
| PF13899 | Thioredoxin_7 | 0.47 |
| PF13683 | rve_3 | 0.47 |
| PF00227 | Proteasome | 0.47 |
| PF12840 | HTH_20 | 0.47 |
| PF08241 | Methyltransf_11 | 0.47 |
| PF13374 | TPR_10 | 0.47 |
| PF00753 | Lactamase_B | 0.47 |
| PF07883 | Cupin_2 | 0.47 |
| PF07244 | POTRA | 0.47 |
| PF12697 | Abhydrolase_6 | 0.47 |
| PF13601 | HTH_34 | 0.47 |
| PF12704 | MacB_PCD | 0.47 |
| PF13188 | PAS_8 | 0.47 |
| PF00884 | Sulfatase | 0.47 |
| PF00171 | Aldedh | 0.47 |
| PF02371 | Transposase_20 | 0.47 |
| PF00456 | Transketolase_N | 0.47 |
| PF07228 | SpoIIE | 0.47 |
| PF00903 | Glyoxalase | 0.47 |
| PF01546 | Peptidase_M20 | 0.47 |
| PF07681 | DoxX | 0.47 |
| PF02578 | Cu-oxidase_4 | 0.47 |
| PF00486 | Trans_reg_C | 0.47 |
| PF01264 | Chorismate_synt | 0.47 |
| PF13155 | Toprim_2 | 0.47 |
| PF01594 | AI-2E_transport | 0.47 |
| PF04972 | BON | 0.47 |
| PF14559 | TPR_19 | 0.47 |
| PF08867 | FRG | 0.47 |
| PF00342 | PGI | 0.47 |
| PF00248 | Aldo_ket_red | 0.47 |
| PF02683 | DsbD | 0.47 |
| PF01758 | SBF | 0.47 |
| PF14522 | Cytochrome_C7 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 214 Family Scaffolds |
|---|---|---|---|
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 30.37 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 3.27 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 1.40 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.40 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.40 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.40 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.47 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.47 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.47 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.47 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.47 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.47 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.47 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.47 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.47 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.47 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.47 |
| COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.47 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.47 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.47 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.47 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.47 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.47 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.47 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.80 % |
| Unclassified | root | N/A | 47.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000731|JGI12381J11899_1017132 | Not Available | 580 | Open in IMG/M |
| 3300003219|JGI26341J46601_10098855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300003223|JGI26343J46809_1009419 | Not Available | 744 | Open in IMG/M |
| 3300003368|JGI26340J50214_10010121 | Not Available | 2994 | Open in IMG/M |
| 3300003369|JGI24140J50213_10050497 | Not Available | 1476 | Open in IMG/M |
| 3300004080|Ga0062385_10458089 | Not Available | 777 | Open in IMG/M |
| 3300004092|Ga0062389_100971522 | Not Available | 1034 | Open in IMG/M |
| 3300004092|Ga0062389_102240321 | Not Available | 719 | Open in IMG/M |
| 3300004152|Ga0062386_100036894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3649 | Open in IMG/M |
| 3300004152|Ga0062386_100091760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2327 | Open in IMG/M |
| 3300004152|Ga0062386_100652797 | Not Available | 862 | Open in IMG/M |
| 3300004152|Ga0062386_101666314 | Not Available | 532 | Open in IMG/M |
| 3300005529|Ga0070741_10030705 | All Organisms → cellular organisms → Bacteria | 7521 | Open in IMG/M |
| 3300005533|Ga0070734_10005175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 11733 | Open in IMG/M |
| 3300005538|Ga0070731_10331635 | Not Available | 1010 | Open in IMG/M |
| 3300005542|Ga0070732_10818140 | Not Available | 568 | Open in IMG/M |
| 3300005841|Ga0068863_101970417 | Not Available | 594 | Open in IMG/M |
| 3300005995|Ga0066790_10407499 | Not Available | 581 | Open in IMG/M |
| 3300005995|Ga0066790_10537424 | Not Available | 500 | Open in IMG/M |
| 3300006052|Ga0075029_100155071 | Not Available | 1409 | Open in IMG/M |
| 3300006052|Ga0075029_100237810 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300006052|Ga0075029_100362992 | Not Available | 935 | Open in IMG/M |
| 3300006055|Ga0097691_1024691 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300006059|Ga0075017_100378108 | Not Available | 1059 | Open in IMG/M |
| 3300006176|Ga0070765_100078861 | All Organisms → cellular organisms → Bacteria | 2787 | Open in IMG/M |
| 3300006176|Ga0070765_100094996 | All Organisms → cellular organisms → Bacteria | 2563 | Open in IMG/M |
| 3300006176|Ga0070765_100660230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300006642|Ga0075521_10004236 | All Organisms → cellular organisms → Bacteria | 5141 | Open in IMG/M |
| 3300006642|Ga0075521_10018198 | All Organisms → cellular organisms → Bacteria | 2825 | Open in IMG/M |
| 3300006642|Ga0075521_10020612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2679 | Open in IMG/M |
