Metagenome Family F022333

Basic Information
Family ID	F022333
Family Type	Metagenome
Number of Sequences	214
Average Sequence Length	37 residues
Representative Sequence	MSSISVQNFSSIGDDHKELSLSKETDFKTEAETLDT
Number of Associated Samples	13
Number of Associated Scaffolds	214

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	73.58 %
% of genes near scaffold ends (potentially truncated)	14.49 %
% of genes from short scaffolds (< 2000 bps)	44.86 %
Associated GOLD sequencing projects	11
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (50.935 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated (97.664 % of family members)
Environment Ontology (ENVO)	Unclassified (97.664 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant corpus (97.664 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 214 Family Scaffolds
PF14223	Retrotran_gag_2	20.56
PF14244	Retrotran_gag_3	10.28
PF07727	RVT_2	6.54
PF13976	gag_pre-integrs	5.14
PF00665	rve	3.27
PF16297	DUF4939	0.93
PF04937	DUF659	0.47
PF02992	Transposase_21	0.47
PF02182	SAD_SRA	0.47
PF03732	Retrotrans_gag	0.47
PF07714	PK_Tyr_Ser-Thr	0.47
PF05990	DUF900	0.47
PF00201	UDPGT	0.47
PF00642	zf-CCCH	0.47
PF00675	Peptidase_M16	0.47
PF00805	Pentapeptide	0.47
PF01535	PPR	0.47

COG ID	Name	Functional Category	% Frequency in 214 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	3.27
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	3.27
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	3.27
COG4584	Transposase	Mobilome: prophages, transposons [X]	3.27
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	1.87
COG1819	UDP:flavonoid glycosyltransferase YjiC, YdhE family	Carbohydrate transport and metabolism [G]	0.93
COG1357	Uncharacterized conserved protein YjbI, contains pentapeptide repeats	Function unknown [S]	0.47
COG4782	Esterase/lipase superfamily enzyme	General function prediction only [R]	0.47

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
All Organisms	root	All Organisms	49.07 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
cellular organisms	root	All Organisms → cellular organisms	49.07 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	32.71 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	16.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	29.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	16.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	29.44 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	16.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	28.04 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	16.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	27.57 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	16.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	18.69 %
Enterobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter	16.36 %
Bryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta	2.34 %
Marchantiophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	18.69 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	16.36 %
Bryophytina	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina	2.34 %
Marchantiopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Polypodiopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida	17.29 %
unclassified Enterobacter cloacae complex	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex	16.36 %
Bryopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	2.34 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.40 %
Marchantiidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Polypodiidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.40 %
Marchantiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales	0.93 %
Dicranidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Polypodiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.93 %
Marchantiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae	0.93 %
Pseudoditrichales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Pteridineae	suborder	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Marchantia	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia	0.93 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.93 %
Ditrichaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Pteridaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.93 %
Ceratodon	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Parkerioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Ceratopteris	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Ceratopteris richardii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Ceratopteris richardii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Ceratopteris richardii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Ceratopteris richardii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Ceratopteris richardii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Ceratopteris richardii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	17.29 %
Enterobacter cloacae complex sp. GF14B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	16.36 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.93 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.93 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	0.47 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009500\|Ga0116229_10001310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	38476	Open in IMG/M
3300009500\|Ga0116229_10002101	All Organisms → cellular organisms → Eukaryota	32001	Open in IMG/M
