Basic Information | |
---|---|
Family ID | F022278 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 215 |
Average Sequence Length | 45 residues |
Representative Sequence | MNVLLIEPILDRYVAQAERRQKDWSAKEVEALLLKLRKEILDCLK |
Number of Associated Samples | 176 |
Number of Associated Scaffolds | 215 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.58 % |
% of genes near scaffold ends (potentially truncated) | 21.86 % |
% of genes from short scaffolds (< 2000 bps) | 77.21 % |
Associated GOLD sequencing projects | 164 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.233 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.628 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.860 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (26.047 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 215 Family Scaffolds |
---|---|---|
PF12681 | Glyoxalase_2 | 13.49 |
PF00903 | Glyoxalase | 4.19 |
PF11008 | DUF2846 | 3.72 |
PF00582 | Usp | 3.26 |
PF04389 | Peptidase_M28 | 3.26 |
PF02578 | Cu-oxidase_4 | 2.79 |
PF00881 | Nitroreductase | 2.79 |
PF13302 | Acetyltransf_3 | 1.86 |
PF02518 | HATPase_c | 1.86 |
PF00248 | Aldo_ket_red | 1.40 |
PF01258 | zf-dskA_traR | 0.93 |
PF06439 | 3keto-disac_hyd | 0.93 |
PF04326 | AlbA_2 | 0.93 |
PF09723 | Zn-ribbon_8 | 0.93 |
PF01471 | PG_binding_1 | 0.93 |
PF02540 | NAD_synthase | 0.93 |
PF02201 | SWIB | 0.93 |
PF13847 | Methyltransf_31 | 0.93 |
PF02826 | 2-Hacid_dh_C | 0.47 |
PF09411 | PagL | 0.47 |
PF01558 | POR | 0.47 |
PF12706 | Lactamase_B_2 | 0.47 |
PF02661 | Fic | 0.47 |
PF01850 | PIN | 0.47 |
PF00528 | BPD_transp_1 | 0.47 |
PF07821 | Alpha-amyl_C2 | 0.47 |
PF01135 | PCMT | 0.47 |
PF14792 | DNA_pol_B_palm | 0.47 |
PF04909 | Amidohydro_2 | 0.47 |
PF00296 | Bac_luciferase | 0.47 |
PF01813 | ATP-synt_D | 0.47 |
PF01941 | AdoMet_Synthase | 0.47 |
PF14339 | DUF4394 | 0.47 |
PF02353 | CMAS | 0.47 |
PF01972 | SDH_sah | 0.47 |
PF02874 | ATP-synt_ab_N | 0.47 |
PF13193 | AMP-binding_C | 0.47 |
PF02559 | CarD_CdnL_TRCF | 0.47 |
PF00702 | Hydrolase | 0.47 |
PF03401 | TctC | 0.47 |
PF00072 | Response_reg | 0.47 |
PF01434 | Peptidase_M41 | 0.47 |
PF00343 | Phosphorylase | 0.47 |
PF05532 | CsbD | 0.47 |
PF06210 | DUF1003 | 0.47 |
PF01145 | Band_7 | 0.47 |
PF03795 | YCII | 0.47 |
PF13379 | NMT1_2 | 0.47 |
PF13474 | SnoaL_3 | 0.47 |
PF01842 | ACT | 0.47 |
PF09949 | APP1_cat | 0.47 |
PF02775 | TPP_enzyme_C | 0.47 |
PF13439 | Glyco_transf_4 | 0.47 |
PF01738 | DLH | 0.47 |
PF13180 | PDZ_2 | 0.47 |
PF03266 | NTPase_1 | 0.47 |
PF11897 | DUF3417 | 0.47 |
PF00011 | HSP20 | 0.47 |
PF04972 | BON | 0.47 |
COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
---|---|---|---|
COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 2.79 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.93 |
COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.93 |
COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.93 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.93 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.93 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.47 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.47 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.47 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.47 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.47 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.47 |
COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.47 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.47 |
COG1812 | Archaeal S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.47 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG1618 | Nucleoside-triphosphatase THEP1 | Nucleotide transport and metabolism [F] | 0.47 |
COG1394 | Archaeal/vacuolar-type H+-ATPase subunit D/Vma8 | Energy production and conversion [C] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.70 % |
Unclassified | root | N/A | 29.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886006|SwRhRL3b_contig_3802274 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
2209111006|2214776627 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
2228664021|ICCgaii200_c0876114 | All Organisms → cellular organisms → Bacteria | 2598 | Open in IMG/M |
2228664022|INPgaii200_c0970222 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
2228664022|INPgaii200_c1086623 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300000890|JGI11643J12802_12154088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1554 | Open in IMG/M |
3300002120|C687J26616_10283291 | Not Available | 506 | Open in IMG/M |
3300002124|C687J26631_10256855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 578 | Open in IMG/M |
3300002485|C687J35088_10126198 | Not Available | 760 | Open in IMG/M |
3300003349|JGI26129J50193_1015540 | Not Available | 560 | Open in IMG/M |
3300003987|Ga0055471_10091176 | Not Available | 883 | Open in IMG/M |
3300003987|Ga0055471_10098349 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300003987|Ga0055471_10155283 | Not Available | 700 | Open in IMG/M |
3300003993|Ga0055468_10064960 | Not Available | 962 | Open in IMG/M |
3300003993|Ga0055468_10238820 | Not Available | 569 | Open in IMG/M |
3300003997|Ga0055466_10196237 | Not Available | 594 | Open in IMG/M |
3300003999|Ga0055469_10082218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_55_13 | 901 | Open in IMG/M |
3300004020|Ga0055440_10195274 | Not Available | 523 | Open in IMG/M |
3300004024|Ga0055436_10117823 | Not Available | 790 | Open in IMG/M |
3300004114|Ga0062593_100233693 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300004156|Ga0062589_100076827 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
3300004157|Ga0062590_102252147 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300004157|Ga0062590_102329760 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300004463|Ga0063356_101037801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