| 3300006642|Ga0075521_10560650 | Not Available | 561 | Open in IMG/M |
| 3300006642|Ga0075521_10686180 | Not Available | 505 | Open in IMG/M |
| 3300006795|Ga0075520_1105896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300006949|Ga0075528_10224589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009616|Ga0116111_1000855 | All Organisms → cellular organisms → Bacteria | 23453 | Open in IMG/M |
| 3300009623|Ga0116133_1023467 | Not Available | 1525 | Open in IMG/M |
| 3300009623|Ga0116133_1071365 | Not Available | 868 | Open in IMG/M |
| 3300009632|Ga0116102_1221404 | Not Available | 504 | Open in IMG/M |
| 3300009839|Ga0116223_10796887 | Not Available | 540 | Open in IMG/M |
| 3300010048|Ga0126373_10463518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1304 | Open in IMG/M |
| 3300010048|Ga0126373_10475589 | Not Available | 1288 | Open in IMG/M |
| 3300010048|Ga0126373_11166036 | Not Available | 836 | Open in IMG/M |
| 3300010339|Ga0074046_10000142 | All Organisms → cellular organisms → Bacteria | 60992 | Open in IMG/M |
| 3300010339|Ga0074046_10008032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8101 | Open in IMG/M |
| 3300010339|Ga0074046_10008775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 7700 | Open in IMG/M |
| 3300010339|Ga0074046_10036957 | All Organisms → cellular organisms → Bacteria | 3303 | Open in IMG/M |
| 3300010339|Ga0074046_10046903 | All Organisms → cellular organisms → Bacteria | 2882 | Open in IMG/M |
| 3300010339|Ga0074046_10151854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1477 | Open in IMG/M |
| 3300010339|Ga0074046_10233068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300010341|Ga0074045_10003619 | All Organisms → cellular organisms → Bacteria | 13894 | Open in IMG/M |
| 3300010341|Ga0074045_10026383 | All Organisms → cellular organisms → Bacteria | 4454 | Open in IMG/M |
| 3300010341|Ga0074045_10079110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2304 | Open in IMG/M |
| 3300010341|Ga0074045_10932846 | Not Available | 547 | Open in IMG/M |
| 3300010343|Ga0074044_10087169 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300010358|Ga0126370_11251278 | Not Available | 693 | Open in IMG/M |
| 3300010376|Ga0126381_100062751 | All Organisms → cellular organisms → Bacteria | 4600 | Open in IMG/M |
| 3300010376|Ga0126381_100238299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2457 | Open in IMG/M |
| 3300010376|Ga0126381_103067090 | Not Available | 662 | Open in IMG/M |
| 3300010379|Ga0136449_103939497 | Not Available | 556 | Open in IMG/M |
| 3300012971|Ga0126369_11331392 | Not Available | 808 | Open in IMG/M |
| 3300014155|Ga0181524_10056156 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300014156|Ga0181518_10051885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2462 | Open in IMG/M |
| 3300014162|Ga0181538_10004987 | All Organisms → cellular organisms → Bacteria | 12116 | Open in IMG/M |
| 3300014164|Ga0181532_10000020 | All Organisms → cellular organisms → Bacteria | 179163 | Open in IMG/M |
| 3300014164|Ga0181532_10000031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 140775 | Open in IMG/M |
| 3300014164|Ga0181532_10122845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1590 | Open in IMG/M |
| 3300014164|Ga0181532_10176695 | Not Available | 1266 | Open in IMG/M |
| 3300014165|Ga0181523_10268614 | Not Available | 970 | Open in IMG/M |
| 3300014199|Ga0181535_10278627 | Not Available | 1002 | Open in IMG/M |
| 3300014322|Ga0075355_1000431 | All Organisms → cellular organisms → Bacteria | 7512 | Open in IMG/M |
| 3300014490|Ga0182010_10401403 | Not Available | 748 | Open in IMG/M |
| 3300014492|Ga0182013_10002859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 22163 | Open in IMG/M |
| 3300014492|Ga0182013_10084982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2203 | Open in IMG/M |
| 3300014495|Ga0182015_10291342 | Not Available | 1069 | Open in IMG/M |
| 3300014501|Ga0182024_10353180 | Not Available | 1920 | Open in IMG/M |
| 3300014969|Ga0157376_12497720 | Not Available | 556 | Open in IMG/M |
| 3300015206|Ga0167644_1098713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300015371|Ga0132258_13505436 | Not Available | 1075 | Open in IMG/M |
| 3300016445|Ga0182038_10405279 | Not Available | 1144 | Open in IMG/M |
| 3300016702|Ga0181511_1040868 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300016750|Ga0181505_10649376 | Not Available | 1982 | Open in IMG/M |
| 3300016750|Ga0181505_11050382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14911 | Open in IMG/M |
| 3300017929|Ga0187849_1325113 | Not Available | 571 | Open in IMG/M |
| 3300017931|Ga0187877_1126727 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300017934|Ga0187803_10183318 | Not Available | 824 | Open in IMG/M |
| 3300017935|Ga0187848_10042045 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300017941|Ga0187850_10052928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 2088 | Open in IMG/M |
| 3300017955|Ga0187817_10821590 | Not Available | 594 | Open in IMG/M |
| 3300017961|Ga0187778_11018529 | Not Available | 574 | Open in IMG/M |