3300009500\|Ga0116229_10002668	Not Available	28957	Open in IMG/M
3300009500\|Ga0116229_10043255	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	4648	Open in IMG/M
3300009500\|Ga0116229_10050025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	4185	Open in IMG/M
3300009500\|Ga0116229_10065700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3456	Open in IMG/M
3300009500\|Ga0116229_10093062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	2740	Open in IMG/M
3300009500\|Ga0116229_10102329	Not Available	2582	Open in IMG/M
3300009500\|Ga0116229_10165295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	1926	Open in IMG/M
3300009500\|Ga0116229_10177812	Not Available	1845	Open in IMG/M
3300009500\|Ga0116229_10223783	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1610	Open in IMG/M
3300009500\|Ga0116229_10357346	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1225	Open in IMG/M
3300009500\|Ga0116229_10364070	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1212	Open in IMG/M
3300009500\|Ga0116229_10527952	Not Available	975	Open in IMG/M
3300009500\|Ga0116229_10666640	Not Available	851	Open in IMG/M
3300009500\|Ga0116229_10840111	Not Available	744	Open in IMG/M
3300009500\|Ga0116229_10902352	Not Available	714	Open in IMG/M
3300009500\|Ga0116229_10974046	Not Available	683	Open in IMG/M
3300009500\|Ga0116229_11053783	Not Available	652	Open in IMG/M
3300009500\|Ga0116229_11082320	Not Available	642	Open in IMG/M
3300009500\|Ga0116229_11193164	Not Available	607	Open in IMG/M
3300009500\|Ga0116229_11428884	Not Available	548	Open in IMG/M
3300009500\|Ga0116229_11493034	Not Available	534	Open in IMG/M
3300009500\|Ga0116229_11646322	Not Available	503	Open in IMG/M
3300009510\|Ga0116230_10000727	Not Available	29491	Open in IMG/M
3300009510\|Ga0116230_10001117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	24950	Open in IMG/M
3300009510\|Ga0116230_10002731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	17025	Open in IMG/M
3300009510\|Ga0116230_10003178	Not Available	15984	Open in IMG/M
3300009510\|Ga0116230_10004461	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13721	Open in IMG/M
3300009510\|Ga0116230_10006028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	11907	Open in IMG/M
3300009510\|Ga0116230_10007260	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10935	Open in IMG/M
3300009510\|Ga0116230_10007890	Not Available	10514	Open in IMG/M
3300009510\|Ga0116230_10012988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	8203	Open in IMG/M
3300009510\|Ga0116230_10015563	Not Available	7467	Open in IMG/M
3300009510\|Ga0116230_10020281	Not Available	6471	Open in IMG/M
3300009510\|Ga0116230_10021437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6281	Open in IMG/M
3300009510\|Ga0116230_10021952	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	6201	Open in IMG/M
3300009510\|Ga0116230_10033965	Not Available	4835	Open in IMG/M
3300009510\|Ga0116230_10041238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	4316	Open in IMG/M
3300009510\|Ga0116230_10042885	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	4213	Open in IMG/M
3300009510\|Ga0116230_10049285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3873	Open in IMG/M
3300009510\|Ga0116230_10050568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3811	Open in IMG/M
3300009510\|Ga0116230_10051196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3781	Open in IMG/M
3300009510\|Ga0116230_10051270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	3778	Open in IMG/M
3300009510\|Ga0116230_10052664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3715	Open in IMG/M
3300009510\|Ga0116230_10059749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3435	Open in IMG/M
3300009510\|Ga0116230_10063097	Not Available	3322	Open in IMG/M
3300009510\|Ga0116230_10069856	Not Available	3119	Open in IMG/M
3300009510\|Ga0116230_10070630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3097	Open in IMG/M
3300009510\|Ga0116230_10082918	Not Available	2800	Open in IMG/M
3300009510\|Ga0116230_10146119	Not Available	1970	Open in IMG/M
3300009510\|Ga0116230_10149855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1940	Open in IMG/M
3300009510\|Ga0116230_10152106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	1922	Open in IMG/M
3300009510\|Ga0116230_10155066	Not Available	1899	Open in IMG/M
3300009510\|Ga0116230_10205883	Not Available	1599	Open in IMG/M
3300009510\|Ga0116230_10210524	Not Available	1577	Open in IMG/M
3300009510\|Ga0116230_10278821	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1331	Open in IMG/M
3300009510\|Ga0116230_10295797	Not Available	1284	Open in IMG/M
3300009510\|Ga0116230_10444122	Not Available	1003	Open in IMG/M
3300009510\|Ga0116230_10551113	Not Available	879	Open in IMG/M
3300009510\|Ga0116230_10616088	Not Available	821	Open in IMG/M
3300009510\|Ga0116230_10684484	Not Available	770	Open in IMG/M
3300009510\|Ga0116230_10957940	Not Available	628	Open in IMG/M
3300009510\|Ga0116230_11016530	Not Available	605	Open in IMG/M
3300009510\|Ga0116230_11052501	Not Available	593	Open in IMG/M
3300009510\|Ga0116230_11118264	Not Available	571	Open in IMG/M
3300009510\|Ga0116230_11169680	Not Available	556	Open in IMG/M
3300009510\|Ga0116230_11255711	Not Available	532	Open in IMG/M
3300009510\|Ga0116230_11321874	Not Available	514	Open in IMG/M
3300009627\|Ga0116109_1078201	Not Available	673	Open in IMG/M