3300004463|Ga0063356_101984596 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300004633|Ga0066395_10009651 | All Organisms → cellular organisms → Bacteria | 3532 | Open in IMG/M |
3300004778|Ga0062383_10188892 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300005166|Ga0066674_10002997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6302 | Open in IMG/M |
3300005167|Ga0066672_10112394 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
3300005168|Ga0066809_10220592 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005174|Ga0066680_10197426 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300005186|Ga0066676_10828363 | Not Available | 625 | Open in IMG/M |
3300005187|Ga0066675_10203174 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300005204|Ga0068997_10028204 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300005213|Ga0068998_10143619 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005294|Ga0065705_10016673 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
3300005363|Ga0008090_11328020 | Not Available | 937 | Open in IMG/M |
3300005445|Ga0070708_100991091 | Not Available | 788 | Open in IMG/M |
3300005445|Ga0070708_101643973 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300005447|Ga0066689_10595883 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005457|Ga0070662_101322372 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300005471|Ga0070698_101828935 | Not Available | 560 | Open in IMG/M |
3300005540|Ga0066697_10153137 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300005553|Ga0066695_10136886 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
3300005598|Ga0066706_10214281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
3300005713|Ga0066905_101103564 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300005830|Ga0074473_10848284 | Not Available | 803 | Open in IMG/M |
3300005875|Ga0075293_1023957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 788 | Open in IMG/M |
3300005896|Ga0075282_1013418 | Not Available | 1006 | Open in IMG/M |
3300005937|Ga0081455_10133422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1938 | Open in IMG/M |
3300005937|Ga0081455_10248093 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300005981|Ga0081538_10031552 | All Organisms → cellular organisms → Bacteria | 3570 | Open in IMG/M |
3300006049|Ga0075417_10086738 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300006049|Ga0075417_10121942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1197 | Open in IMG/M |
3300006049|Ga0075417_10406082 | Not Available | 674 | Open in IMG/M |
3300006058|Ga0075432_10074028 | Not Available | 1227 | Open in IMG/M |
3300006058|Ga0075432_10466955 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300006169|Ga0082029_1731452 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300006224|Ga0079037_101923864 | Not Available | 591 | Open in IMG/M |
3300006794|Ga0066658_10572892 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300006845|Ga0075421_100352213 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300006845|Ga0075421_100965571 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300006845|Ga0075421_102346765 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300006847|Ga0075431_100418907 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300006847|Ga0075431_101125050 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300006852|Ga0075433_11745181 | Not Available | 535 | Open in IMG/M |
3300006854|Ga0075425_100407949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1565 | Open in IMG/M |
3300006865|Ga0073934_10000208 | All Organisms → cellular organisms → Bacteria | 175941 | Open in IMG/M |
3300006865|Ga0073934_10054374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3427 | Open in IMG/M |
3300006871|Ga0075434_100244701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1813 | Open in IMG/M |
3300006903|Ga0075426_10543915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 865 | Open in IMG/M |
3300006969|Ga0075419_10131588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1626 | Open in IMG/M |
3300007004|Ga0079218_10234105 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300007076|Ga0075435_101259246 | Not Available | 647 | Open in IMG/M |
3300009012|Ga0066710_100276989 | Not Available | 2443 | Open in IMG/M |
3300009012|Ga0066710_100830324 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
3300009012|Ga0066710_101143633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1205 | Open in IMG/M |
3300009053|Ga0105095_10134946 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300009081|Ga0105098_10122103 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300009087|Ga0105107_10444768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 903 | Open in IMG/M |
3300009094|Ga0111539_11268146 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300009147|Ga0114129_10323238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2051 | Open in IMG/M |
3300009147|Ga0114129_11056407 | Not Available | 1019 | Open in IMG/M |
3300009156|Ga0111538_10327275 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300009156|Ga0111538_11271518 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300009157|Ga0105092_10034139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2706 | Open in IMG/M |
3300009157|Ga0105092_10874563 | Not Available | 530 | Open in IMG/M |
3300009162|Ga0075423_10620343 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300009444|Ga0114945_10003738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8549 | Open in IMG/M |
3300009444|Ga0114945_11012745 | Not Available | 515 | Open in IMG/M |