| 3300017970|Ga0187783_10020580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4873 | Open in IMG/M |
| 3300017975|Ga0187782_10442291 | Not Available | 991 | Open in IMG/M |
| 3300018006|Ga0187804_10239768 | Not Available | 781 | Open in IMG/M |
| 3300018019|Ga0187874_10051088 | Not Available | 1918 | Open in IMG/M |
| 3300020581|Ga0210399_10080189 | Not Available | 2652 | Open in IMG/M |
| 3300020583|Ga0210401_10360662 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300021180|Ga0210396_10168535 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300021180|Ga0210396_10847619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300021181|Ga0210388_10368761 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300021405|Ga0210387_10129235 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300021432|Ga0210384_11718957 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300021475|Ga0210392_10650237 | Not Available | 783 | Open in IMG/M |
| 3300021477|Ga0210398_10038237 | All Organisms → cellular organisms → Bacteria | 3986 | Open in IMG/M |
| 3300021559|Ga0210409_11722368 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300021560|Ga0126371_11954791 | Not Available | 705 | Open in IMG/M |
| 3300022524|Ga0224534_1086153 | Not Available | 564 | Open in IMG/M |
| 3300022709|Ga0222756_1076698 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025427|Ga0208077_1001616 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
| 3300025454|Ga0208039_1095702 | Not Available | 513 | Open in IMG/M |
| 3300025464|Ga0208076_1021813 | Not Available | 1107 | Open in IMG/M |
| 3300025474|Ga0208479_1004252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3009 | Open in IMG/M |
| 3300025474|Ga0208479_1009682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2061 | Open in IMG/M |
| 3300025475|Ga0208478_1006668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2716 | Open in IMG/M |
| 3300025579|Ga0207927_1000222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 23919 | Open in IMG/M |
| 3300025579|Ga0207927_1017173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2282 | Open in IMG/M |
| 3300025916|Ga0207663_10358487 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300026294|Ga0209839_10175875 | Not Available | 696 | Open in IMG/M |
| 3300026783|Ga0207778_110313 | Not Available | 673 | Open in IMG/M |
| 3300026800|Ga0207742_102099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1951 | Open in IMG/M |
| 3300026800|Ga0207742_107213 | Not Available | 896 | Open in IMG/M |
| 3300027394|Ga0209904_1000342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4358 | Open in IMG/M |
| 3300027698|Ga0209446_1001852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5100 | Open in IMG/M |
| 3300027698|Ga0209446_1010195 | Not Available | 2305 | Open in IMG/M |
| 3300027698|Ga0209446_1029748 | Not Available | 1368 | Open in IMG/M |
| 3300027703|Ga0207862_1155384 | Not Available | 684 | Open in IMG/M |
| 3300027703|Ga0207862_1167687 | Not Available | 655 | Open in IMG/M |
| 3300027812|Ga0209656_10001081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17607 | Open in IMG/M |
| 3300027812|Ga0209656_10017664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4400 | Open in IMG/M |
| 3300027812|Ga0209656_10029715 | All Organisms → cellular organisms → Bacteria | 3253 | Open in IMG/M |
| 3300027812|Ga0209656_10049101 | All Organisms → cellular organisms → Bacteria | 2394 | Open in IMG/M |
| 3300027812|Ga0209656_10052904 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300027812|Ga0209656_10152805 | Not Available | 1155 | Open in IMG/M |
| 3300027812|Ga0209656_10401842 | Not Available | 614 | Open in IMG/M |
| 3300027824|Ga0209040_10010664 | All Organisms → cellular organisms → Bacteria | 6403 | Open in IMG/M |
| 3300027824|Ga0209040_10022329 | All Organisms → cellular organisms → Bacteria | 4115 | Open in IMG/M |
| 3300027824|Ga0209040_10032306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3299 | Open in IMG/M |
| 3300027824|Ga0209040_10344910 | Not Available | 709 | Open in IMG/M |
| 3300027824|Ga0209040_10492137 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum | 547 | Open in IMG/M |
| 3300027825|Ga0209039_10007404 | All Organisms → cellular organisms → Bacteria | 7013 | Open in IMG/M |
| 3300027825|Ga0209039_10367561 | Not Available | 555 | Open in IMG/M |
| 3300027826|Ga0209060_10010071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5697 | Open in IMG/M |
| 3300027869|Ga0209579_10045737 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300028800|Ga0265338_10043822 | All Organisms → cellular organisms → Bacteria | 4143 | Open in IMG/M |
| 3300029817|Ga0247275_1037784 | Not Available | 1415 | Open in IMG/M |
| 3300029990|Ga0311336_10461162 | Not Available | 1072 | Open in IMG/M |
| 3300030000|Ga0311337_10045052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3425 | Open in IMG/M |
| 3300030014|Ga0302175_10095435 | Not Available | 674 | Open in IMG/M |
| 3300031231|Ga0170824_122107370 | Not Available | 965 | Open in IMG/M |
| 3300031235|Ga0265330_10093544 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300031521|Ga0311364_11016667 | Not Available | 827 | Open in IMG/M |