3300009697\|Ga0116231_10004320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	28846	Open in IMG/M
3300009697\|Ga0116231_10005188	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	25795	Open in IMG/M
3300009697\|Ga0116231_10013974	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	11010	Open in IMG/M
3300009697\|Ga0116231_10015157	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10054	Open in IMG/M
3300009697\|Ga0116231_10050485	All Organisms → cellular organisms → Eukaryota	3021	Open in IMG/M
3300009697\|Ga0116231_10103195	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1755	Open in IMG/M
3300009697\|Ga0116231_10209191	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1105	Open in IMG/M
3300009697\|Ga0116231_10317522	Not Available	862	Open in IMG/M
3300009697\|Ga0116231_10624084	Not Available	588	Open in IMG/M
3300009697\|Ga0116231_10785554	Not Available	518	Open in IMG/M
3300009701\|Ga0116228_10000058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	62991	Open in IMG/M
3300009701\|Ga0116228_10003620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	13609	Open in IMG/M
3300009701\|Ga0116228_10004188	Not Available	12756	Open in IMG/M
3300009701\|Ga0116228_10008611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	9159	Open in IMG/M
3300009701\|Ga0116228_10010209	Not Available	8404	Open in IMG/M
3300009701\|Ga0116228_10010643	Not Available	8226	Open in IMG/M
3300009701\|Ga0116228_10013227	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	7335	Open in IMG/M
3300009701\|Ga0116228_10021445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	5600	Open in IMG/M
3300009701\|Ga0116228_10041264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	3771	Open in IMG/M
3300009701\|Ga0116228_10050135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3335	Open in IMG/M
3300009701\|Ga0116228_10055835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3119	Open in IMG/M
3300009701\|Ga0116228_10180467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1520	Open in IMG/M
3300009701\|Ga0116228_10214592	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1372	Open in IMG/M
3300009701\|Ga0116228_10341300	Not Available	1043	Open in IMG/M
3300009701\|Ga0116228_10374512	Not Available	987	Open in IMG/M
3300009701\|Ga0116228_10442490	Not Available	894	Open in IMG/M
3300009701\|Ga0116228_10518414	Not Available	814	Open in IMG/M
3300009701\|Ga0116228_10657991	Not Available	708	Open in IMG/M
3300009701\|Ga0116228_10680791	Not Available	695	Open in IMG/M
3300009709\|Ga0116227_10001797	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	48602	Open in IMG/M
3300009709\|Ga0116227_10003013	Not Available	37840	Open in IMG/M
3300009709\|Ga0116227_10007683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	20873	Open in IMG/M
3300009709\|Ga0116227_10040075	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	4588	Open in IMG/M
3300009709\|Ga0116227_10272836	Not Available	1298	Open in IMG/M
3300009709\|Ga0116227_10304605	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1220	Open in IMG/M
3300009709\|Ga0116227_10390061	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1062	Open in IMG/M
3300009709\|Ga0116227_10790851	Not Available	715	Open in IMG/M
3300009709\|Ga0116227_11330082	Not Available	540	Open in IMG/M
3300009709\|Ga0116227_11364523	Not Available	532	Open in IMG/M
3300009787\|Ga0116226_10002688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	15566	Open in IMG/M
3300009787\|Ga0116226_10006166	Not Available	10754	Open in IMG/M
3300009787\|Ga0116226_10014962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	7291	Open in IMG/M
3300009787\|Ga0116226_10018507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6644	Open in IMG/M
3300009787\|Ga0116226_10019485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	6490	Open in IMG/M
3300009787\|Ga0116226_10023021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	6019	Open in IMG/M
3300009787\|Ga0116226_10025835	All Organisms → cellular organisms → Eukaryota	5724	Open in IMG/M
3300009787\|Ga0116226_10029191	All Organisms → cellular organisms → Eukaryota	5417	Open in IMG/M
3300009787\|Ga0116226_10040445	Not Available	4670	Open in IMG/M
3300009787\|Ga0116226_10050910	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	4182	Open in IMG/M
3300009787\|Ga0116226_10059122	Not Available	3891	Open in IMG/M
3300009787\|Ga0116226_10126828	Not Available	2651	Open in IMG/M
3300009787\|Ga0116226_10130106	Not Available	2616	Open in IMG/M
3300009787\|Ga0116226_10132692	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	2589	Open in IMG/M
3300009787\|Ga0116226_10137733	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	2538	Open in IMG/M
3300009787\|Ga0116226_10138197	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	2534	Open in IMG/M
3300009787\|Ga0116226_10152986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	2401	Open in IMG/M
3300009787\|Ga0116226_10153860	Not Available	2394	Open in IMG/M
3300009787\|Ga0116226_10169239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	2274	Open in IMG/M
3300009787\|Ga0116226_10198811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	2083	Open in IMG/M
3300009787\|Ga0116226_10223106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1953	Open in IMG/M
3300009787\|Ga0116226_10288503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1692	Open in IMG/M