3300009506|Ga0118657_10022698 | All Organisms → cellular organisms → Bacteria | 9876 | Open in IMG/M |
3300009691|Ga0114944_1163255 | Not Available | 879 | Open in IMG/M |
3300009777|Ga0105164_10055871 | All Organisms → cellular organisms → Bacteria | 2107 | Open in IMG/M |
3300009792|Ga0126374_10546919 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300009807|Ga0105061_1001188 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
3300010043|Ga0126380_11336233 | Not Available | 626 | Open in IMG/M |
3300010047|Ga0126382_10610046 | Not Available | 900 | Open in IMG/M |
3300010048|Ga0126373_12498369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 576 | Open in IMG/M |
3300010325|Ga0134064_10086601 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300010360|Ga0126372_12463743 | Not Available | 571 | Open in IMG/M |
3300010361|Ga0126378_10333407 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300010361|Ga0126378_13226182 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300010366|Ga0126379_11786596 | Not Available | 719 | Open in IMG/M |
3300010398|Ga0126383_11706328 | Not Available | 719 | Open in IMG/M |
3300010413|Ga0136851_11610288 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300011112|Ga0114947_10025043 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
3300011112|Ga0114947_10108734 | Not Available | 1705 | Open in IMG/M |
3300012022|Ga0120191_10032937 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300012201|Ga0137365_10546850 | Not Available | 850 | Open in IMG/M |
3300012205|Ga0137362_10437028 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300012349|Ga0137387_10075464 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
3300012355|Ga0137369_10063600 | All Organisms → cellular organisms → Bacteria | 3155 | Open in IMG/M |
3300012358|Ga0137368_10887000 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300012918|Ga0137396_10319436 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300012929|Ga0137404_10748384 | Not Available | 886 | Open in IMG/M |
3300012931|Ga0153915_10534765 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300012931|Ga0153915_12174517 | Not Available | 649 | Open in IMG/M |
3300012948|Ga0126375_10768929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 759 | Open in IMG/M |
3300012964|Ga0153916_10036922 | All Organisms → cellular organisms → Bacteria | 4311 | Open in IMG/M |
3300012964|Ga0153916_12546497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300012972|Ga0134077_10430606 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300014255|Ga0075320_1009137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
3300014265|Ga0075314_1117486 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300014270|Ga0075325_1222038 | Not Available | 514 | Open in IMG/M |
3300014885|Ga0180063_1203533 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300015356|Ga0134073_10105370 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300015356|Ga0134073_10271158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 594 | Open in IMG/M |
3300016319|Ga0182033_11000414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → Rhizomicrobium electricum | 744 | Open in IMG/M |
3300017939|Ga0187775_10011479 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
3300018000|Ga0184604_10004842 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
3300018027|Ga0184605_10043806 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300018052|Ga0184638_1139174 | Not Available | 881 | Open in IMG/M |
3300018054|Ga0184621_10007725 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
3300018075|Ga0184632_10131051 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300018081|Ga0184625_10436761 | Not Available | 672 | Open in IMG/M |
3300018422|Ga0190265_10049228 | All Organisms → cellular organisms → Bacteria | 3661 | Open in IMG/M |
3300018422|Ga0190265_10331017 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
3300018422|Ga0190265_12112357 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300018431|Ga0066655_10159390 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300018433|Ga0066667_10296629 | Not Available | 1255 | Open in IMG/M |
3300018466|Ga0190268_12268890 | Not Available | 510 | Open in IMG/M |
3300018468|Ga0066662_10065474 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
3300018468|Ga0066662_12453513 | Not Available | 549 | Open in IMG/M |
3300020003|Ga0193739_1161292 | Not Available | 529 | Open in IMG/M |
3300020230|Ga0212167_1317908 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300020230|Ga0212167_1343046 | Not Available | 2039 | Open in IMG/M |
3300021063|Ga0206227_1102673 | Not Available | 564 | Open in IMG/M |
3300021090|Ga0210377_10245389 | Not Available | 1120 | Open in IMG/M |
3300021178|Ga0210408_10917784 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300021560|Ga0126371_10206673 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300022563|Ga0212128_10004238 | All Organisms → cellular organisms → Bacteria | 9555 | Open in IMG/M |
3300022563|Ga0212128_10201827 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300022694|Ga0222623_10245865 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300025146|Ga0209322_10033788 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
3300025146|Ga0209322_10044309 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
3300025155|Ga0209320_10223680 | Not Available | 809 | Open in IMG/M |
3300025160|Ga0209109_10042370 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2435 | Open in IMG/M |
3300025173|Ga0209824_10004774 | All Organisms → cellular organisms → Bacteria | 6424 | Open in IMG/M |
3300025289|Ga0209002_10670212 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300025310|Ga0209172_10004089 | All Organisms → cellular organisms → Bacteria | 20579 | Open in IMG/M |