| 3300031573|Ga0310915_10118157 | Not Available | 1808 | Open in IMG/M |
| 3300031708|Ga0310686_111444145 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum | 553 | Open in IMG/M |
| 3300031708|Ga0310686_115298797 | Not Available | 638 | Open in IMG/M |
| 3300031708|Ga0310686_115514669 | Not Available | 553 | Open in IMG/M |
| 3300031715|Ga0307476_10479039 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300031719|Ga0306917_10034222 | Not Available | 3300 | Open in IMG/M |
| 3300031781|Ga0318547_10409379 | Not Available | 833 | Open in IMG/M |
| 3300031819|Ga0318568_10834948 | Not Available | 571 | Open in IMG/M |
| 3300031819|Ga0318568_11057742 | Not Available | 501 | Open in IMG/M |
| 3300031910|Ga0306923_10637998 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1192 | Open in IMG/M |
| 3300031910|Ga0306923_11938597 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 600 | Open in IMG/M |
| 3300031947|Ga0310909_10095542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2381 | Open in IMG/M |
| 3300032008|Ga0318562_10739411 | Not Available | 565 | Open in IMG/M |
| 3300032041|Ga0318549_10107392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1222 | Open in IMG/M |
| 3300032076|Ga0306924_11434069 | Not Available | 735 | Open in IMG/M |
| 3300032076|Ga0306924_12447183 | Not Available | 525 | Open in IMG/M |
| 3300032261|Ga0306920_100098233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4333 | Open in IMG/M |
| 3300032261|Ga0306920_100658483 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300032261|Ga0306920_102525765 | Not Available | 706 | Open in IMG/M |
| 3300032261|Ga0306920_103770217 | Not Available | 555 | Open in IMG/M |
| 3300032770|Ga0335085_10000020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 603225 | Open in IMG/M |
| 3300032770|Ga0335085_10002231 | All Organisms → cellular organisms → Bacteria | 36943 | Open in IMG/M |
| 3300032770|Ga0335085_10092442 | All Organisms → cellular organisms → Bacteria | 3935 | Open in IMG/M |
| 3300032770|Ga0335085_10167762 | Not Available | 2730 | Open in IMG/M |
| 3300032770|Ga0335085_10361999 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300032770|Ga0335085_10604810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1233 | Open in IMG/M |
| 3300032770|Ga0335085_11218559 | Not Available | 799 | Open in IMG/M |
| 3300032770|Ga0335085_11250768 | Not Available | 786 | Open in IMG/M |
| 3300032782|Ga0335082_10005013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 14444 | Open in IMG/M |
| 3300032782|Ga0335082_10163729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2142 | Open in IMG/M |
| 3300032782|Ga0335082_10168642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2104 | Open in IMG/M |
| 3300032782|Ga0335082_11052971 | Not Available | 679 | Open in IMG/M |
| 3300032782|Ga0335082_11107296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300032783|Ga0335079_10005893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 14017 | Open in IMG/M |
| 3300032783|Ga0335079_10157186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2547 | Open in IMG/M |
| 3300032783|Ga0335079_10589381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300032805|Ga0335078_10010308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13836 | Open in IMG/M |
| 3300032805|Ga0335078_11102418 | Not Available | 928 | Open in IMG/M |
| 3300032805|Ga0335078_11630301 | Not Available | 712 | Open in IMG/M |
| 3300032805|Ga0335078_12515735 | Not Available | 531 | Open in IMG/M |
| 3300032828|Ga0335080_10179241 | Not Available | 2337 | Open in IMG/M |
| 3300032828|Ga0335080_12119877 | Not Available | 542 | Open in IMG/M |
| 3300032828|Ga0335080_12151242 | Not Available | 537 | Open in IMG/M |
| 3300032829|Ga0335070_10209334 | Not Available | 1936 | Open in IMG/M |
| 3300032829|Ga0335070_10372161 | Not Available | 1372 | Open in IMG/M |
| 3300032829|Ga0335070_10601680 | Not Available | 1034 | Open in IMG/M |
| 3300032892|Ga0335081_10001207 | All Organisms → cellular organisms → Bacteria | 41232 | Open in IMG/M |
| 3300032892|Ga0335081_10006204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 19013 | Open in IMG/M |
| 3300032892|Ga0335081_10578691 | Not Available | 1391 | Open in IMG/M |
| 3300032892|Ga0335081_10741367 | Not Available | 1184 | Open in IMG/M |
| 3300032892|Ga0335081_10949966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300032893|Ga0335069_10006689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16729 | Open in IMG/M |
| 3300032893|Ga0335069_10526028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1368 | Open in IMG/M |
| 3300032893|Ga0335069_12349569 | Not Available | 555 | Open in IMG/M |
| 3300032895|Ga0335074_10033784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7152 | Open in IMG/M |
| 3300032895|Ga0335074_10072756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4632 | Open in IMG/M |
| 3300032954|Ga0335083_10148239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2220 | Open in IMG/M |
| 3300032954|Ga0335083_10910849 | Not Available | 697 | Open in IMG/M |
| 3300033004|Ga0335084_10125334 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