3300009787\|Ga0116226_10304183	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1642	Open in IMG/M
3300009787\|Ga0116226_10320143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1595	Open in IMG/M
3300009787\|Ga0116226_10389218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1424	Open in IMG/M
3300009787\|Ga0116226_10525432	Not Available	1194	Open in IMG/M
3300009787\|Ga0116226_10534387	Not Available	1182	Open in IMG/M
3300009787\|Ga0116226_10554945	Not Available	1155	Open in IMG/M
3300009787\|Ga0116226_10575590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1130	Open in IMG/M
3300009787\|Ga0116226_10700873	Not Available	1003	Open in IMG/M
3300009787\|Ga0116226_10788360	Not Available	933	Open in IMG/M
3300009787\|Ga0116226_10800403	Not Available	925	Open in IMG/M
3300009787\|Ga0116226_10842623	Not Available	896	Open in IMG/M
3300009787\|Ga0116226_10870973	Not Available	877	Open in IMG/M
3300009787\|Ga0116226_10964359	Not Available	824	Open in IMG/M
3300009787\|Ga0116226_10993646	Not Available	808	Open in IMG/M
3300009787\|Ga0116226_11026022	Not Available	792	Open in IMG/M
3300009787\|Ga0116226_11247205	Not Available	702	Open in IMG/M
3300009787\|Ga0116226_11273041	Not Available	693	Open in IMG/M
3300009787\|Ga0116226_11414788	Not Available	649	Open in IMG/M
3300009787\|Ga0116226_11447952	Not Available	640	Open in IMG/M
3300009787\|Ga0116226_11473714	Not Available	633	Open in IMG/M
3300009787\|Ga0116226_11511073	Not Available	623	Open in IMG/M
3300009787\|Ga0116226_11755056	Not Available	568	Open in IMG/M
3300009787\|Ga0116226_11770818	Not Available	565	Open in IMG/M
3300009787\|Ga0116226_12030777	Not Available	520	Open in IMG/M
3300009787\|Ga0116226_12134858	Not Available	504	Open in IMG/M
3300014654\|Ga0181525_10492465	Not Available	678	Open in IMG/M
3300014658\|Ga0181519_10290001	Not Available	1017	Open in IMG/M
3300017941\|Ga0187850_10334690	Not Available	667	Open in IMG/M
3300018030\|Ga0187869_10176215	Not Available	1053	Open in IMG/M
3300027807\|Ga0209208_10000016	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	182422	Open in IMG/M
3300027807\|Ga0209208_10000146	Not Available	76118	Open in IMG/M
3300027807\|Ga0209208_10000173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	73212	Open in IMG/M
3300027807\|Ga0209208_10000300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	60704	Open in IMG/M
3300027807\|Ga0209208_10000322	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	59027	Open in IMG/M
3300027807\|Ga0209208_10000327	Not Available	58789	Open in IMG/M
3300027807\|Ga0209208_10000328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	58781	Open in IMG/M
3300027807\|Ga0209208_10001412	Not Available	33741	Open in IMG/M
3300027807\|Ga0209208_10001419	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	33696	Open in IMG/M
3300027807\|Ga0209208_10003154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	23726	Open in IMG/M
3300027807\|Ga0209208_10004998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	18585	Open in IMG/M
3300027807\|Ga0209208_10005414	Not Available	17792	Open in IMG/M
3300027807\|Ga0209208_10005485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	17684	Open in IMG/M
3300027807\|Ga0209208_10006343	Not Available	16309	Open in IMG/M
3300027807\|Ga0209208_10009184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	13040	Open in IMG/M
3300027807\|Ga0209208_10009396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12856	Open in IMG/M
3300027807\|Ga0209208_10011174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	11531	Open in IMG/M
3300027807\|Ga0209208_10015649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	9179	Open in IMG/M
3300027807\|Ga0209208_10016423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8862	Open in IMG/M
3300027807\|Ga0209208_10018713	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8066	Open in IMG/M
3300027807\|Ga0209208_10021598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	7255	Open in IMG/M
3300027807\|Ga0209208_10023417	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	6820	Open in IMG/M
3300027807\|Ga0209208_10031766	All Organisms → cellular organisms → Eukaryota	5330	Open in IMG/M
3300027807\|Ga0209208_10033263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	5129	Open in IMG/M
3300027807\|Ga0209208_10038603	Not Available	4534	Open in IMG/M
3300027807\|Ga0209208_10039905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	4412	Open in IMG/M
3300027807\|Ga0209208_10043195	Not Available	4120	Open in IMG/M
3300027807\|Ga0209208_10045480	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	3939	Open in IMG/M
3300027807\|Ga0209208_10054628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	3355	Open in IMG/M
3300027807\|Ga0209208_10056108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3276	Open in IMG/M
3300027807\|Ga0209208_10057833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	3192	Open in IMG/M
3300027807\|Ga0209208_10072299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	2626	Open in IMG/M
3300027807\|Ga0209208_10104510	Not Available	1901	Open in IMG/M
3300027807\|Ga0209208_10234535	Not Available	986	Open in IMG/M
3300027807\|Ga0209208_10336855	Not Available	755	Open in IMG/M
3300027807\|Ga0209208_10440823	Not Available	623	Open in IMG/M
3300027860\|Ga0209611_10000354	All Organisms → cellular organisms → Eukaryota → Viridiplantae	64727	Open in IMG/M
3300027860\|Ga0209611_10000559	All Organisms → cellular organisms → Eukaryota	56895	Open in IMG/M