3300025310|Ga0209172_10098663 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
3300025319|Ga0209520_10207403 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300025324|Ga0209640_10117593 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2285 | Open in IMG/M |
3300025324|Ga0209640_10323194 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300025325|Ga0209341_11131276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 562 | Open in IMG/M |
3300025537|Ga0210061_1007742 | Not Available | 1700 | Open in IMG/M |
3300025559|Ga0210087_1002074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4682 | Open in IMG/M |
3300025791|Ga0210115_1018543 | Not Available | 1589 | Open in IMG/M |
3300025792|Ga0210143_1071728 | Not Available | 625 | Open in IMG/M |
3300025792|Ga0210143_1087995 | Not Available | 568 | Open in IMG/M |
3300025930|Ga0207701_10126623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2274 | Open in IMG/M |
3300025960|Ga0207651_10196821 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300026052|Ga0208289_1004536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1042 | Open in IMG/M |
3300027360|Ga0209969_1041283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
3300027490|Ga0209899_1004369 | All Organisms → cellular organisms → Bacteria | 3245 | Open in IMG/M |
3300027573|Ga0208454_1000021 | All Organisms → cellular organisms → Bacteria | 145950 | Open in IMG/M |
3300027614|Ga0209970_1049668 | Not Available | 757 | Open in IMG/M |
3300027665|Ga0209983_1014697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1613 | Open in IMG/M |
3300027682|Ga0209971_1010709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2171 | Open in IMG/M |
3300027722|Ga0209819_10097369 | Not Available | 1026 | Open in IMG/M |
3300027723|Ga0209703_1085567 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300027815|Ga0209726_10003212 | All Organisms → cellular organisms → Bacteria | 22724 | Open in IMG/M |
3300027840|Ga0209683_10093701 | Not Available | 1353 | Open in IMG/M |
3300027873|Ga0209814_10232983 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300027876|Ga0209974_10014157 | Not Available | 2658 | Open in IMG/M |
3300027894|Ga0209068_10598332 | Not Available | 641 | Open in IMG/M |
3300027909|Ga0209382_10512352 | Not Available | 1320 | Open in IMG/M |
3300027909|Ga0209382_12190543 | Not Available | 523 | Open in IMG/M |
3300027917|Ga0209536_100009466 | All Organisms → cellular organisms → Bacteria | 14478 | Open in IMG/M |
3300027952|Ga0209889_1006261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3131 | Open in IMG/M |
3300028420|Ga0210366_10178196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 797 | Open in IMG/M |
3300030006|Ga0299907_10114958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia asplenii | 2214 | Open in IMG/M |
3300030606|Ga0299906_10803891 | Not Available | 699 | Open in IMG/M |
3300030620|Ga0302046_10153714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1888 | Open in IMG/M |
3300031547|Ga0310887_11091174 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031548|Ga0307408_100429660 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300031720|Ga0307469_10052153 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
3300031731|Ga0307405_10969273 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300031740|Ga0307468_100445524 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300031744|Ga0306918_11230721 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031903|Ga0307407_11268259 | Not Available | 577 | Open in IMG/M |
3300031912|Ga0306921_12279745 | Not Available | 568 | Open in IMG/M |
3300031965|Ga0326597_10010859 | Not Available | 12110 | Open in IMG/M |
3300031965|Ga0326597_10014249 | All Organisms → cellular organisms → Bacteria | 10422 | Open in IMG/M |
3300031965|Ga0326597_10551111 | Not Available | 1244 | Open in IMG/M |
3300032000|Ga0310903_10271225 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300032003|Ga0310897_10552673 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300032205|Ga0307472_100326477 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300032261|Ga0306920_100376299 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
3300032770|Ga0335085_11433752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 722 | Open in IMG/M |
3300033004|Ga0335084_10207918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2032 | Open in IMG/M |
3300033407|Ga0214472_10373710 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300033407|Ga0214472_10777561 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300033417|Ga0214471_11015257 | Not Available | 638 | Open in IMG/M |
3300033486|Ga0316624_10978935 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.63% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.12% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.26% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.26% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.79% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.33% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.86% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.86% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.40% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.40% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.40% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.40% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.93% |
Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 0.93% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.93% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.47% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.47% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.47% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.47% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.47% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.47% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.47% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.47% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.47% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.47% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.47% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.47% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002485 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 | Environmental | Open in IMG/M |
3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020230 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02 | Environmental | Open in IMG/M |
3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026052 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwRhRL3b_0133.00000740 | 2162886006 | Switchgrass Rhizosphere | MTVLLIEPTLERYRSVQRGRKEWNVKEVEALLLKLREEMLECLK |
2213798014 | 2209111006 | Arabidopsis Rhizosphere | MNVLLIEAILDRYVAKAQKRAKAWSPTEVETLLLKLREEVLDCLK |
ICCgaii200_08761143 | 2228664021 | Soil | MSALLIEPILDRYVALVEKRERSWSPKEVEALLLRLREEVLQCLTS |
INPgaii200_09702222 | 2228664022 | Soil | MNVLLIEPILDRYVAQAERREKDWSPKEVATLLLKLRKEILDXLK |
INPgaii200_10866232 | 2228664022 | Soil | MKVLLIEPILDRYVAAVQRGQKEWSAKEVEALRLKLREEILECLK |
JGI11643J12802_121540883 | 3300000890 | Soil | RYVAQVEKRDKDWKAKEVEALLLRLRKEILDCLR* |
C687J26616_102832911 | 3300002120 | Soil | MNVLLIEAILDRYVAQVQRRKKDWSPADIEALLLKLREEVLDCLK* |
C687J26631_102568552 | 3300002124 | Soil | MNILLIEAILDRYVAQVQRRKKDWSPAEIEALLLKLREEVLDCLK* |
C687J35088_101261982 | 3300002485 | Soil | MNVLLIEAILDRYVAQVQRRKKDWRPAEIEALLLKLREEVLDCLK* |
JGI26129J50193_10155401 | 3300003349 | Arabidopsis Thaliana Rhizosphere | MSVLLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILDCLR* |
Ga0055471_100911762 | 3300003987 | Natural And Restored Wetlands | MSVFLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILD |
Ga0055471_100983492 | 3300003987 | Natural And Restored Wetlands | MKVLLIEPILDRYVTAVQRGRKEWSAKEVEALLIKLRDEILECLK* |
Ga0055471_101552832 | 3300003987 | Natural And Restored Wetlands | MSVLLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILD |
Ga0055468_100649602 | 3300003993 | Natural And Restored Wetlands | MTALLIEPILDRYVALTERRKKDWPAKEVEALLLKLRKEVLDCLKSSIPE* |
Ga0055468_102388202 | 3300003993 | Natural And Restored Wetlands | MSVFLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILDCLR* |
Ga0055466_101962371 | 3300003997 | Natural And Restored Wetlands | DPGDPGEKISRANGGNPIMSVLLIEPILDRYVAQVEKRDKDWKAKEVAALLLRLRKEILDCLR* |
Ga0055469_100822182 | 3300003999 | Natural And Restored Wetlands | MTALLIEPILDRYVALTERRHKDWPAQEVEALMLKLRKEILDCLKSSMSE* |
Ga0055440_101952741 | 3300004020 | Natural And Restored Wetlands | MNVLLIEAILDRYVAKVERREKQWSAREVEALLLKLREEVLDCLK* |
Ga0055436_101178232 | 3300004024 | Natural And Restored Wetlands | MNILLIEVILDRYVAIAQKRQKDWNPAEVETLLLKLREEVLDSLR* |
Ga0062593_1002336932 | 3300004114 | Soil | MNVLLIEAVLDRYVAKAQKRAKAWSPDEVETLLLKLREEVLDCLK* |
Ga0062589_1000768272 | 3300004156 | Soil | MSALLIEPILDRYVALVEKRERSWSPKEVEALLLRLREEVLQCLTS* |
Ga0062590_1022521472 | 3300004157 | Soil | MSALLIEPILDRYVALVEKRERSWSPKEVEALLLRLREEVLQCLKS* |
Ga0062590_1023297602 | 3300004157 | Soil | MNVLLIEAVLDRYVAKAQKRAKDWSPDEVETLLLKLREEVLDCLK* |
Ga0063356_1010378012 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNILLIEAILDRYVAKAQKRRKDWSVAEVEALLLKLRDEVLNCLR* |
Ga0063356_1019845961 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSALLIEPILDRYVALVEKRDRDWSPREVEALLLKLREEVLQCLKT* |
Ga0066395_100096514 | 3300004633 | Tropical Forest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEIEVLLLKLRKEILDCLK* |
Ga0062383_101888922 | 3300004778 | Wetland Sediment | MNILLIEVILDRYVAKAQKHEKDWSPAEVEALLVKLRDEVLNCLK* |
Ga0066674_100029975 | 3300005166 | Soil | MNVLLIEPILDRYVAQVERRGKDWKPKEVEGLLLKLREEILECLK* |
Ga0066672_101123942 | 3300005167 | Soil | MNVLLIEPILDRYVAQAERREKDWKPKEVEGLLLKLREEILECLK* |
Ga0066809_102205921 | 3300005168 | Soil | MNVLLIEPILDRYVAQAERREKDWSPKEVAALLLKLRKEILDCLK* |
Ga0066680_101974263 | 3300005174 | Soil | MKVLLIEPILDRYVAAVQRGQKDWVAKEVEALLLKLREEILECLK* |
Ga0066676_108283632 | 3300005186 | Soil | MKVLLIEPILDRYVAAVQRGQKEWSAKEVEALLLKLREEILECLK* |
Ga0066675_102031743 | 3300005187 | Soil | MNVLLIEPILDRYVAQTERREKDWKPKEVEGLLLKLREEILECLK* |
Ga0068997_100282042 | 3300005204 | Natural And Restored Wetlands | MNILLIEVILDRYVAIAQKRQKDWSPAEVEALLLKLREEVLDSLR* |
Ga0068998_101436192 | 3300005213 | Natural And Restored Wetlands | MNILLIEVILDRYVAIAQKRQKDWSPAEVEALLLKLREEVLDSLK* |
Ga0065705_100166733 | 3300005294 | Switchgrass Rhizosphere | MTVLLIEPTLERYRSVQRGRKEWNVKEVEALLLKLREEMLECLK* |
Ga0008090_113280201 | 3300005363 | Tropical Rainforest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEIEALLLKLRKEILDCLK* |
Ga0070708_1009910911 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVLLIEAILDRYVAKVQRRNKDWSQTEVEALLLELRQEVLECLK* |
Ga0070708_1016439732 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVLLIEPILDRYVARAERREKYWSPKEVEVLLLKLREEILDCLK* |
Ga0066689_105958832 | 3300005447 | Soil | MNVLLIEPILDRYVAQAERREKYWSPKEVEVLLLKLREEILDCLK* |
Ga0070662_1013223721 | 3300005457 | Corn Rhizosphere | SALLIEPILDRYVALVEKRERNWTPKEVEALLLKLREEVLQCLKS* |
Ga0070698_1018289351 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVLLIEAILDRYVAKVQRRNKDWSQTEVEVLLLELRQEVLECLK* |
Ga0066697_101531371 | 3300005540 | Soil | MNVLLIEPILDRYVAQAERREKDWKPKEVEGLLLKLRE |
Ga0066695_101368863 | 3300005553 | Soil | MNVLLIEPILDRYVAQVERRGKDWKPKEVEGLLLKLRE |
Ga0066706_102142813 | 3300005598 | Soil | MNVLLIEPILDRYVAQAERREKYWSPKEVEVLLLKIREEILDCLK* |
Ga0066905_1011035642 | 3300005713 | Tropical Forest Soil | MTVLLIEPILDRYVAQAERREKDWSPKEVAALLLKLRKEILDCLK* |
Ga0074473_108482841 | 3300005830 | Sediment (Intertidal) | MNVLLIEIILDRYIATAQKHQTDWSPAEVEALLVKLRDEVLNCLK* |