| 3300033004|Ga0335084_11155214 | Not Available | 775 | Open in IMG/M |
| 3300033134|Ga0335073_11645880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 610 | Open in IMG/M |
| 3300033158|Ga0335077_10163243 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
| 3300033158|Ga0335077_11516153 | Not Available | 641 | Open in IMG/M |
| 3300033402|Ga0326728_10000370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 179452 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 20.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 12.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.41% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.48% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.47% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.47% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.47% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.47% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.47% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.47% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.47% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026783 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes) | Environmental | Open in IMG/M |
| 3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12381J11899_10171322 | 3300000731 | Tropical Forest Soil | MDFVTIAVIGIIVAAYTVGSLTSSVETETKLPHNYR* |
| JGI26341J46601_100988552 | 3300003219 | Bog Forest Soil | VGCHMDLVTIAVVGVILVSYLVGSLTSSIETEQELPHRY* |
| JGI26343J46809_10094191 | 3300003223 | Bog Forest Soil | VRCHMDVITIAVVSVILVSYLVGSLTSSVETERELPHRY* |
| JGI26340J50214_100101213 | 3300003368 | Bog Forest Soil | VRCHMDVVTXAVVTVILVSYLVGSLTSSVETEQKLPHRY* |
| JGI24140J50213_100504972 | 3300003369 | Arctic Peat Soil | VRRHMDVVTIAVVSVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0062385_104580892 | 3300004080 | Bog Forest Soil | VRCHMDVVTIAVVSVILVSYLVGSLTSSVETEQELPHRY* |
| Ga0062389_1009715222 | 3300004092 | Bog Forest Soil | VRCAMDIVTLAVVGLIVVAYVVGSLTSSVETETELPHVYR* |
| Ga0062389_1022403212 | 3300004092 | Bog Forest Soil | VRCQMDVVTIAVVCVILISYLIGTLTSSVDTERELPHRY* |
| Ga0062386_1000368946 | 3300004152 | Bog Forest Soil | VRCHMDVVTIAVVGVILVSYLVGSLTSSVETERELPHRY* |
| Ga0062386_1000917604 | 3300004152 | Bog Forest Soil | LPECGDPMDLVTIAVASIVIIAYVVGSLTSSVETETELPHLYR* |
| Ga0062386_1006527971 | 3300004152 | Bog Forest Soil | VRCHMDVVTIAVVGVILVSYLVGSLTSSVETEQELPHRY* |
| Ga0062386_1016663141 | 3300004152 | Bog Forest Soil | VGCNMDVVTIAVVGVILISYLVGSLTSSEETERELPHRY* |
| Ga0070741_100307056 | 3300005529 | Surface Soil | MDAVTVALLGIIVVSYVVGSLSSSVDTEQKLPHRY* |
| Ga0070734_1000517513 | 3300005533 | Surface Soil | MDMVTVALLGIIVVSYVVGSLSSSVDTEEKLPHRF* |
| Ga0070731_103316352 | 3300005538 | Surface Soil | VDLVTITVVGIIVVSYLVGSLTSSVETEQKLPHRY* |
| Ga0070732_108181402 | 3300005542 | Surface Soil | MDVVTIAVVVVILVSYLIGTLTSSVETERELPHRY* |
| Ga0068863_1019704172 | 3300005841 | Switchgrass Rhizosphere | MLAMVAVVSVILVSFLVGSLTSSVETELELPHLY* |
| Ga0066790_104074991 | 3300005995 | Soil | MDVVTIAVVVVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0066790_105374241 | 3300005995 | Soil | WGEGAMDFVTVAVLVLIVLAYAVGSLTSSVETETKLPHQYR* |
| Ga0075029_1001550712 | 3300006052 | Watersheds | MDFVTIAVVGLVVVAYVVGSFSSSVETEKELPHHYR* |
| Ga0075029_1002378101 | 3300006052 | Watersheds | MGFVTVAVLVGIVAAYAVGSLTSSVETETELPHQYR* |
| Ga0075029_1003629922 | 3300006052 | Watersheds | VGCPMDFVTVAVTLLIVVAYAVGALTSSIETETELPHHYR* |
| Ga0097691_10246913 | 3300006055 | Arctic Peat Soil | MDVVTIAVVSVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0075017_1003781082 | 3300006059 | Watersheds | MDFVTIAVAGLIVVAYVVGSLTSNIETETELPHHYR* |
| Ga0070765_1000788612 | 3300006176 | Soil | MNLVTIALVVIILVSYVVGALTSSEETERELPHHY* |
| Ga0070765_1000949963 | 3300006176 | Soil | VNLTTALILALILVSYIVGAFTSSVETEQALPHRY* |
| Ga0070765_1006602302 | 3300006176 | Soil | LDLVTIAVVGVIVVSYVVGCLTSSVETEQKLPHRY* |
| Ga0075521_100042364 | 3300006642 | Arctic Peat Soil | MDVVTFAVLVVIVVAYAVGSLTSSVETETELPHQYR* |
| Ga0075521_100181983 | 3300006642 | Arctic Peat Soil | MDVVTVAVLVVIVIAYAVGSLTSSVETETELPHQYR* |
| Ga0075521_100206123 | 3300006642 | Arctic Peat Soil | MDVVTIAVVSVILISYLIGTLTSSVDTERELPHRY* |
| Ga0075521_105606503 | 3300006642 | Arctic Peat Soil | MDAVTIAVVSVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0075521_106861802 | 3300006642 | Arctic Peat Soil | MGRTGVRRHMDAVTIAVVSVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0075520_11058961 | 3300006795 | Arctic Peat Soil | MGRTGVRCHVDVVTIAVLGVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0075528_102245892 | 3300006949 | Arctic Peat Soil | MDIATIAVIIVVLVSYLVGSLTGSVETEKELPHRY* |
| Ga0116111_100085526 | 3300009616 | Peatland | MDVVTIAVVGVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0116133_10234672 | 3300009623 | Peatland | MDLITIAVVGVIVVSYVIGSLTSSVETEQKLPHRY* |
| Ga0116133_10713652 | 3300009623 | Peatland | MDIATIAVIGVVLVSYVVGSLTSSVETEKELPHRY* |
| Ga0116102_12214041 | 3300009632 | Peatland | MDVVTITVVGVILISYLIGTLTSSVDTERELPHRY* |
| Ga0116223_107968872 | 3300009839 | Peatlands Soil | GVRCHMDVVTIAVVGVILVSYLIGTLTSSVDTERELPHRY* |