3300027860\|Ga0209611_10001986	Not Available	35764	Open in IMG/M
3300027860\|Ga0209611_10003339	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	27901	Open in IMG/M
3300027860\|Ga0209611_10003870	Not Available	25745	Open in IMG/M
3300027860\|Ga0209611_10005322	Not Available	21618	Open in IMG/M
3300027860\|Ga0209611_10014023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	10845	Open in IMG/M
3300027860\|Ga0209611_10020872	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	7644	Open in IMG/M
3300027860\|Ga0209611_10041048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	4022	Open in IMG/M
3300027860\|Ga0209611_10064021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B	2744	Open in IMG/M
3300027860\|Ga0209611_10115503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Polypodiopsida → Polypodiidae → Polypodiales → Pteridineae → Pteridaceae → Parkerioideae → Ceratopteris → Ceratopteris richardii	1767	Open in IMG/M
3300027860\|Ga0209611_10418776	Not Available	764	Open in IMG/M
3300027860\|Ga0209611_10531301	Not Available	657	Open in IMG/M
3300027860\|Ga0209611_10585216	Not Available	618	Open in IMG/M
3300027860\|Ga0209611_10601666	Not Available	607	Open in IMG/M
3300027860\|Ga0209611_10669471	Not Available	566	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.66%
Environmental	Environmental	2.34%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	97.66%
Aquatic	Environmental → Aquatic	2.34%

Habitat	Taxonomy	Distribution
Peat Moss	Host-Associated → Plants → Peat Moss	97.66%
Freshwater	Environmental → Aquatic → Freshwater	2.34%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified	97.66%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.34%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified	97.66%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.87%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated	97.66%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.93%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.93%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.47%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300009500	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG	Host-Associated	Open in IMG/M
3300009510	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG	Host-Associated	Open in IMG/M
3300009627	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10	Environmental	Open in IMG/M
3300009697	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG	Host-Associated	Open in IMG/M
3300009701	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG	Host-Associated	Open in IMG/M
3300009709	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG	Host-Associated	Open in IMG/M
3300009787	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG	Host-Associated	Open in IMG/M
3300014654	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG	Environmental	Open in IMG/M
3300014658	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG	Environmental	Open in IMG/M
3300017941	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150	Environmental	Open in IMG/M
3300018030	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100	Environmental	Open in IMG/M
3300027807	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)	Host-Associated	Open in IMG/M
3300027860	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0116229_100013102	3300009500	Host-Associated	MSFISAQYFSFIDDNHKELSLSKEIEFKIEAKTLDI*
Ga0116229_100021014	3300009500	Host-Associated	MSFIFSQNFSFIDDDHKEISFSKEIDFKTEAETLDT*
Ga0116229_100026684	3300009500	Host-Associated	MSSISAQNFSFINDDHKEISLSKETDFKIEAEILDA*
Ga0116229_100432555	3300009500	Host-Associated	MSSISVQNFSSIDGDRKELLPSKRTDFKTEIEILNA*
Ga0116229_100500252	3300009500	Host-Associated	MFSISTQNFNSIDDDQKELSLSKGIDFKTEIETLNV*
Ga0116229_100657002	3300009500	Host-Associated	MSSIFAQNCSSIDDDHKELSLSKEIDFKIKTKTLDA*
Ga0116229_100930621	3300009500	Host-Associated	MSFIFAQNFSSIDDDHKELSLSKKTDFKTESEILNV*
Ga0116229_101023291	3300009500	Host-Associated	MSSIYTQNFSSIDDDHEELSLSKETDFKTKIETLDV*
Ga0116229_101652954	3300009500	Host-Associated	MSFISTQNFSSIDDDHKELSLSKEIDFKIETETLDA*
Ga0116229_101778122	3300009500	Host-Associated	MLSVSLQNVSSIDDDHKKLSLSKETNFKIKTETLDA*
Ga0116229_102237834	3300009500	Host-Associated	MFSIFFQTFSSIDDDHKELSLSKKTDFKTETETLDA*
Ga0116229_103573461	3300009500	Host-Associated	MSSIFAQNFSSIDDDHKEISLSKETDFKTETETSDAWIS
Ga0116229_103640702	3300009500	Host-Associated	MSSISVQNFSSIDDDHKEISLSKETDFKTETETSNA*
Ga0116229_105279521	3300009500	Host-Associated	MSSISAQNFSSINDDHKEISLSKETDFKIETETLDA*
Ga0116229_106666401	3300009500	Host-Associated	MSSISAQNFSPIDDDHKEISLSKETDFKTETETSDA
Ga0116229_108401111	3300009500	Host-Associated	FGRHIKYMSSISAQNFSSINDDHKEISLSKETDFKIETETLNA*
Ga0116229_109023522	3300009500	Host-Associated	MSSISAQNFSSIDDDHKEISLSKETDFKTETETLDT*
Ga0116229_109740462	3300009500	Host-Associated	MSSISAQNFSSIDDDHKEISLSKETDFKTKTETSNA*
Ga0116229_110537831	3300009500	Host-Associated	MSSISAQNFSSINDDHKEISVSKETDFKTETKTLDA*
Ga0116229_110823201	3300009500	Host-Associated	MSSISAQNFSSINDDHKEISLSKETDFKTKTETLDA*
Ga0116229_111931641	3300009500	Host-Associated	MSSIFVQNFSFIGDDHKELSLSKETDFKTEAETLDT*
Ga0116229_114288842	3300009500	Host-Associated	MSSISAQNFSFINDDHKEISLSKETDFKTETETLDA*
Ga0116229_114930342	3300009500	Host-Associated	MSFIFAQNFNPIDDDHKEISLSKEIDFKIETETSDA*
Ga0116229_116463221	3300009500	Host-Associated	HIRYMFSISAQNFSSINDDHKEISLSKETDFKTETETLDA*