Ga0075293_10239572 | 3300005875 | Rice Paddy Soil | AGDPGDPGEKISRANGGNPIMSVLLIEPILDRYVAQVEKRDKDWKAKEVAALLLRLRKEILDCLR* |
Ga0075282_10134182 | 3300005896 | Rice Paddy Soil | MNILLIEAILDRYVAKAQKRAKVWGPAEVEALLLKLREEVLDCLK* |
Ga0081455_101334222 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTVFLVEPILDRYVAQAERREKDWSPKEVEALLLKLRKEILDCLK* |
Ga0081455_102480933 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNVLLIEPILDRYVAQAERREKNWSPKEVEALLLKLRKEILDCLK* |
Ga0081538_100315524 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSILLIEPILDRYVAQAKRREKDWSPKEVEALLLKLRKEILDCLR* |
Ga0075417_100867384 | 3300006049 | Populus Rhizosphere | MKVLLIEPILDRYVAVVQRRQKEWSAKAVEALLLKLREEILACLK* |
Ga0075417_101219421 | 3300006049 | Populus Rhizosphere | MNALLIEAILDRYVAQAERREKNWQAKEVEALLLKLREEVLQCLK* |
Ga0075417_104060821 | 3300006049 | Populus Rhizosphere | MKVLLIEPILDRYVAAVQRGQKEWSAKEVEALLLKLREEILEWLK* |
Ga0075432_100740283 | 3300006058 | Populus Rhizosphere | MKVLLIEPILDRYVAAVQRRQKEWSAKAVEALLLKLR |
Ga0075432_104669551 | 3300006058 | Populus Rhizosphere | MNVLLIEPILDRYVAQADRREKDWTAKEVATLLLKLRKEILDCLK* |
Ga0082029_17314522 | 3300006169 | Termite Nest | MSALLIEPILDRYIALVEKRERSWTPKEVEALLLKLREEVLQCLKS* |
Ga0079037_1019238642 | 3300006224 | Freshwater Wetlands | MSVILIEPILDRYVAQAERRKKDWSPKEIEALLLKLRKEILDCLK* |
Ga0066658_105728922 | 3300006794 | Soil | MNVLLIEPILDRYVAQAERRGKDWKPKEVEGLLLKLREEILECLK* |
Ga0075421_1003522132 | 3300006845 | Populus Rhizosphere | MNVLLIEIILDRYVAKAQKRQKDWSPAEVEALLVKLRDEVLNCLK* |
Ga0075421_1009655712 | 3300006845 | Populus Rhizosphere | MKVLLIEPILDRYVAAVQRRQKEWSAKAVEALLLKLREEILECLK* |
Ga0075421_1023467652 | 3300006845 | Populus Rhizosphere | LMKVLLIEPILDRYVAAVQRGQKEWSSIEVEALLLKLREEILECLK* |
Ga0075431_1004189071 | 3300006847 | Populus Rhizosphere | ILDRYVALVEKRDRDWSPREVEALLLKLREEVLQCLKT* |
Ga0075431_1011250502 | 3300006847 | Populus Rhizosphere | ILDRYVAAVQRGQKEWSSIEVEALLLKLREEMLECLK* |
Ga0075433_117451811 | 3300006852 | Populus Rhizosphere | MKVLLIEPMLDRYVAAVQRGQKEWSAKAVEALLLKLREEILECLK* |
Ga0075425_1004079493 | 3300006854 | Populus Rhizosphere | KVLLIEPILDRYVAAVQRGQKEWSSIEVEALLLKLREEILECLK* |
Ga0073934_10000208140 | 3300006865 | Hot Spring Sediment | MNVLLVEIILDRYVAKAQKRLKDWNPAEVEALLVQLRNEVLNCLK* |
Ga0073934_100543742 | 3300006865 | Hot Spring Sediment | MNVLLIEAILDRYVAQAQRRRKDWSAAQVEALLLKLRDEILDCLRS* |
Ga0075434_1002447015 | 3300006871 | Populus Rhizosphere | LMKVLLIEPILDRYVAAVQRRQKEWSAKAVEALLLKLREEILECLK* |
Ga0075426_105439152 | 3300006903 | Populus Rhizosphere | MKVLLIEPILDRYVAAVQRGQKEWSSIEVEALLLKLREEMLECLK* |
Ga0075419_101315883 | 3300006969 | Populus Rhizosphere | WRHALMKVLLIEPILDRYVAAVQRGQKEWSSIEVEALLLKLREEILECLK* |
Ga0079218_102341053 | 3300007004 | Agricultural Soil | MSALLIEPILDRYVALVEKRDRDWSPREVEALLLKLRQEVLQCLKT* |
Ga0075435_1012592462 | 3300007076 | Populus Rhizosphere | MKILLIEPILDRYVAAVQRGQKEWSAKEVEALLLKLREEILECLK* |
Ga0066710_1002769891 | 3300009012 | Grasslands Soil | MNVLLIEPILDRYVAQAERRGKDWKPKEVEGLLLKLREEILECLK |
Ga0066710_1008303243 | 3300009012 | Grasslands Soil | MNVLLIEPILDRYVAQVERREKDWKPKEVEGLLLKLREEILECLK |
Ga0066710_1011436332 | 3300009012 | Grasslands Soil | MNVLLIEPILDRYVAQAERREKYWSPKEVEVLLLKLREEILDCLK |
Ga0105095_101349462 | 3300009053 | Freshwater Sediment | MNILLIEIILDRYVAKAQKRQKDWSPAEVEELLLKLREEVLDSLR* |
Ga0105098_101221032 | 3300009081 | Freshwater Sediment | MNILLIEPILDRYVAQAERRQKDWSAKEVEALLLKLRKEILDCLK* |
Ga0105107_104447681 | 3300009087 | Freshwater Sediment | MSVLLIEPILDRYVAQAEKREKDWKAKEVEALLLKLRKEILDCLR* |
Ga0111539_112681462 | 3300009094 | Populus Rhizosphere | MSALLIEPILDRYVALVEKRERNWTPKEVEALLLKLREEVLQCLKS* |
Ga0114129_103232383 | 3300009147 | Populus Rhizosphere | MNALLIESILDRYVAQAERRDRNWQPREVEALLLKLRDEVLQCLK* |
Ga0114129_110564072 | 3300009147 | Populus Rhizosphere | MKVLLIEPILDRYVAAVQRLQKEWSAKAVEALLLKLREEILECLK* |
Ga0111538_103272752 | 3300009156 | Populus Rhizosphere | MSALLLEPILDRYVALVEKRERNWTPKEVEALLLKLREEVLQCLKS* |
Ga0111538_112715183 | 3300009156 | Populus Rhizosphere | MTVLPIEPTLERYRSVQRGRKEWNVKEVEALLLKLREEMLECLK* |
Ga0105092_100341393 | 3300009157 | Freshwater Sediment | MKVVLIEPILDRYVAQAERREKDWNPKEVEALLLKLRKEILDCLK* |
Ga0105092_108745631 | 3300009157 | Freshwater Sediment | MKVLLIEPILDRYVAQAERREKDWSPKEVEALLLKLRREILDCLK* |
Ga0075423_106203431 | 3300009162 | Populus Rhizosphere | MNVLLIEPILDRYVAQADRREKDWSPKEVAVLLLKLRKEILDCLK* |
Ga0114945_100037387 | 3300009444 | Thermal Springs | MNIFLIEAVLDRYVQKVKRSQKQWTAKEVEALLLALREEVLECLK* |
Ga0114945_110127451 | 3300009444 | Thermal Springs | MKALLIEPILDRYVAAVQRGQKEWSAKEVEALLLKLREEILECLK* |
Ga0118657_100226985 | 3300009506 | Mangrove Sediment | MNILLIEAILDRYVARVERRKKEWSAAEVEALMLKLREEILDCLR* |
Ga0114944_11632551 | 3300009691 | Thermal Springs | SVRGARMNIFLIEAVLDRYVQKVKRSQKQWTAKEVEALLLALREEVLECLK* |
Ga0105164_100558715 | 3300009777 | Wastewater | MKLLLIEPILDRYVAAVQRGQKEWSAKEVEALLLKLREEILECLK* |
Ga0126374_105469191 | 3300009792 | Tropical Forest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEIETLLLKLRKEILDCLK* |
Ga0105061_10011883 | 3300009807 | Groundwater Sand | MNVFLIEPILDRYVAQAERREKDWSPKEVAALLLKLRKEILDCLK* |
Ga0126380_113362332 | 3300010043 | Tropical Forest Soil | MNVLLIEPILDRYVAQAERREKDWKPKEVEALLLKLRQEILQCVK* |
Ga0126382_106100461 | 3300010047 | Tropical Forest Soil | MNVLLIEPILDRYVAQAKRREKDWKPKEVEALLLKLREELLQCLK* |
Ga0126373_124983691 | 3300010048 | Tropical Forest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEIEVLLLKLRKEILD |
Ga0134064_100866011 | 3300010325 | Grasslands Soil | VLLIEPILDRYVAQVERRGKDWKPKEVEGLLLKLREEILECLK* |
Ga0126372_124637432 | 3300010360 | Tropical Forest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEIEVLLLKL |
Ga0126378_103334073 | 3300010361 | Tropical Forest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEIEALLLKLRKEILDC |
Ga0126378_132261822 | 3300010361 | Tropical Forest Soil | VLLIEPILDRYVAQAERREKDWSPKEIEALLLKLRKEILDCLK* |
Ga0126379_117865961 | 3300010366 | Tropical Forest Soil | GDSINECILDRYVARAERRDRNWSAKEVEALLLKLREEILDCLK* |
Ga0126383_117063281 | 3300010398 | Tropical Forest Soil | DSINECILDRYVARAERRDRNWSAKEVEALLLKLREEILDCLK* |
Ga0136851_116102881 | 3300010413 | Mangrove Sediment | MNILLIEAILDRYVARVERRKKDWSAAEVEALMLKLREEILDCLR* |
Ga0114947_100250434 | 3300011112 | Deep Subsurface | MKILLVEPILDRYVATVRRRQKDWSAKEVEALLLKLREEILECLM* |
Ga0114947_101087341 | 3300011112 | Deep Subsurface | MAELDRGMKVLLIEPILDRYVAMARRREKDWSVKEVEVLLLKLREEVLECLK* |
Ga0120191_100329371 | 3300012022 | Terrestrial | MNALLIESILDRYVAQAERREKNWQAKEVEELLLKLREEVLQCLK* |
Ga0137365_105468502 | 3300012201 | Vadose Zone Soil | MNVLLIEPILDRYVAQVERRGKAWKPKEVEGLLLKLREEILECLK* |
Ga0137362_104370283 | 3300012205 | Vadose Zone Soil | MKVLLIEPILHRYVAAVQRGQKDWVAKEVEALLLKLREEILECLK* |
Ga0137387_100754643 | 3300012349 | Vadose Zone Soil | MNVLLIEPILDRYIAQAERREKDWKPKEVEGLLLKLREEILECLK* |
Ga0137369_100636004 | 3300012355 | Vadose Zone Soil | MNALLIESILDRYVAQAERRDRTWGPKEVEALLLKLREEVLQCLK* |
Ga0137368_108870002 | 3300012358 | Vadose Zone Soil | MKVLLIEPILDRYVAAVQRGQKEWSAKDLEALLLKLREEILECLK* |
Ga0137396_103194362 | 3300012918 | Vadose Zone Soil | MNVLLIEPILDRYVAQAEKRAKDWSPKEVEALLLKLRKEILDCLK* |
Ga0137404_107483841 | 3300012929 | Vadose Zone Soil | MNVLLIEPILDRYVAQAERREKDWSPKEVAAFLLKLRKEILDCLK* |
Ga0153915_105347652 | 3300012931 | Freshwater Wetlands | MNILLIEAILDRYVAKAQKRAKAWGPAEVEALLLKLREEVLDCLK* |
Ga0153915_121745171 | 3300012931 | Freshwater Wetlands | MKILLIEPILDRYVAAVQRGQKEWRAQEVEVLLLKLREEILECLK* |
Ga0126375_107689291 | 3300012948 | Tropical Forest Soil | MTVLLIEPILDRYVAQAERREKDWSPKEVEALLLKLRKEIGLPQVIDG |
Ga0153916_100369222 | 3300012964 | Freshwater Wetlands | MKILLIEPILDRYVAAVQRGQKEWRAQEVEALLLKLREEILECLK* |
Ga0153916_125464972 | 3300012964 | Freshwater Wetlands | MNVLLIEAILDRYVAQVERREKQWSAREVEALLLKLREEVLDCLK* |
Ga0134077_104306062 | 3300012972 | Grasslands Soil | MNVLLIEPILDRYIAQVEKRGKDWKPKEVEGLLLKLREEILECLK* |
Ga0075320_10091374 | 3300014255 | Natural And Restored Wetlands | MTVLLIEPILDRYVAQAERRQKDWSAKEVEALLLKLRKEILDCLK* |
Ga0075314_11174861 | 3300014265 | Natural And Restored Wetlands | MNLLLIEPILDRYVAQAERRKKDWSPGEVEALLLKLRKEILDCLK* |
Ga0075325_12220381 | 3300014270 | Natural And Restored Wetlands | MKVLLIEPILDRYVTAVQRGRKEWSAKEVEALLIKLREEILECLK* |
Ga0180063_12035331 | 3300014885 | Soil | MSVMLIEQILDRYVAQAERRKKDWSPKEIEALLLKLRKEILDCLK* |
Ga0134073_101053703 | 3300015356 | Grasslands Soil | VMNVLLIEPILDRYVAQAERREKDWKPKEVEGLLLKLREEILECLK* |
Ga0134073_102711581 | 3300015356 | Grasslands Soil | MNVLLIEPILDRYVAQVERRGKDWKPKEVEGLLLKL |
Ga0182033_110004142 | 3300016319 | Soil | MNILLIEAILDRYVAKAQKRAKAWSLAEVETLLLKLREE |
Ga0187775_100114791 | 3300017939 | Tropical Peatland | MNVLLIEVILDRYVAQVQKRQKDWSPAEIEALLLKLREEVLNCLK |
Ga0184604_100048423 | 3300018000 | Groundwater Sediment | MNALLIESILDRYVAQAERRDRTWGPKEVEALLLKLREEVLQCLK |
Ga0184605_100438063 | 3300018027 | Groundwater Sediment | MNALLIESILDRYVAQAERRERTWGPKEVEALLLKLREEVLQCLK |
Ga0184638_11391742 | 3300018052 | Groundwater Sediment | MNILLIEPILDRYVAQAERRQKDWSAKEVEALLLKLRKEILDCLK |
Ga0184621_100077253 | 3300018054 | Groundwater Sediment | MNALLVESILDRYVAQAERRDRTWGPKEVEALLLKLREEVLQCLK |
Ga0184632_101310511 | 3300018075 | Groundwater Sediment | MNVLLIEPILDRYVAQAERRQKDWSAKEVEALLLKLRKEILDCLK |
Ga0184625_104367611 | 3300018081 | Groundwater Sediment | MTVLLIEPILDRYVAQAERREKDWSPKEVAALLLKLRKEILDCLK |
Ga0190265_100492282 | 3300018422 | Soil | MNVVLIEPILDRYVAQAERREKDWKAKEVEMLLLKLRKEILDCLK |
Ga0190265_103310172 | 3300018422 | Soil | MSALLIEPVLDKYVALAEKRERDWSPKEVEALLLKLREEILQCLKS |
Ga0190265_121123571 | 3300018422 | Soil | MSALLIEPILDRYVALVEKRDRDWSPREVEALLLKLRQEVLQCLKT |
Ga0066655_101593902 | 3300018431 | Grasslands Soil | MNVLLIEPILDRYVAQVERRGKDWKPKEVEGLLLKLREEILECLK |
Ga0066667_102966291 | 3300018433 | Grasslands Soil | MNVLLIEPILDRYVAQAERREKDWKPKEVEGLLLKLREE |
Ga0190268_122688902 | 3300018466 | Soil | MNILLIEPILDRYVALSERRQRFWTPKEVEALLLKLREEVLRCLK |
Ga0066662_100654742 | 3300018468 | Grasslands Soil | MNVLLIEPILDRYVAQAERREKDWKPKEVEGLLLKLREEILECLK |
Ga0066662_124535132 | 3300018468 | Grasslands Soil | MKVLLIEPILDRYVAAVQRGQKDWVAKEVEALLLKLREEILECLK |
Ga0193739_11612921 | 3300020003 | Soil | KALLIESILDRYVAQAERRDRTWGPKEVEALLLKLREEVLQCLK |
Ga0212167_13179083 | 3300020230 | Sediment | MKILLVEPILDRYVATVRRRQKDWSAKEVEALLLKLREEILECLM |
Ga0212167_13430461 | 3300020230 | Sediment | MAELDRGMKVLLIEPILDRYVAMARRREKDWSVKEVEVLLLKLREEVLECLK |
Ga0206227_11026731 | 3300021063 | Deep Subsurface Sediment | MNVLLIEAILDRYVAQVQRRKKDWRPAEIEAILLKLREEVLDCLR |
Ga0210377_102453891 | 3300021090 | Groundwater Sediment | MNVLLIEVILDRYVAKAQKHQKDWSPAEVEALLLKPRDEVLDCLK |
Ga0210408_109177842 | 3300021178 | Soil | MNVLLIEPILDRYVAQAERREKNWSPKEVETLLLKLRKEILDCLK |
Ga0126371_102066732 | 3300021560 | Tropical Forest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEIEVLLLKLRKEILDCLK |
Ga0212128_100042381 | 3300022563 | Thermal Springs | MNIFLIEAVLDRYVQKVKRSQKQWTAKEVEALLLALREEVLECLK |
Ga0212128_102018272 | 3300022563 | Thermal Springs | MRVLLIEPILDRYVAQAERREKDWSPKEVAALLLRLRNEILDCLK |
Ga0222623_102458651 | 3300022694 | Groundwater Sediment | MNALLIESILDRYVAQAERRDRTWGPKEVEALLLKLRE |
Ga0209322_100337884 | 3300025146 | Soil | MSVMLIEPILDRYVAQAERRKKDWNPKEIEALLLKLRKEILDCLK |
Ga0209322_100443092 | 3300025146 | Soil | MNVLLIEAILDRYVAQVQRRKKDWRPAEIEALLLKLREEVLDCLK |
Ga0209320_102236802 | 3300025155 | Soil | MNVLLIEAILDRYVAKVERREKQWSAREVEALLLKLREEVLDCLK |
Ga0209109_100423701 | 3300025160 | Soil | MNILLIEAILDRYVAQVQRRKKDWSPAEIEALLLKLREEVLDCLK |
Ga0209824_100047744 | 3300025173 | Wastewater | MKLLLIEPILDRYVAAVQRGQKEWSAKEVEALLLKLREEILECLK |