| Ga0126373_104635182 | 3300010048 | Tropical Forest Soil | MDVVTVVVVGLIVVAYVIGSLTSSVETETELPHNYR* |
| Ga0126373_104755893 | 3300010048 | Tropical Forest Soil | MDVVTVVVLGLIVVAYVVGSLTSSVETETELPHNYR* |
| Ga0126373_111660362 | 3300010048 | Tropical Forest Soil | MDLITIAVVGVIVLSYVVGSLTSSVDTEQKLPHRY* |
| Ga0074046_1000014231 | 3300010339 | Bog Forest Soil | MDVITIAVVSVILVSYLVGSLTSSVETERELPHRY* |
| Ga0074046_100080327 | 3300010339 | Bog Forest Soil | MDVVTIAVVGVILVSYLVGSLTSSVETERELPHRY* |
| Ga0074046_100087751 | 3300010339 | Bog Forest Soil | MDVVTLAVVGLIVVAYIVGSLTSSVETETKLPHLFR* |
| Ga0074046_100369574 | 3300010339 | Bog Forest Soil | MDVVTVTVLLVIVVAYAVGSLTSSVETEIELSHRYR* |
| Ga0074046_100469034 | 3300010339 | Bog Forest Soil | MDVVTIAVVTVILVSYLVGSLTSSVETEQKLPHRY* |
| Ga0074046_101518543 | 3300010339 | Bog Forest Soil | RCQMDIATIVVISMALVSYVVGSLTSPVETEKELPHRY* |
| Ga0074046_102330682 | 3300010339 | Bog Forest Soil | MDVVTIAVVGLIVVAYIVGSLTSSIETETKLPHVFR* |
| Ga0074045_100036196 | 3300010341 | Bog Forest Soil | MDVVTIAVVSVILVSYLVGSLTSSVETEKELPHRY* |
| Ga0074045_100263834 | 3300010341 | Bog Forest Soil | MDVVTIAVVGLIVVAYIVGSLTSSIETETELPHLYR* |
| Ga0074045_100791103 | 3300010341 | Bog Forest Soil | MDVVTIAVVGVILVSYLVGSLTSSVETEQELPHRY* |
| Ga0074045_109328461 | 3300010341 | Bog Forest Soil | MAAGAGVGCNMDVVTIAVVGVILISYLVGSLTSSEETERQLPHRY* |
| Ga0074044_100871691 | 3300010343 | Bog Forest Soil | QGLKRVRCNMDGITMALLGVILVSYLVGSLTSSIETEQKLPHRY* |
| Ga0126370_112512781 | 3300010358 | Tropical Forest Soil | MDVVTVVVIGLIVAAYVVGSLTSSVETETELPHNYR* |
| Ga0126381_1000627512 | 3300010376 | Tropical Forest Soil | MDLITIAVVSLIVVSYVVGSLTSSVDIEQKLPHRY* |
| Ga0126381_1002382993 | 3300010376 | Tropical Forest Soil | MMDIATIVVLTVVLVSYLLGSLTSSTETELQLPHRY* |
| Ga0126381_1030670901 | 3300010376 | Tropical Forest Soil | MDVVTVVVLGLIVVAYVVGSLTSSVETETELPHNY |
| Ga0136449_1039394971 | 3300010379 | Peatlands Soil | MDVVTIAVVSVILISYLIGTLTSSVDTERELPHRYF* |
| Ga0126369_113313922 | 3300012971 | Tropical Forest Soil | MDVVTIAVVSVILVSYLVGSLTSSVETEQKLPHRY* |
| Ga0181524_100561563 | 3300014155 | Bog | MDLITIAVVGVIVVSYVVGCLTSSVETEQKLPHRY* |
| Ga0181518_100518852 | 3300014156 | Bog | MDLTMIAVVGVIVVSYLVGSLTSSVDTEQKLPHRY* |
| Ga0181538_100049879 | 3300014162 | Bog | MDIATIAVISVVLASYLVGALTSSVETERELPHRY* |
| Ga0181532_1000002047 | 3300014164 | Bog | VVITIVIVAVILASYAVGSLTSSAETEKELPHHY* |
| Ga0181532_1000003171 | 3300014164 | Bog | MDLITIAVVGIIVVSYVVGSLTSSVDTEQKLPHRY* |
| Ga0181532_101228452 | 3300014164 | Bog | MDIATIAVIGVVLVSYVVGALTSSVETEKELPHRY* |
| Ga0181532_101766952 | 3300014164 | Bog | MDVVTIAVVTVILVSYLVGSLTSSIETEQKLPHRY* |
| Ga0181523_102686141 | 3300014165 | Bog | RCHMDLVTIAVVGVIALSYLIGSLTSSVDVEQELPHRY* |
| Ga0181535_102786272 | 3300014199 | Bog | MDLVTIAVIGVIVISYLVGSLTSSVETEEKLPHRY |
| Ga0075355_10004312 | 3300014322 | Natural And Restored Wetlands | MIAMVTVLGVILVSFVVGSLTSSVETEQALPHHF* |
| Ga0182010_104014031 | 3300014490 | Fen | QMDIATIAVIIVVLVSYLVGSLTSSVETEKELPHRY* |
| Ga0182013_100028599 | 3300014492 | Bog | MDLVTIAVVGVIVISYLVGALTSSVETEEKLPHRY* |
| Ga0182013_100849823 | 3300014492 | Bog | MDLITIAVVSIIVVSYVIGSLTSSVETEQKLPHRY* |
| Ga0182015_102913422 | 3300014495 | Palsa | MDLVTIAVIGVIVISYLVGALTSSVETEEKLPHRY* |
| Ga0182024_103531801 | 3300014501 | Permafrost | MDVVTIAVVTVILISYVVGTLTSSVDTERELPHRY* |
| Ga0157376_124977201 | 3300014969 | Miscanthus Rhizosphere | MLAMVAVVSVILVSFLVGSLTSSVETELELPHRY* |
| Ga0167644_10987132 | 3300015206 | Glacier Forefield Soil | MDIVTIAIVSVILVSYAVGALTSSMEAEKELPHRY* |
| Ga0132258_135054362 | 3300015371 | Arabidopsis Rhizosphere | MLATLAVLAVILVSFLVGSLTSSVETEQALPHRF* |
| Ga0182038_104052791 | 3300016445 | Soil | GVQMDVVTVTVVLVIVASYLVGALTSSVETERELPHRFQ |
| Ga0181511_10408682 | 3300016702 | Peatland | MDLITIAVVGIIVVSYVVGSLTSSVDTEQKLPHRY |
| Ga0181505_106493762 | 3300016750 | Peatland | MDVVTIAVVTVILVSYLVGSLTSSIETEQKLPHRY |
| Ga0181505_1105038214 | 3300016750 | Peatland | MDLITIAVVGVIVVSYVVGCLTSSVETEQKLPHRY |
| Ga0187849_13251132 | 3300017929 | Peatland | MDIATIAVIGVVLVSYVVGALTSSVETEKELPHRY |
| Ga0187877_11267271 | 3300017931 | Peatland | MDVVTIAVVGVILVSYLIGTLTSSVDTERELPHRY |
| Ga0187803_101833182 | 3300017934 | Freshwater Sediment | MEVVTIAVVSVILVSYLIGAFTSSVDTERDLPHRY |
| Ga0187848_100420453 | 3300017935 | Peatland | MDVVTITVVGVILISYLIGTLTSSVDTERELPHRY |
| Ga0187850_100529282 | 3300017941 | Peatland | MDIATIAVIGVVLVSYVVGSLTSSVETEKELPHRY |
| Ga0187817_108215902 | 3300017955 | Freshwater Sediment | MDVVTIAVVSVILVSYLVGSLTSSVETERELPHRY |
| Ga0187778_110185291 | 3300017961 | Tropical Peatland | MDIVTIAVVSVILVSYLVGSLTSSVETEQELPHRY |
| Ga0187783_100205804 | 3300017970 | Tropical Peatland | MDLVTMAVIGVVLVSYVVGSLASSVETEKQLPHRY |
| Ga0187781_107068931 | 3300017972 | Tropical Peatland | MDVVTITVVGVVLVSYLLGSLTSTEETEKQLPHRY |
| Ga0187782_104422912 | 3300017975 | Tropical Peatland | MDVVTMAVIGLVLVSYVVGSLTSSVETEKELPHRY |
| Ga0187804_102397681 | 3300018006 | Freshwater Sediment | MDVVTIAVVGVILVSYLVGSLTSSVETERELPHRY |
| Ga0187874_100510883 | 3300018019 | Peatland | MDLITIAVVGVIVVSYVIGSLTSSVETEQKLPHRY |
| Ga0210399_100801894 | 3300020581 | Soil | MDFVTIAVLGVIVVAYVVGSMTSSVETETELPHLYR |
| Ga0210401_103606622 | 3300020583 | Soil | MNLATIALVFIILVSYVVGALTSSEETERELPHHY |