Ga0116230_100007276	3300009510	Host-Associated	MSSIFARNFSSIDDDHKELSLSKEIDFKTEAETLDT*
Ga0116230_1000111710	3300009510	Host-Associated	MSSISIQNFSSIGDNHKELSLSKETDFKTKVETLDI*
Ga0116230_1000273110	3300009510	Host-Associated	MSSISIQNFSSIDNGYKELSLSKEIDSKTKVEILDT*
Ga0116230_100031781	3300009510	Host-Associated	MSFIFVQNFSFIGDDHKELSLSKEIDFKTKAKTLDT*
Ga0116230_1000446110	3300009510	Host-Associated	MSFISVHNFNSIGDDHKESSLSKEIDFEIEGEPLDT*
Ga0116230_1000602812	3300009510	Host-Associated	MSSIFFQNFNSIDDDHKELSLSKEIVFKTEAETLGT*
Ga0116230_100072602	3300009510	Host-Associated	MYTQNFSFIDDDHKELSLSKEIDLKTEVETLDTWISLNT*
Ga0116230_100078902	3300009510	Host-Associated	MSSISIQNFSSIDDDHKELSLSKETDFKIKAETLDA*
Ga0116230_1001298813	3300009510	Host-Associated	MSSISIQNFSSISDDHKELSLSKETNFKTEAKTLDT*
Ga0116230_100155632	3300009510	Host-Associated	MYVFIFIKNLNFIDDDHKELSLSKETDFKTKVEL*
Ga0116230_100202814	3300009510	Host-Associated	MSSISVQNFNSIGDDHKELSLSKETDFKTKAEILNT*
Ga0116230_100214371	3300009510	Host-Associated	MFSIFVQNFSSIDDDHKELSLSKETDFKTKAETLDN*
Ga0116230_100219524	3300009510	Host-Associated	MSSISIQNFSFIDDDHKELSLSKETDFKIKAETLDT*
Ga0116230_100339656	3300009510	Host-Associated	MSFISIQNFSSIGDNHKELSLSKEIDFKIKAETLDT*
Ga0116230_100412387	3300009510	Host-Associated	MSFISVQNLSSIDDDHKELSLSKETDFKIEVETLDI*
Ga0116230_100428851	3300009510	Host-Associated	MSSISFQNFSSIHDDHKELSLSKETDLKIEVETLDT*
Ga0116230_100492855	3300009510	Host-Associated	MYSISVQNFSSIDDDHKELSLSKETDFKTEAKTLDA*
Ga0116230_100505681	3300009510	Host-Associated	MSFISVQNFSSIDDDHKELSLSKETDFKTEVETLDT*
Ga0116230_100511967	3300009510	Host-Associated	MSSIYVQTFSSIDDDHKELSLSKETDFKTKAEILDT*
Ga0116230_100512705	3300009510	Host-Associated	MFSIFGQNFSSIYDDHKEISLSKETDFKIEAETLDT*
Ga0116230_100526647	3300009510	Host-Associated	MSSIFVQNFSSIGDDHKELSLSKETDFKIEAETLDT*
Ga0116230_100597493	3300009510	Host-Associated	MSSISTQNFSSIDDDHKELSLSKETDFKIEAKTLDT*
Ga0116230_100630973	3300009510	Host-Associated	MSSIFVQNFSFIGDNHKECFFYSLLKEIDFKIEAETLDAL*
Ga0116230_100698562	3300009510	Host-Associated	MSSISVQTFNFINDDHKELSLSKEIDFKTKVETLDT*
Ga0116230_100706306	3300009510	Host-Associated	MSFTFTQNFSSIDDDHKEISLSKETDFKTEAETLDT*
Ga0116230_100829181	3300009510	Host-Associated	MSSIFVQTFSFINDDHKELSLSKETDFKTKVEILDT*
Ga0116230_101461192	3300009510	Host-Associated	MSSIFGQTFSSIGGDHKELSLSKETDFKIEAKTLDT*
Ga0116230_101498553	3300009510	Host-Associated	MSSISIQNFNSIDDDHKELSLSKEVHFKIEAETLDT*
Ga0116230_101521061	3300009510	Host-Associated	MSSISVQNFNSIGDDHKELSLSKETDFKIEAETLDT*
Ga0116230_101550661	3300009510	Host-Associated	MSSIFVQNFSSIDDDHKELSLSKETNFKIEAETLDT*
Ga0116230_102058832	3300009510	Host-Associated	MSLIFAKNFNFIGDDHKELSLSKEIDFKIEVETLDT*
Ga0116230_102105242	3300009510	Host-Associated	MFSIFVQNFSSIGDNHKELSLLKEIDFKIEAETLDT*
Ga0116230_102788213	3300009510	Host-Associated	MSSISIQTFNSIDDDHKELSLSKVTDFKTKAEILDT*
Ga0116230_102957971	3300009510	Host-Associated	MFSIFVQNFSSIYDDHKEISLSKETDFKIEAETLDT*
Ga0116230_104441222	3300009510	Host-Associated	MSSISIKKFSSIGDDHKELSFPKKTGFKTEAEILDT*
Ga0116230_105511131	3300009510	Host-Associated	MSSISVQNFNSIGDDQKELSLSKETDFKTKAEILDT*
Ga0116230_106160881	3300009510	Host-Associated	MFSISVQNFSSIGDNHKKLSLLKEIDFKIEAETLDT*
Ga0116230_106844841	3300009510	Host-Associated	MSSISAQNFSSIGDDQKELSVSKETDFKTKVEILDT*
Ga0116230_109579401	3300009510	Host-Associated	MFFISVQNVSTIDDDHKMLSLSKEIDFKIEAKTLDT*
Ga0116230_110165301	3300009510	Host-Associated	MSSISPQNFSSIDDDHKEISLSKETDFKTEIETSNA*
Ga0116230_110525011	3300009510	Host-Associated	MSSISVQNFSSIGDDHKELSLSKETDFKTEAETLDT*
Ga0116230_111182641	3300009510	Host-Associated	MSSICTQNFSSIDDDYKEISLSKETDFKTETKTLDAWI
Ga0116230_111696801	3300009510	Host-Associated	MSSISFQNFSSIDDDYKEKSLSKETDFKTEIETSDA*
Ga0116230_112557112	3300009510	Host-Associated	MSSISAQNFSSIDDDHKEISLSKEIDFKTETKTSDA*
Ga0116230_113218741	3300009510	Host-Associated	TYMSSISAQNFSSINDDHKEISLSKETDFKTETETLDA*
Ga0116109_10782011	3300009627	Peatland	MSSISVQNFNSIDNGYKELSLSKEIDSKTKVEILDT*
Ga0116231_100043206	3300009697	Host-Associated	MFSIFFQTFSSIDDDHKELSLSKETDFKTETETLDA*
Ga0116231_1000518819	3300009697	Host-Associated	MSFISTQNFSSIDDDHKELSLSKETDFKIETETLDA*
Ga0116231_1001397415	3300009697	Host-Associated	MSSISVQNFSPIDDDHKEISLSKETDFKTEIETSDA*
Ga0116231_100151577	3300009697	Host-Associated	MSSIFVQNFSSIDDDHKEISLSKETDFKTETETSDA*
Ga0116231_100504855	3300009697	Host-Associated	MSSIFAQNFSPIDDDHKEISLSKETDFKTETETSDAWIS
Ga0116231_101031951	3300009697	Host-Associated	MSFISSQSFSSIDDDHKEISLSKETNFKTETKTLEA
Ga0116231_102091911	3300009697	Host-Associated	MSYISAQNFSSINDDHKEISLSKETDFKTKTETLDAWISLNIN
Ga0116231_103175222	3300009697	Host-Associated	MSSISAQNFSSINDDHKDISLSKETDFKTKTETLDA*
Ga0116231_106240841	3300009697	Host-Associated	SSMSAQNFSSINDDHKEISLSKETDFKIETETLDA*
Ga0116231_107855542	3300009697	Host-Associated	MSSISAQNFSSINDDHKEISLSKETDFKTETETLDA*
Ga0116228_1000005813	3300009701	Host-Associated	MSSIFVQNFSSIDDDHKKLSLSKEFDFKTEVETLNT*
Ga0116228_100036207	3300009701	Host-Associated	MSSISIQNFSSIDDDHKELSLSKETDFKIEAKTLDT*
Ga0116228_100041886	3300009701	Host-Associated	MSSISIQNFNSIDDDHKELSLSKEVDFKIEAETLDT*
Ga0116228_100086112	3300009701	Host-Associated	MSSISVQNFSSIDNGYKELSLSKEIDSKTKVEILDT*
Ga0116228_1001020911	3300009701	Host-Associated	MSSIFVQIFSFIGDNHKEFFFYSLSKETDFKIEAETLDA*
Ga0116228_100106431	3300009701	Host-Associated	MSSIYVQIFGSIDVNHKELSLLKKTDFKIEVETLDT*
Ga0116228_100132277	3300009701	Host-Associated	ERHIKYMSSIFVQNFSSIGDGHKELSPSKETDFKTKVETLDT*
Ga0116228_100214451	3300009701	Host-Associated	MSFIFVQNFSSIDDDRKELSLSKETDFKTEVETLNT*