Ga0209002_106702121 | 3300025289 | Soil | MNVLLIEAILDRYVAKVERREKQWSAREVEALLLKLR |
Ga0209172_1000408922 | 3300025310 | Hot Spring Sediment | MNVLLVEIILDRYVAKAQKRLKDWNPAEVEALLVQLRNEVLNCLK |
Ga0209172_100986632 | 3300025310 | Hot Spring Sediment | MNVLLIEAILDRYVAQAQRRRKDWSAAQVEALLLKLRDEILDCLRS |
Ga0209520_102074031 | 3300025319 | Soil | MSVMLIEPILDRYVAQAERRKKDWSPKEIEALLLKLRKEILDCLK |
Ga0209640_101175933 | 3300025324 | Soil | MSVMLIEPILDRYVAQAERRKKDWSAKEIEALLLKLRKEILDCLK |
Ga0209640_103231943 | 3300025324 | Soil | VEVKPMNVLLIEIILDRYVAIAQKRQKDWSPAEVEALLVKLRDEVLNCLR |
Ga0209341_111312761 | 3300025325 | Soil | LLAEVETMNVLLIEAILDRYVAKVERREKQWSAREVEALLLKLREEVLDCLK |
Ga0210061_10077422 | 3300025537 | Natural And Restored Wetlands | MSVLLIEPILDRYVAQVEKRDKDWKAKEVAALLLRLRKEILDCLR |
Ga0210087_10020745 | 3300025559 | Natural And Restored Wetlands | MSVLLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILDCLR |
Ga0210115_10185431 | 3300025791 | Natural And Restored Wetlands | MSVFLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILDCLR |
Ga0210143_10717281 | 3300025792 | Natural And Restored Wetlands | MTALLIEPILDRYVALTERRKKDWPAKEVEALLLKLRKEVLDCLKSSIPE |
Ga0210143_10879952 | 3300025792 | Natural And Restored Wetlands | SRANGGNPIMSVLLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILDCLR |
Ga0207701_101266232 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALLIEPILDRYVALVEKRERNWTPKEVEALLLKLREEVLQCLKS |
Ga0207651_101968212 | 3300025960 | Switchgrass Rhizosphere | MNVLLIEAVLDRYVAKAQKRAKAWSPDEVETLLLKLREEVLDCLK |
Ga0208289_10045361 | 3300026052 | Natural And Restored Wetlands | PIMSVLLIEPILDRYVAQVEKRDKDWKAKEVEALLLRLRKEILDCLR |
Ga0209969_10412832 | 3300027360 | Arabidopsis Thaliana Rhizosphere | PEANGGDLIMSLLLIEPILDRYIAQAEKRDKDWKPKEVEALLLRLRKEILDCLR |
Ga0209899_10043692 | 3300027490 | Groundwater Sand | MNVFLIEPILDRYVAQAERREKDWSPKEVAALLLKLRKEILDCLK |
Ga0208454_100002184 | 3300027573 | Soil | MKVLLIEIILDRYVAKAQKRQKDWNPVEVEALLVKLRDEVLNCLK |
Ga0209970_10496682 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MSVLLIEPILDRYVAQVEKRDKDWKAKEVEALLLRL |
Ga0209983_10146972 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MSLLLIEPILDRYIAQTEKRDKDWKPKEVEALFLRLRKEILDCLR |
Ga0209971_10107094 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MSLLLIEPILDRYIAQAEKRDKDWKPKEVEALLLRLRKEILDCLR |
Ga0209819_100973691 | 3300027722 | Freshwater Sediment | MKVVLIEPILDRYVAQAERREKDWNPKEVEALLLKLRKEILDCLK |
Ga0209703_10855672 | 3300027723 | Freshwater Sediment | MNILLIEIILDRYVAKAQKRQKDWSPAEVEELLLKLREEVLDSLR |
Ga0209726_1000321210 | 3300027815 | Groundwater | MNVLLIEAILDRYVAQVQRRKKNWSPAEIEALLLKLREEVLDCLK |
Ga0209683_100937012 | 3300027840 | Wetland Sediment | MNILLIEVILDRYVAKAQKHEKDWSPAEVEALLVKLRDEVLNCLK |
Ga0209814_102329832 | 3300027873 | Populus Rhizosphere | MKVLLIEPILDRYVAVVQRRQKEWSAKAVEALLLKLREEILACLK |
Ga0209974_100141574 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MSLLLIEPILDRYIAQTEKRDKDWKPKEVEALLLRLRKEILDCLR |
Ga0209068_105983322 | 3300027894 | Watersheds | MSVILIEPILDRYVAQAERRKKDWSPKEIEALLLKLRKEILDCLK |
Ga0209382_105123521 | 3300027909 | Populus Rhizosphere | MNVLLIEIILDRYVAKAQKRQKDWSPAEVEALLVKLRDEVLNCLK |
Ga0209382_121905431 | 3300027909 | Populus Rhizosphere | MKVLLIEPILDRYVAAVQRGQKEWSAKEVEALLLKLREEILE |
Ga0209536_1000094663 | 3300027917 | Marine Sediment | MNILLIEAILDRYVAKVERRKKDWSPTEVEAVILKLREEILDCLR |
Ga0209889_10062615 | 3300027952 | Groundwater Sand | MKVLLIEPILDRYVAVVQRGQKEWSAKEVEALLLKLREEILECLK |
Ga0210366_101781962 | 3300028420 | Estuarine | LQRRSAVNILLIEAILDRYVAKVERRKKDWNAAEVEALILKLREEILDCLK |
Ga0299907_101149581 | 3300030006 | Soil | MKVMLIEPILDRYVARTERRQKDWRPKEVEALLLKLREEILDCLK |
Ga0299906_108038912 | 3300030606 | Soil | MNVLMIEPILDRYVAQAERREEDWSAKEVEALLLKLREEILNCLK |
Ga0302046_101537142 | 3300030620 | Soil | MNILLIEAILDRYVAKAQRRRKDWSAAEIETLLLRLRAEILDRLK |
Ga0310887_110911741 | 3300031547 | Soil | LDRYVALVEKRERNWTPKEVEALLLKLREEVLQCLKS |
Ga0307408_1004296601 | 3300031548 | Rhizosphere | MSALLIEPILDRYVALVEKRDRDWSPREVEALLLKLREEVLQCLKT |
Ga0307469_100521531 | 3300031720 | Hardwood Forest Soil | MNFLLIEPILDRYVAQAERREKDWSPKEVATLLLKLRKEILDCLK |
Ga0307405_109692732 | 3300031731 | Rhizosphere | MSALLIEPILDRYVALVEKRDRDWSPREVEALLLKLREEVLRCLKT |
Ga0307468_1004455242 | 3300031740 | Hardwood Forest Soil | MNVLLIEPILDRYVAQAERREKDWSPKEVATLLLKLRKEILDCLK |
Ga0306918_112307211 | 3300031744 | Soil | AQKLRLLAEASHMNILLIEAILDRYVAKAQKRAKAWSLAEVETLLLKLREEVLDCLK |
Ga0307407_112682591 | 3300031903 | Rhizosphere | MSALLIEPILDRYVALVEKRDRDWSPREVEALLLKLREEVLQ |
Ga0306921_122797451 | 3300031912 | Soil | MNILLIEAILDRYVAKAQKRAKAWSLAEVETLLLKLREEVLDCL |
Ga0326597_100108597 | 3300031965 | Soil | MNILLIEAILDRYVAQVQRRKKDWRPAEIEVLLLKLREEVLDCLR |
Ga0326597_100142496 | 3300031965 | Soil | MNVLLIEAILDRYVAQVQRRKKHWSPAEIEALLLKLREEVLDCLK |
Ga0326597_105511112 | 3300031965 | Soil | MNVLLIEAILDRYVAQVQRRKKDWSPAEIEALLLKLREEVLDCLK |
Ga0310903_102712252 | 3300032000 | Soil | MSALLLEPILDRYVALVEKRERNWTPKEVEALLLKLREEVLQCLKS |
Ga0310897_105526732 | 3300032003 | Soil | LLLEPILDRYVALVEKRERNWTPKEVEALLLKLREEVLQCLKS |
Ga0307472_1003264773 | 3300032205 | Hardwood Forest Soil | LIEPILDRYVAQAERREKDWSPKEVATLLLKLRKEILDCLK |
Ga0306920_1003762992 | 3300032261 | Soil | MNILLIEAILDRYVAKAQKRAKAWSLAEVETLLLKLREEVLDCLK |
Ga0335085_114337522 | 3300032770 | Soil | MNILLIEVILDRYVAQAQKRQKEWNPAEVEALLLKLRDEV |
Ga0335084_102079183 | 3300033004 | Soil | MNILLIEVILDRYVAQAQKRQKEWNPAEVEALLLKLRDEVLNCLK |
Ga0214472_103737101 | 3300033407 | Soil | MNVLLIEPIPDRYVAKARVRQKDWSVKEVELLLLKLREEVLECLQ |
Ga0214472_107775612 | 3300033407 | Soil | MNALLIEPILDRYVAQAERRDRVWQPKEVATLLLKLREEVLQCLK |
Ga0214471_110152571 | 3300033417 | Soil | MNLLLIEPILDRYVAQAERRKKDWSPREVEAMLLKLRKEILDCLK |
Ga0316624_109789352 | 3300033486 | Soil | MNILLIEAILDRYVAKAQKRAKAWGPAEVEALLLKLREEVLDCLK |
⦗Top⦘ |