| Ga0210396_101685352 | 3300021180 | Soil | MNLVTIALVVIILVSYVVGALTSSEETERELPHHY |
| Ga0210396_108476192 | 3300021180 | Soil | LDLVTITVVGVIVVSYVVGCLTSSVETEQKLPHRY |
| Ga0210388_103687612 | 3300021181 | Soil | MNVVTIAVVILILASYVVGALASSIETEKELPHHY |
| Ga0210387_101292352 | 3300021405 | Soil | MNVVTIAVVILILASYVVGALTSSIETEKELPHHY |
| Ga0210384_117189572 | 3300021432 | Soil | LGGEGHMDLVTIAVVGIIVVSYVVGSLTSSVETEQKLPHRY |
| Ga0210392_106502372 | 3300021475 | Soil | MDIVTAAVLVVIVVAYAVGSLTSSVETETELPHRYR |
| Ga0210398_100382372 | 3300021477 | Soil | MNLVTIAVVGVIVISYLVGTFTSSVETEQKLPHRY |
| Ga0210409_117223681 | 3300021559 | Soil | RCRRFQMNLVTIALVVIILVSYVVGALTSSEETERELPHHY |
| Ga0126371_119547911 | 3300021560 | Tropical Forest Soil | MDLITIAVVGVIVLSYVVGSLTSSVDTEQKLPHRY |
| Ga0224534_10861531 | 3300022524 | Soil | MDAVTIAVVSVILVSYLIGTLTSSVDTERELPHRY |
| Ga0222756_10766981 | 3300022709 | Soil | GEGHMDLVTIAVVGIIVVSYVVGSLTSSVETEQKLPHRY |
| Ga0208077_10016162 | 3300025427 | Arctic Peat Soil | MDVVTFAVLVVIVVAYAVGSLTSSVETETELPHQYR |
| Ga0208039_10957022 | 3300025454 | Peatland | AGWGRCHMDLITIAVVGVIVVSYVIGSLTSSVETEQKLPHRY |
| Ga0208076_10218132 | 3300025464 | Arctic Peat Soil | MDVVTVAVLVVIVIAYAVGSLTSSVETETELPHQYR |
| Ga0208479_10042526 | 3300025474 | Arctic Peat Soil | MDIATIAVIIVVLVSYLVGSLTSSVETEKELPHRY |
| Ga0208479_10096822 | 3300025474 | Arctic Peat Soil | MDVVTIAVVSVILVSYLIGTLTSSVDTERELPHRY |
| Ga0208478_10066683 | 3300025475 | Arctic Peat Soil | MDIATIAVIIVVLVSYLVGSLTGSVETEKELPHRY |
| Ga0207927_100022214 | 3300025579 | Arctic Peat Soil | MDVVTVAVLVVIVVAYAVGSLTSSVETETELPHQYR |
| Ga0207927_10171732 | 3300025579 | Arctic Peat Soil | MDVVTIAVVSVILISYLIGTLTSSVDTERELPHRY |
| Ga0207663_103584872 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLVTIAVLGIIVVSYIVGSLTSSVETEQKLPHRY |
| Ga0209839_101758752 | 3300026294 | Soil | MDVVTVAVLAVIVVAYVVGSLTSSVETETELPHQYR |
| Ga0207778_1103131 | 3300026783 | Tropical Forest Soil | MDFVTIAVIGIIVAAYAVGSLTSSVETETKLPHNYR |
| Ga0207742_1020993 | 3300026800 | Tropical Forest Soil | MDFVTIAVIGIIVAAYTVGSLTSSVETETKLPHNYR |
| Ga0207742_1072132 | 3300026800 | Tropical Forest Soil | PVILGCLMDFVTIAVIGIIVAAYAVGSLTSSVETETKLPHNYR |
| Ga0209904_10003423 | 3300027394 | Thawing Permafrost | MDVVTIAVVGVILISYLIGTLTSSVDTERELPHRY |
| Ga0209446_10018526 | 3300027698 | Bog Forest Soil | MDVITIAVVSVILVSYLVGSLTSSVETERELPHRY |
| Ga0209446_10101953 | 3300027698 | Bog Forest Soil | MDVVTIAVVSVILVSYLVGSLTSSVETEQELPHRY |
| Ga0209446_10297481 | 3300027698 | Bog Forest Soil | MDVVTIAVVSVILVSYLVGSLTSSVETEKELPHRY |
| Ga0207862_11553841 | 3300027703 | Tropical Forest Soil | MDFVTIAVIGIIVAAYTVGSLTSSVETETKLPHNY |
| Ga0207862_11676872 | 3300027703 | Tropical Forest Soil | MDVVTIAVVSVILVSYLVGSLTSSVETEQQLPHRY |
| Ga0209656_1000108111 | 3300027812 | Bog Forest Soil | MDVVTIAVVTVILVSYLVGSLTSSVETEQKLPHRY |
| Ga0209656_100176646 | 3300027812 | Bog Forest Soil | MDLVTIAVVGVILVSYLVGSLTSSIETEQELPHRY |
| Ga0209656_100297152 | 3300027812 | Bog Forest Soil | MDVVTIAVVGLIVVAYIVGSLTSSVETETKLPHLFR |
| Ga0209656_100491015 | 3300027812 | Bog Forest Soil | MDVVTLAVVGLIVVAYIVGSLTSSVETETKLPHLFR |
| Ga0209656_100529045 | 3300027812 | Bog Forest Soil | MDVVTIAVVGLIVVAYIVGSLTSSIETETKLPHVFR |
| Ga0209656_101528051 | 3300027812 | Bog Forest Soil | MDVVTIAVVSVILISYLVGSLTSSVETEQKLPHRY |
| Ga0209656_104018421 | 3300027812 | Bog Forest Soil | MDLVTIAVASIVIIAYVVGSLTSSVETETELPHLYR |
| Ga0209040_100106643 | 3300027824 | Bog Forest Soil | MDVVTIVIVGLIVVAYVVGSLTSSVETETELPHLYR |
| Ga0209040_100223296 | 3300027824 | Bog Forest Soil | MDIVTIAVVGVILVSYLVGSLTSSVETEKQLPHRY |
| Ga0209040_100323063 | 3300027824 | Bog Forest Soil | MDVVTVTVLLVIVVAYAVGSLTSSVETEIELSHRYR |
| Ga0209040_103449102 | 3300027824 | Bog Forest Soil | MDLITIAVVGVIIVSYVVGSLTSSVDIEEKLPHRY |
| Ga0209040_104921371 | 3300027824 | Bog Forest Soil | MDVVTIAVLVIIVVSFVVGSLSSSVETEQMLPHRY |
| Ga0209039_100074048 | 3300027825 | Bog Forest Soil | MDIATIVVISMALVSYVVGSLTSPVETEKELPHRY |
| Ga0209039_103675611 | 3300027825 | Bog Forest Soil | GVRCHMDFVTVAVVSVILVSYLVGSLTSSVETERELPHRY |
| Ga0209060_100100718 | 3300027826 | Surface Soil | MDMVTVALLGIIVVSYVVGSLSSSVDTEEKLPHRF |
| Ga0209579_100457374 | 3300027869 | Surface Soil | MDAVTVALLGIIVVSYVVGSLSSSVDTEQKLPHRY |
| Ga0265338_100438224 | 3300028800 | Rhizosphere | MDLITIAVVSLIVVSYVVGSLTSSVDIEQKLPHRY |
| Ga0247275_10377841 | 3300029817 | Soil | VRCHMDVVTIAVVGVILVSYLIGTLTSSVDTERELPHRY |
| Ga0311336_104611621 | 3300029990 | Fen | GCAMDFVTIAVAGLIIVAYVVGSLTSNIETETELPHHYR |
| Ga0311337_100450523 | 3300030000 | Fen | MDFVTIAVAGLIIVAYVVGSLTSNIETETELPHHYR |
| Ga0302175_100954351 | 3300030014 | Fen | LGIGREKGCAMDFVTIAVAGLIIVAYVVGSLTSNIETETELPHHYR |
| Ga0170824_1221073701 | 3300031231 | Forest Soil | MDVVTIAIVSVILISYLIGTLTSSVETEQKLPHRY |
| Ga0265330_100935443 | 3300031235 | Rhizosphere | MDVVTIAVIGVIVVSYIVGSLTSSVETEQELPHRY |
| Ga0311364_110166671 | 3300031521 | Fen | MDFVTIAVAGLIIVAYIVGSLTSNIETETELPHHYR |
| Ga0310915_101181573 | 3300031573 | Soil | MDGVTIAVVGLIVVAYVIGSLTSSVETETELPHNYR |
| Ga0310686_1114441451 | 3300031708 | Soil | MDVVTIAVVSVILVSYLVGTLTSSVDTERELPHRY |
| Ga0310686_1152987972 | 3300031708 | Soil | MNLVTIAVVGVIVLSYLVGTLTSSVETEQKLPHRY |
| Ga0310686_1155146691 | 3300031708 | Soil | MDLITIAVVGVIIVSYVVGSLTSSVDIEQKLPHRY |
| Ga0307476_104790392 | 3300031715 | Hardwood Forest Soil | MNLVTIAVVVIILVSYVVGALTSSEETERELPHHY |
| Ga0306917_100342223 | 3300031719 | Soil | MDFVTVAVLAVIVVAYAVGSLTSSVETETELPHRYR |
| Ga0318547_104093793 | 3300031781 | Soil | CFGAMDIVTIAVVGVIVVAYVVGAMTSSVETETELPHLYR |
| Ga0318568_108349482 | 3300031819 | Soil | AMDGVTIAVVGLIVVAYVIGSLTSSVETETELPHNYR |
| Ga0318568_110577422 | 3300031819 | Soil | SGAPMDLVTIAVAGIVLVAYVVGSLTSSVETETELPHLYR |
| Ga0306923_106379983 | 3300031910 | Soil | MDVVTILVVGLIVVAYVVGSLTSSVETETELPHLYR |
| Ga0306923_119385972 | 3300031910 | Soil | MDVVTVVVIGLIVAAYVVGSLTSSVETETELPHHYR |
| Ga0310909_100955423 | 3300031947 | Soil | ADKGCFGAMDIVTIAVVGVIVVAYVVGAMTSSVETETELPHLYR |
| Ga0318562_107394112 | 3300032008 | Soil | DLVTIAVAGIVLVAYVVGSLTSSVETETELPHLYR |
| Ga0318549_101073921 | 3300032041 | Soil | SLIWVRCAMDGVTIAVVGLIVVAYVIGSLTSSVETETELPHNYR |
| Ga0306924_114340691 | 3300032076 | Soil | VDIVTIAVVGVIIVSYLIGALTSSVDTERELPHRY |
| Ga0306924_124471831 | 3300032076 | Soil | CAMDVVTVVVIGLIVAAYVVGSLTSSVETETELPHHYR |
| Ga0306920_1000982335 | 3300032261 | Soil | MDIVTIAVVGVIVVAYVVGAMTSSVETETELPHLYR |
| Ga0306920_1006584833 | 3300032261 | Soil | MDLVTIAVAGIVLVAYVVGSLTSSVETETELPHLYR |
| Ga0306920_1025257652 | 3300032261 | Soil | MDLVTVTVVLLVVVAYAVGSLTSSVQTETELPHHYR |
| Ga0306920_1037702171 | 3300032261 | Soil | MDLVTVTVVLLVVVAYAVGSLTSSVQTETELPQHYR |
| Ga0335085_10000020424 | 3300032770 | Soil | MDTVTLAVLGIIVASYLVGTLTSSVDTELKLPHRY |
| Ga0335085_1000223115 | 3300032770 | Soil | MDITTVAVVSVILISYLIGSLTSSVETEQELPHRY |
| Ga0335085_100924426 | 3300032770 | Soil | MDVVTFAVVGVILISFVVGSLTSSVETERELPHRF |
| Ga0335085_101677622 | 3300032770 | Soil | MDFVTIAIVGLVVVAYVVGSLTSSIETETELPHVYR |
| Ga0335085_103619993 | 3300032770 | Soil | MDVVTFAVVGVILVSYIVGSLTSSVETEQELPHRY |
| Ga0335085_106048102 | 3300032770 | Soil | MDAVTIAVLGIIFVSYVVGSLTSSVDTEEKLPHRY |
| Ga0335085_112185592 | 3300032770 | Soil | MDLVTVVVVGLIVVAYVVGSLTSSVETETELPHLFR |
| Ga0335085_112507682 | 3300032770 | Soil | VDVVTIAVVGVILVSYLIGTLTSSVDTERELPHRY |
| Ga0335082_100050133 | 3300032782 | Soil | MDVVTIAVVGVILVSYLVGSLTSSVETEQELPHRY |
| Ga0335082_101637293 | 3300032782 | Soil | MDTVTLAVIGVIFVSFLVGALTSSVETEQELPHRY |
| Ga0335082_101686424 | 3300032782 | Soil | MDMVTIAVIGVILVSYVVGSLTSSVETERELPHRF |
| Ga0335082_110529712 | 3300032782 | Soil | MDVVTIVVVGLIVVAYVIGSLTSSVETETELPHIYR |
| Ga0335082_111072961 | 3300032782 | Soil | MDVVTIAVVGIIVVSYIVGSLTSSVETEQKLPHRY |
| Ga0335079_100058935 | 3300032783 | Soil | MDAVTMTVLAIIVASYVVGSLTSSVDTELKLPHRY |
| Ga0335079_101571862 | 3300032783 | Soil | MDVVTLTVLGIIVASYVVGSLTSSVDTELKLPHRY |
| Ga0335079_105893812 | 3300032783 | Soil | MDLITIAVVGLIVVSYVVGSLTSSVDIEQKLPHRY |
| Ga0335078_100103083 | 3300032805 | Soil | MDLITIAVVGVIIVSYVVGSLTSSVDTEEKLPHRY |
| Ga0335078_111024182 | 3300032805 | Soil | MNIATIVVLAVIVTSYIVGALTSSVETEQRLPHRF |
| Ga0335078_116303012 | 3300032805 | Soil | MDVVTIAVVSVILVSYLVGSLTSSVETEQKLPHRY |
| Ga0335078_125157351 | 3300032805 | Soil | LPEGRCHVDVVTIAVVGVILVSYLVGSLTSSVETEQKLPHRY |
| Ga0335080_101792413 | 3300032828 | Soil | MNTASVLAGRSGVRCHMDVVTIAVVSVILVSYLVGSLTSSVETEQELPHRY |
| Ga0335080_121198772 | 3300032828 | Soil | MDVVTVAVVSVIVISYLVGSLTSSVETEQELPHRY |
| Ga0335080_121512422 | 3300032828 | Soil | MDGATLTVLGIIVASYIIGSFASSVDTELKLPHRY |
| Ga0335070_102093342 | 3300032829 | Soil | MDFVTVVVAGLVVVVYVVGCLTSSVETETQLPHYYR |
| Ga0335070_103721612 | 3300032829 | Soil | MDVVSVVVLGLVVAAYVVGSLTSSVETETELPHHYR |
| Ga0335070_106016801 | 3300032829 | Soil | MDLASIAVLGIIVASYVVGSLTSSVDTERKLPHLYH |
| Ga0335081_1000120713 | 3300032892 | Soil | MDVVTIAVLGIIVASYVVGALTSSVATEQELPHLYH |
| Ga0335081_1000620415 | 3300032892 | Soil | MDLVTIAVVSIIVVSYVVGSLTSSVETEQKLPHRY |
| Ga0335081_105786912 | 3300032892 | Soil | MDLITIAVVSVIVLSYVIGSLTSSVDIEQKLPHRY |
| Ga0335081_107413672 | 3300032892 | Soil | MNFAMIAVVGLVLVSYVVGSLTSSVETEQKLPYRYW |
| Ga0335081_109499662 | 3300032892 | Soil | MDLVTIAVVSIIVVSYVVGSLTSSVDTEQKLPHRY |
| Ga0335069_1000668911 | 3300032893 | Soil | MDAVTIAVLGIIVLSYVVGSLTSSVDTEEKLPHRY |
| Ga0335069_105260282 | 3300032893 | Soil | MDLVTITVVGIIVVSYVVGCLTSSVETEQKLPHRY |
| Ga0335069_123495691 | 3300032893 | Soil | MDFVTITVLGIIVVSYVVGSLTSSVETEQKLPHRY |
| Ga0335074_100337845 | 3300032895 | Soil | MDLITIAVVGVIVVSYVVGSLTSSIDIEEKLPHRY |
| Ga0335074_100727564 | 3300032895 | Soil | MNFATIAVVVVVAVSYLVGSLTSSVETEKQLPHRY |
| Ga0335083_101482391 | 3300032954 | Soil | RGRRHMDAVTIAVLGIIFVSYVVGSLTSSVDTEEKLPHRY |
| Ga0335083_109108491 | 3300032954 | Soil | SLVWVRCAMDLVTVVVVGLIVVAYVVGSLTSSVETETELPHLFR |
| Ga0335084_101253342 | 3300033004 | Soil | MDLITIAVVSLIVVSYVVGSLTSSVDVEQKLPHRY |
| Ga0335084_111552142 | 3300033004 | Soil | GVRCQVDVVTIAVVGVILVSYLIGTLTSSVDTERELPHRY |
| Ga0335073_116458802 | 3300033134 | Soil | LDLVTITVVGIIVVSYVVGCLTSSVETEQELPHRY |
| Ga0335077_101632433 | 3300033158 | Soil | MDVVTFAVVGVILISFVVGSLTSSVETEQELPHRF |
| Ga0335077_115161532 | 3300033158 | Soil | MDLVTIAVVGVIVVSYLVGSLTSSVDTEQELPHRN |
| Ga0326728_1000037095 | 3300033402 | Peat Soil | MDLITIAVVGVIVVSYVVGSLTSSVEVEQKLPHRY |
| ⦗Top⦘ |