Ga0116228_100412642	3300009701	Host-Associated	MSSIFVQNFSSIGDDHKKLSFSKETNFKIEAETLDT*
Ga0116228_100501352	3300009701	Host-Associated	MFSIFVQNFSSIGDNHKELSLLKEIDFKIKAETLDT*
Ga0116228_100558356	3300009701	Host-Associated	MSSISVQNFSSIGDEHKELSLSKEIDFKIEAETLDA*
Ga0116228_101804671	3300009701	Host-Associated	MSSISAQNFSSINDDYKEISLSKETDLKTKTETSDAWIS
Ga0116228_102145922	3300009701	Host-Associated	MSFISVQNLSSIDDDHKELSLSKETNFKIEVETLDI*
Ga0116228_103413001	3300009701	Host-Associated	MSSISAQNFSSIDDNYKEISLSKETDFKTETETSDA*
Ga0116228_103745122	3300009701	Host-Associated	MSSISAQNFSSIDDDYKEISLSKEIDFKTETETLDA*
Ga0116228_104424901	3300009701	Host-Associated	MSSISVQNFSSIDEDHKELSLSKETDFKIKAETLDA*
Ga0116228_105184141	3300009701	Host-Associated	MSSISSQNFSSIDDDYKEISLSKETDFKIKAETSDA*
Ga0116228_106579911	3300009701	Host-Associated	MFFISAQNVSTIDDDHKMLSLSKEVDFKIEAKTLDT*
Ga0116228_106807911	3300009701	Host-Associated	MSSISVQNFSSIGDDHKELSLSKETDFKTKVETLDI*
Ga0116227_1000179735	3300009709	Host-Associated	MPSISFQNFSSIDDDHKKLSLSKETNFKTEAKTLDT*
Ga0116227_100030138	3300009709	Host-Associated	MLSVSFQNVSSIDDDHKKLSLSKETNFKIKTETLDA*
Ga0116227_1000768317	3300009709	Host-Associated	MSSILIKNFSFIDDDHKELSLSKEIDFKTKIETLDA*
Ga0116227_100276095	3300009709	Host-Associated	MSSISAQNFSSIDGDRKELSPSKRTDFKTEIEILNA*
Ga0116227_100400752	3300009709	Host-Associated	MFSISAQNFSSINDDHKEISLSKETDFKTETETLDA*
Ga0116227_102728362	3300009709	Host-Associated	MSSIFAQNFSSIDDDHKEISLSKETDFKTETETSDA*
Ga0116227_103046051	3300009709	Host-Associated	MSSISVQNFSSIDDDHKEISLSKETDFKTETETSDA
Ga0116227_103900611	3300009709	Host-Associated	MSSISTQNFSSINDDHKEISLSKETDFKTEIETLDAWIS
Ga0116227_107908511	3300009709	Host-Associated	MSSISAQNFSSINDDHKEISLSKETDFKIETETLNA*
Ga0116227_113300821	3300009709	Host-Associated	MSSIFAQNFSSIDDDHKEISLSKETDFKTETETSDA
Ga0116227_113645231	3300009709	Host-Associated	MSSISAQNFSPIDDDHKEISLSKETDFKTETETSDAWIS
Ga0116226_100026889	3300009787	Host-Associated	MSYISLPNFSSIDDDYKELSFSKEIDFKIEAETLDT*
Ga0116226_100061663	3300009787	Host-Associated	MSSISIQNFSSINDDHKELSLSKETDFKTEVKTLKS*
Ga0116226_100149622	3300009787	Host-Associated	MPSTSAQNFSSIDDDHKEISLSKETNFKTKAKTLDT*
Ga0116226_100185077	3300009787	Host-Associated	MPSISVQNFRCIGEDHKKLSFSKEIDFKTEAETLDT*
Ga0116226_100194851	3300009787	Host-Associated	MSSIFVQNFSFIDDDHKELSLSKEIDFKTEAEILDT*
Ga0116226_100230217	3300009787	Host-Associated	MSSIFVQNFSSIDDDHKELSLSKEIDFKIEAETLDT*
Ga0116226_100258359	3300009787	Host-Associated	MFSIYVQNSSSIDDDHKEISLSKEIDFKIEGKTLDI*
Ga0116226_100291912	3300009787	Host-Associated	MFSISVQNFSSIDDDHKELSLSKETNFKTKAEILDT*
Ga0116226_100404452	3300009787	Host-Associated	MSFISVHNFNSIGDDHKKSSLSKEIDFETKGETLYT*
Ga0116226_100509104	3300009787	Host-Associated	MSFISVQTFSSIDDDHKELSLSKETDFKTKVETLDT*
Ga0116226_100591223	3300009787	Host-Associated	MSSISIQNFSSIGDDHKELSLSKEIDLKTEAETLDT*
Ga0116226_101268282	3300009787	Host-Associated	MSLIFVQNFNSIDDDHKELSFSKETDFKTEVETLDI*
Ga0116226_101301062	3300009787	Host-Associated	MSSIFVQNFNSIGDDHKELSLSKETDFKTEAETLDT*
Ga0116226_101326927	3300009787	Host-Associated	MFSTPAQNFSSIDDDYKEISLSKETNFKTEAEALDT*
Ga0116226_101377331	3300009787	Host-Associated	MSSIYVQNFSSIGDDHKELSLLKEIDFKTEAKTLDA*
Ga0116226_101381975	3300009787	Host-Associated	MSPIYVQDFSSIGDNHKELSLSKETDFKTEAETLDA*
Ga0116226_101529862	3300009787	Host-Associated	MFSISDQNCGSIDDDHKEISLSKEIDFKIEVETLDT*
Ga0116226_101538601	3300009787	Host-Associated	GYMSSIFSQNFSSINDDHKELSLSKEIDFKTEAETLDT*
Ga0116226_101692391	3300009787	Host-Associated	MSSISIQNFSSIDDDHKELSLSKEIDFKTEAKTLDT*
Ga0116226_101988112	3300009787	Host-Associated	MFSIFVQNFSFIGDDHKELSLSKETDFKTEAETLDT*
Ga0116226_102231063	3300009787	Host-Associated	MSSISVQTFNSIDDDHKELSLSKETDFKIKVETLDT*
Ga0116226_102885032	3300009787	Host-Associated	MSSTFAQNFSSIDDDQKEISLSKESHFKIEAETLDA*
Ga0116226_103041832	3300009787	Host-Associated	MSTIFLQNFSSIDDDHKELSLSKEIDFKTEAETLDI*
Ga0116226_103201431	3300009787	Host-Associated	MSSIFFQTFNSIDDDHKELSLSKETPFKTKAETLDT*
Ga0116226_103892181	3300009787	Host-Associated	MSSIFIQNFSSIGDDHKELSLSKEIDFKIEVETLDT*
Ga0116226_105254322	3300009787	Host-Associated	MSSIYAQNFSSIDDDHKELSLSKETNFKIKVKTLDT*
Ga0116226_105343871	3300009787	Host-Associated	MFSTFSQKFFHIDDDHKELSLSKETNFKVKAQILDT*
Ga0116226_105549451	3300009787	Host-Associated	MSSISVQNFNFIGDDHKELSLSKETDFKIEVETLDT*
Ga0116226_105755903	3300009787	Host-Associated	MSSIFSQNFSSINDDHKELSLSKEIDFKTEAETLDT*IS
Ga0116226_107008732	3300009787	Host-Associated	MSSIFVQNFSFIGDDNKELSLSKETDFKIEVETLDA*
Ga0116226_107883601	3300009787	Host-Associated	MSSIYVINFSSIGDDHKELSLSKETDFKTKAETLDT*
Ga0116226_108004032	3300009787	Host-Associated	MSSIFAQNFSSIDDDHKKISLSKEIDFKTKTETSDA*
Ga0116226_108426231	3300009787	Host-Associated	FERHIKYMSSISVQNFSSIGDDHKELSLSKETDFKT*
Ga0116226_108709731	3300009787	Host-Associated	MSSISAKNFSSIGDDHKELSLYKKIDFKIEVETLDT*
Ga0116226_109643591	3300009787	Host-Associated	MSSISDQNYNSIDDDHKEISLSKESDFKIEVETLDT*
Ga0116226_109936461	3300009787	Host-Associated	MSSIYVQNFSSIDDDHKKLSLSKEIDFKTKVKTLDIWISLNT
Ga0116226_110260221	3300009787	Host-Associated	THKYMFIIFVQNFNSIDDDHKELSLSKEIDFKTKVEI*
Ga0116226_112472051	3300009787	Host-Associated	HIRYMSFTSIQNFSSIDDDHKGLLLLKKTNFKIEVETLNT*
Ga0116226_112730411	3300009787	Host-Associated	YMSSISIQNFSSIGDDHKELSFSKETDFKTKVQTLDI*
Ga0116226_114147882	3300009787	Host-Associated	MSSIFAQNFSSIDDDYKEISLSKETDFKIETETSDAWISLNT
Ga0116226_114182962	3300009787	Host-Associated	MSSISAQNFSSIDDDYKEISLSKETNFKTETKTSNAWISPK*
Ga0116226_114479522	3300009787	Host-Associated	MSFICAQNFSSIDDDYKEISLSKETDFKTKAETSDA*
Ga0116226_114737142	3300009787	Host-Associated	MCSISIQSFSSIDDDHKELSLSKETDFKIEAEILDI*
Ga0116226_115110731	3300009787	Host-Associated	MSSICAQNFSSIDDDNKEISLSKETNFKTKAETSDA*
Ga0116226_117550561	3300009787	Host-Associated	MSSIYVQNFSSIDDDDKEISLSKEIDFKTETETSDA*
Ga0116226_117708182	3300009787	Host-Associated	SISIQSFSSIDDDHKELSLSKETDFKIKAETLDA*
Ga0116226_120307772	3300009787	Host-Associated	MSSISVQNFSSIGDDQKELSLSKETDFKTKAEILDT*
Ga0116226_121348581	3300009787	Host-Associated	MFIIFVQNFNSIDDDHKELSLSKEIDFKTKVEI*DT
Ga0181525_104924651	3300014654	Bog	MSSTFAQNFSSIDDDHKELSLSKETDFKTEAETLDT*
Ga0181519_102900012	3300014658	Bog	MSSTFTQNFSFIDDDHKELSLSKETDFKTKAETLDT*
Ga0187850_103346901	3300017941	Peatland	MSSISVQNFSSIDDDHKKLSLSKETNFKTEAKTLDT
Ga0187869_101762151	3300018030	Peatland	MSSISAQNFSSIDDDYKEISLSKETDFKTKPETLDT
Ga0209208_1000001619	3300027807	Host-Associated	MSSIFVQNFSSIDDDHKKLSLSKEFDFKTEVETLNT
Ga0209208_1000014624	3300027807	Host-Associated	MFSIFFQNFSSIDDDHKELSLSKETDFKTKAETLDN
Ga0209208_1000017359	3300027807	Host-Associated	MSSIFARNFSSIDDDHKELSLSKEIDFKTEAETLDT
Ga0209208_1000030035	3300027807	Host-Associated	MSSISVQNFSSIDDGHKELSLSKYTNFKIEVETLDI
Ga0209208_1000032246	3300027807	Host-Associated	MYSMYTQNFSFIDDDHKELSLSKEIDLKTEVETLDTWISLNT
Ga0209208_100003279	3300027807	Host-Associated	MSLIFAKNFNFIGDDHKELSLSKEIDFKIEVETLDT
Ga0209208_1000032844	3300027807	Host-Associated	MSSISVQNFSSIDNGYKELSLSKEIDSKTKVEILDT
Ga0209208_1000141227	3300027807	Host-Associated	MSSISFQNFSSIHDDHKELSLSKETDLKIEVETLDT
Ga0209208_1000141912	3300027807	Host-Associated	MSSISIQNFNSIDDDHKELSLSKEVDFKIEAETLDT
Ga0209208_1000315424	3300027807	Host-Associated	MSSIFFQNFNSIDDDHKELSLSKEIVFKTEAETLGT
Ga0209208_100049984	3300027807	Host-Associated	MSSISIQNFSSISDDHKELSLSKETNFKTEAKTLDT
Ga0209208_1000541412	3300027807	Host-Associated	MSFISVQNFSSIDDDHKELSLSKETDFKTEVETLDT
Ga0209208_1000548514	3300027807	Host-Associated	MSSISIQNFSSIDDDHKELSLSKETDFKIKAETLDA
Ga0209208_1000634312	3300027807	Host-Associated	MSSISVQNFNSIGDDHKELSLSKETDFKTKAEILNT
Ga0209208_100091845	3300027807	Host-Associated	MSSISIQNFSFIDDDHKELSLSKETDFKIKAETLDTXILSIRI
Ga0209208_100093969	3300027807	Host-Associated	MSFISVHNFNSIGDDHKESSLSKEIDFEIEGEPLDT
Ga0209208_1001117410	3300027807	Host-Associated	MSSISVQTFNSIDDDHKELSLSKETDFKIKVETLDT
Ga0209208_100156495	3300027807	Host-Associated	MSSIFVQNFSSIGDDHKELSLSKETDFKIEAETLDT
Ga0209208_100164234	3300027807	Host-Associated	MFSIFVQNFSSIYDDHKEISLSKETDFKIEAETLDT
Ga0209208_100187133	3300027807	Host-Associated	MSSIYVQTFSSIDDDHKELSLSKETDFKTKAEILDT
Ga0209208_100215986	3300027807	Host-Associated	MSSIFVQNFSSIGDDHKKLSFSKETNFKIEAKTLDT
Ga0209208_100234171	3300027807	Host-Associated	MYSISVQNFSSIDDDHKELSLSKETDFKTEAKTLDA
Ga0209208_100317662	3300027807	Host-Associated	MSSISTQNFSSIDDDHKELSLSKETDFKIEAKTLDT
Ga0209208_100332631	3300027807	Host-Associated	MSSISIQTFNSIDDDHKELSLSKVTDFKTKAEILDT
Ga0209208_100386031	3300027807	Host-Associated	MSSISIKKFSSIGDDHKELSFPKKTGFKTEAEILDT
Ga0209208_100399058	3300027807	Host-Associated	MSFISVQNLSSIDDDHKELSLSKETNFKIEVETLDI
Ga0209208_100431952	3300027807	Host-Associated	MSSISVQTFNFINDDHKELSLSKEIDFKTKVETLDT
Ga0209208_100454802	3300027807	Host-Associated	MFSIFGQNFNSIYDDHKEISLSKETDFKIEAETLDT
Ga0209208_100546284	3300027807	Host-Associated	MSSISVQNFNSIGDDHKELSLSKETDFKIEAETLDT
Ga0209208_100561081	3300027807	Host-Associated	MSFTFTQNFSSIDDDHKEISLSKETDFKTEAETLDT
Ga0209208_100578331	3300027807	Host-Associated	MSSIYVQTLSSIDDDHKELSLSKETDFKTKAETLDT
Ga0209208_100722992	3300027807	Host-Associated	MSSISAQNFSSIGDDQKELSVSKETDFKTKVEILDT
Ga0209208_101045103	3300027807	Host-Associated	MFSISVQNFSSIGDNHKKLSLLKEIDFKIEAETLDT
Ga0209208_102345352	3300027807	Host-Associated	MFSIFVQNFSSIGDNHKELSLLKEIDFKIEAETLDT
Ga0209208_103368552	3300027807	Host-Associated	MSSISAQNFSSINDDHKEISLSKETDFKTETETLDA
Ga0209208_104408231	3300027807	Host-Associated	MFSIFFQNFSSIYDDHKEISLSKETDFKIEAETLDTXTSFSSDP
Ga0209611_1000035417	3300027860	Host-Associated	MFSISTQNFNSIDDDQKELSLSKGIDFKTEIETLNV
Ga0209611_1000055928	3300027860	Host-Associated	MSFIFSQNFSFIDDDHKEISFSKEIDFKTEAETLDT
Ga0209611_1000198629	3300027860	Host-Associated	MSSISAQNFSFINDDHKEISLSKETDFKIEAEILDA
Ga0209611_1000333919	3300027860	Host-Associated	MSFISTQNFSSIDDDHKELSLSKEIDFKIETETLDA
Ga0209611_1000387018	3300027860	Host-Associated	MSFISAQYFSFIDDNHKELSLSKEIEFKIEAKTLDI
Ga0209611_1000532227	3300027860	Host-Associated	MSSISAQNFSFIDGDRKELSPSKRTDFKTEIEILNA
Ga0209611_100140233	3300027860	Host-Associated	MFSIFFQTFSSIDDDHKELSLSKKTDFKTETETLDA
Ga0209611_1002087210	3300027860	Host-Associated	MFSISAQNFSSINDDHKEISLSKETDFKTETETLDA
Ga0209611_100410486	3300027860	Host-Associated	MLSVSLQNVSSIDDDHKKLSLSKETNFKIKTETLDA
Ga0209611_100640214	3300027860	Host-Associated	MSFIFAQNFSSIDDDHKELSLSKKTDFKTESEILNV
Ga0209611_101155031	3300027860	Host-Associated	MSSIFAQNFSSIDDDHKEISLSKETDFKTETETSDAWISLN
Ga0209611_104187762	3300027860	Host-Associated	MSSISAQNFSSIDDDHKEISLSKETDFKTETETLDT
Ga0209611_105313011	3300027860	Host-Associated	GRHIKYMSSISAQNFSSINDDHKEISLSKETDFKTETETLNA
Ga0209611_105852162	3300027860	Host-Associated	MSSISAQNFSSINDDHKEISLSKETDFKTKTETLDA
Ga0209611_106016661	3300027860	Host-Associated	MSSISTQNFSSINDDHKEISLSKETDFKTEIETLDAWISLN
Ga0209611_106694712	3300027860	Host-Associated	MSSISAQNFSFINDDHKEISLSKETDFKTETETLDA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F022333

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign