| Basic Information | |
|---|---|
| Family ID | F022259 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 215 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MASTAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVS |
| Number of Associated Samples | 179 |
| Number of Associated Scaffolds | 215 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.74 % |
| % of genes from short scaffolds (< 2000 bps) | 86.98 % |
| Associated GOLD sequencing projects | 167 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.535 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.791 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.907 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 215 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 71.16 |
| PF08448 | PAS_4 | 16.28 |
| PF00486 | Trans_reg_C | 2.33 |
| PF16870 | OxoGdeHyase_C | 1.86 |
| PF11946 | DUF3463 | 0.93 |
| PF16736 | sCache_like | 0.93 |
| PF07995 | GSDH | 0.47 |
| PF09907 | HigB_toxin | 0.47 |
| PF12704 | MacB_PCD | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
|---|---|---|---|
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.53 % |
| Unclassified | root | N/A | 0.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17143866 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 2199352024|deeps__Contig_117930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300000909|JGI12488J12863_103059 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300000955|JGI1027J12803_109175648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3947 | Open in IMG/M |
| 3300002557|JGI25381J37097_1014338 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300002907|JGI25613J43889_10044394 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300004082|Ga0062384_101467282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005167|Ga0066672_10416224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300005365|Ga0070688_100253808 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300005451|Ga0066681_10870610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005468|Ga0070707_101482657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300005518|Ga0070699_100725223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300005554|Ga0066661_10089828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1822 | Open in IMG/M |
| 3300005557|Ga0066704_10393251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300005557|Ga0066704_10810556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300005574|Ga0066694_10076783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1542 | Open in IMG/M |
| 3300005591|Ga0070761_10630526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300005713|Ga0066905_101249049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300005764|Ga0066903_101568815 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300005842|Ga0068858_100666071 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300005993|Ga0080027_10284478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300006046|Ga0066652_100367281 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300006173|Ga0070716_100649872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300006173|Ga0070716_100849892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300006176|Ga0070765_100524133 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300006804|Ga0079221_10520582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300006954|Ga0079219_10456248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300007076|Ga0075435_100833927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300007265|Ga0099794_10063042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1804 | Open in IMG/M |
| 3300009012|Ga0066710_100364644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2141 | Open in IMG/M |
| 3300009088|Ga0099830_10032393 | All Organisms → cellular organisms → Bacteria | 3547 | Open in IMG/M |
| 3300009143|Ga0099792_10027992 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
| 3300009551|Ga0105238_11696116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300009629|Ga0116119_1101763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300009698|Ga0116216_10653226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300009764|Ga0116134_1135613 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300010046|Ga0126384_12277734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010048|Ga0126373_10116123 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300010048|Ga0126373_10860499 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300010048|Ga0126373_11529556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300010048|Ga0126373_13034913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010360|Ga0126372_10031220 | All Organisms → cellular organisms → Bacteria | 3348 | Open in IMG/M |
| 3300010360|Ga0126372_10964142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300010360|Ga0126372_12182645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300010366|Ga0126379_10017479 | All Organisms → cellular organisms → Bacteria | 5276 | Open in IMG/M |
| 3300010366|Ga0126379_10066843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3046 | Open in IMG/M |
| 3300010375|Ga0105239_13153408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300010376|Ga0126381_103374921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300010398|Ga0126383_11444727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300011269|Ga0137392_10252501 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300011269|Ga0137392_10976715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300011269|Ga0137392_11121964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300011270|Ga0137391_11517819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300011270|Ga0137391_11575327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300011271|Ga0137393_10801478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300011271|Ga0137393_11059021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012189|Ga0137388_10868497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300012189|Ga0137388_11215034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300012199|Ga0137383_10041497 | All Organisms → cellular organisms → Bacteria | 3267 | Open in IMG/M |
| 3300012199|Ga0137383_10821816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300012200|Ga0137382_10325527 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300012200|Ga0137382_10733791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300012200|Ga0137382_10840814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300012202|Ga0137363_10023132 | All Organisms → cellular organisms → Bacteria | 4197 | Open in IMG/M |
| 3300012202|Ga0137363_11745039 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012203|Ga0137399_10345403 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300012205|Ga0137362_10345677 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300012207|Ga0137381_10077821 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300012209|Ga0137379_10177889 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300012211|Ga0137377_11241293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012357|Ga0137384_10283143 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300012357|Ga0137384_10724280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300012357|Ga0137384_10874121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300012361|Ga0137360_10175569 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300012361|Ga0137360_11650973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300012363|Ga0137390_10904881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300012363|Ga0137390_11328947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300012582|Ga0137358_10193097 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300012923|Ga0137359_10888990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300012924|Ga0137413_11694771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300012927|Ga0137416_10751185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300012929|Ga0137404_11015422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300012929|Ga0137404_12329221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012930|Ga0137407_12310470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012971|Ga0126369_10711049 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300014164|Ga0181532_10113142 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300014169|Ga0181531_10319371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 951 | Open in IMG/M |
| 3300014638|Ga0181536_10522807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300015051|Ga0137414_1182384 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300015053|Ga0137405_1426989 | Not Available | 8024 | Open in IMG/M |
| 3300015054|Ga0137420_1208189 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300015241|Ga0137418_10387641 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300015356|Ga0134073_10232386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300016294|Ga0182041_12139305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300016319|Ga0182033_10138502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 1859 | Open in IMG/M |
| 3300016422|Ga0182039_10096852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2166 | Open in IMG/M |
| 3300016445|Ga0182038_11027888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300017928|Ga0187806_1116209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300017961|Ga0187778_11165202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300017972|Ga0187781_10903012 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018057|Ga0187858_10651105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300018058|Ga0187766_11480032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300018060|Ga0187765_10181767 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300018062|Ga0187784_10033740 | All Organisms → cellular organisms → Bacteria | 4135 | Open in IMG/M |
| 3300018088|Ga0187771_10080917 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300018433|Ga0066667_10590544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300018433|Ga0066667_10729412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300019788|Ga0182028_1356025 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300020022|Ga0193733_1155142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300020170|Ga0179594_10069998 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300020199|Ga0179592_10011482 | All Organisms → cellular organisms → Bacteria | 3837 | Open in IMG/M |
| 3300020199|Ga0179592_10302754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300020579|Ga0210407_10519722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300020579|Ga0210407_11096804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300020580|Ga0210403_10388668 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300020580|Ga0210403_10495917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 992 | Open in IMG/M |
| 3300020581|Ga0210399_10163172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1846 | Open in IMG/M |
| 3300020581|Ga0210399_10333541 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300021086|Ga0179596_10346341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300021168|Ga0210406_10337084 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300021168|Ga0210406_10515824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300021168|Ga0210406_10535975 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300021170|Ga0210400_11539205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300021171|Ga0210405_10703797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300021171|Ga0210405_11047356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300021178|Ga0210408_10420824 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300021180|Ga0210396_11433213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300021402|Ga0210385_10854625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300021403|Ga0210397_10566129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300021405|Ga0210387_11418883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300021406|Ga0210386_10360126 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300021407|Ga0210383_10003950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13188 | Open in IMG/M |
| 3300021420|Ga0210394_10356826 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300021420|Ga0210394_10710887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300021432|Ga0210384_11657510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300021433|Ga0210391_10040641 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
| 3300021478|Ga0210402_11517015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300021559|Ga0210409_10051854 | All Organisms → cellular organisms → Bacteria | 3856 | Open in IMG/M |
| 3300021560|Ga0126371_10659886 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300021560|Ga0126371_12119673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300022557|Ga0212123_10029285 | All Organisms → cellular organisms → Bacteria | 5735 | Open in IMG/M |
| 3300024219|Ga0247665_1017279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300024323|Ga0247666_1079644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300024331|Ga0247668_1046843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300025934|Ga0207686_11616600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300026316|Ga0209155_1165002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300026319|Ga0209647_1173227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300026323|Ga0209472_1093084 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300026327|Ga0209266_1262516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300026360|Ga0257173_1007779 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300026371|Ga0257179_1027098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300026469|Ga0257169_1000277 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300026529|Ga0209806_1140666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300026537|Ga0209157_1054770 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
| 3300026538|Ga0209056_10417956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300026555|Ga0179593_1155048 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300026557|Ga0179587_11155546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300027562|Ga0209735_1151314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027591|Ga0209733_1073252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300027633|Ga0208988_1127961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300027663|Ga0208990_1055287 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300027727|Ga0209328_10259635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 517 | Open in IMG/M |
| 3300027745|Ga0209908_10035760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300027775|Ga0209177_10096951 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300027783|Ga0209448_10138782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300027855|Ga0209693_10284625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300027862|Ga0209701_10191322 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300027884|Ga0209275_10459562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300027889|Ga0209380_10698215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300027911|Ga0209698_10584185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300027915|Ga0209069_10605482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300028036|Ga0265355_1020070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300028037|Ga0265349_1005906 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300028792|Ga0307504_10226730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300028906|Ga0308309_10543828 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300029636|Ga0222749_10172844 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300029993|Ga0302304_10052338 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300030042|Ga0302300_1073489 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300030056|Ga0302181_10476638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300030494|Ga0310037_10351915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300030693|Ga0302313_10418713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300030737|Ga0302310_10277412 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031057|Ga0170834_112428808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031231|Ga0170824_115771973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300031231|Ga0170824_128648705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300031543|Ga0318516_10140098 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300031680|Ga0318574_10009023 | All Organisms → cellular organisms → Bacteria | 4441 | Open in IMG/M |
| 3300031708|Ga0310686_106886733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300031708|Ga0310686_111895740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300031719|Ga0306917_10136632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 1804 | Open in IMG/M |
| 3300031720|Ga0307469_11497368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300031740|Ga0307468_101148962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300031754|Ga0307475_10276939 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300031754|Ga0307475_10707630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300031770|Ga0318521_10175960 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300031781|Ga0318547_10844863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300031795|Ga0318557_10098995 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300031805|Ga0318497_10052926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2098 | Open in IMG/M |
| 3300031821|Ga0318567_10300344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300031833|Ga0310917_10722374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300031896|Ga0318551_10046461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2175 | Open in IMG/M |
| 3300031897|Ga0318520_10630001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300031941|Ga0310912_10886241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300031945|Ga0310913_10926997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300031947|Ga0310909_10474333 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031954|Ga0306926_10955552 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300031962|Ga0307479_10025949 | All Organisms → cellular organisms → Bacteria | 5559 | Open in IMG/M |
| 3300031962|Ga0307479_11635757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300032001|Ga0306922_10889968 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300032009|Ga0318563_10478101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300032044|Ga0318558_10463220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300032180|Ga0307471_100002740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10248 | Open in IMG/M |
| 3300032261|Ga0306920_102010046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300032770|Ga0335085_11119143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300032892|Ga0335081_11332426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.33% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.47% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.47% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.47% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03742000 | 2088090014 | Soil | MGSSAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDPKA |
| deeps_02121090 | 2199352024 | Soil | MASAAKITGVVLYDTLVNYLVSMSRTVEGAMNRALDALVDT |
| JGI12488J12863_1030591 | 3300000909 | Tropical Forest Soil | MATAAGLTEAVLYDALVNYLVSMARTVESAMNRALDAIVGFDSP |
| JGI1027J12803_1091756486 | 3300000955 | Soil | MASTSGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESPR |
| JGI25381J37097_10143382 | 3300002557 | Grasslands Soil | LAATPGLTEAVLYDTLVNYLVSMAHTVEGAMNRATDVVS* |
| JGI25613J43889_100443942 | 3300002907 | Grasslands Soil | MASTSAGLTEAVLYDALVNYLVSMARTVEGAMNRALDALISLDSS |
| Ga0062384_1014672822 | 3300004082 | Bog Forest Soil | MTSSAGLTEAVLYETLVNYLVSMARTVEGAMNRALEAIVGV |
| Ga0066672_104162241 | 3300005167 | Soil | MGSAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSVDDPKA |
| Ga0070688_1002538082 | 3300005365 | Switchgrass Rhizosphere | MGSSAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDPKAAALT |
| Ga0066681_108706102 | 3300005451 | Soil | MGSATGLTETVLYDTLVNYLISMARTVEGAMNRALEAIVGVDDPKV |
| Ga0070707_1014826572 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MASAPGLTETVLYDTLVNYLISMARTVEGAMNRALEAIVSVN |
| Ga0070699_1007252231 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSV |
| Ga0066661_100898282 | 3300005554 | Soil | MATTAGLTEVVLYDTLVNYLVSMARTVEGAMNRAL |
| Ga0066704_103932512 | 3300005557 | Soil | MGSAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSVDDPK |
| Ga0066704_108105562 | 3300005557 | Soil | MGATAGLTEVVLYDTLVNYLVSMARTVEGAMNRAL |
| Ga0066694_100767832 | 3300005574 | Soil | MASTPGLTEAVLYDTLVNYLVSMARTVEGAMNRALDA |
| Ga0070761_106305262 | 3300005591 | Soil | MASSAGLTEAVLYETLVNYLVSMARTVEGAMNRGL |
| Ga0066905_1012490492 | 3300005713 | Tropical Forest Soil | MSTPAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDPK |
| Ga0066903_1015688152 | 3300005764 | Tropical Forest Soil | MSASAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDP |
| Ga0068858_1006660712 | 3300005842 | Switchgrass Rhizosphere | MGSSAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDP |
| Ga0080027_102844782 | 3300005993 | Prmafrost Soil | MATPAGLTETVLYDTLVNYLISMARLVESAMNRALD |
| Ga0066652_1003672811 | 3300006046 | Soil | MAAIARLTEVVLYDTLVNYLVSMARTVEGVMNRALDCIVSLENPRTS |
| Ga0070716_1006498722 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSADDPKA |
| Ga0070716_1008498922 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSADDPKAS |
| Ga0070765_1005241332 | 3300006176 | Soil | MATPAGLTEVVLYDTLVNYLISMARVVETAMNRSLDA |
| Ga0079221_105205821 | 3300006804 | Agricultural Soil | MATTPGLTETVLYDTLMNYLVSMARTVEGAMNRALDSL |
| Ga0079219_104562482 | 3300006954 | Agricultural Soil | MASTPRLTESVMLDTLMNYLVSMARTVESAMNRALDAIVSLDNPR |
| Ga0075435_1008339272 | 3300007076 | Populus Rhizosphere | MASTPRLTETVLLDTLMNYLVSMARAVESAMNRALDAIVSLDNPRTAA |
| Ga0099794_100630422 | 3300007265 | Vadose Zone Soil | MAATAGLTEVVLYDTLMNYLVSMARTVEGAMNRAIDA |
| Ga0066710_1003646442 | 3300009012 | Grasslands Soil | MGTTAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLENPR |
| Ga0099830_100323934 | 3300009088 | Vadose Zone Soil | MGATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDA |
| Ga0099792_100279923 | 3300009143 | Vadose Zone Soil | MASTAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESPQ |
| Ga0105238_116961161 | 3300009551 | Corn Rhizosphere | MATTPGLTETVLYDTLMNYLVSMARTVEGAMNRALD |
| Ga0116119_11017631 | 3300009629 | Peatland | MATAAGLTEVVLHDTLVNYLISMARVVETAMNRALDAI |
| Ga0116216_106532261 | 3300009698 | Peatlands Soil | MTNAAGLTEVVLYDTLVNYLISMARIVESAMNRALDAIVGFDS |
| Ga0116134_11356132 | 3300009764 | Peatland | MATAAGLTEVVLHDTLVNFLISMARVVETAMNHALDAIVGI |
| Ga0126384_122777341 | 3300010046 | Tropical Forest Soil | MGTASRLTETVLYDTLVNYLASMARTVEGAMNRALDS |
| Ga0126373_101161231 | 3300010048 | Tropical Forest Soil | MDTKAPHSETLMLDTLLNYLVAMARTVESAMNRALDAI |
| Ga0126373_108604991 | 3300010048 | Tropical Forest Soil | MGSAAGLTETVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSART |
| Ga0126373_115295562 | 3300010048 | Tropical Forest Soil | MSTAAGLTETVLYDTLVNYLVSMARTVVGAMKRALDSLVGF |
| Ga0126373_130349131 | 3300010048 | Tropical Forest Soil | MTAVPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAIV |
| Ga0126372_100312201 | 3300010360 | Tropical Forest Soil | MSTSAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDPKAAS |
| Ga0126372_109641422 | 3300010360 | Tropical Forest Soil | MGTSAGPTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDPKA |
| Ga0126372_121826452 | 3300010360 | Tropical Forest Soil | MAASTSLTEAVLYDTLVNYLISMARTVESAMNRALDAIV |
| Ga0126379_100174791 | 3300010366 | Tropical Forest Soil | MATNPRLNESVMLDTLMNYLVSMARTVESAMNRALDAI |
| Ga0126379_100668434 | 3300010366 | Tropical Forest Soil | MSTSAGLTETVLYDTLVNYLISMARTVEGAVNRALE |
| Ga0105239_131534081 | 3300010375 | Corn Rhizosphere | MSTSAGLTETVLYDTLVNYLVSMARTVEGAVNRALEAI |
| Ga0126381_1033749212 | 3300010376 | Tropical Forest Soil | MGSAAGLTEVVLYDMLVNYLISMARVVESAMNRSLDAIIAFDNL |
| Ga0126383_114447272 | 3300010398 | Tropical Forest Soil | MASTPRLTDTVMLDTLMNYLVSMARTVESAMNRALDA |
| Ga0137392_102525011 | 3300011269 | Vadose Zone Soil | MATAAGLTEAVLYDTLVNYLISMARTVESAMNRALD |
| Ga0137392_109767152 | 3300011269 | Vadose Zone Soil | MGATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLE |
| Ga0137392_111219642 | 3300011269 | Vadose Zone Soil | MASTAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVS |
| Ga0137391_115178192 | 3300011270 | Vadose Zone Soil | MCSAAGVTETVLYDTLVNYLISMARTVEGAMNRALEAIVSV |
| Ga0137391_115753272 | 3300011270 | Vadose Zone Soil | MGSAAGVTETVLYDTLVNYLISMARTVEGAMNRAL |
| Ga0137393_108014782 | 3300011271 | Vadose Zone Soil | MATTAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLQNPGT |
| Ga0137393_110590211 | 3300011271 | Vadose Zone Soil | MAATAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLES |
| Ga0137388_108684972 | 3300012189 | Vadose Zone Soil | MAANAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLES |
| Ga0137388_112150341 | 3300012189 | Vadose Zone Soil | MASTAGVTEAVLYDTLVNYLVSMARTVEAAMNRALDAI |
| Ga0137383_100414972 | 3300012199 | Vadose Zone Soil | MAATPGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLENLVRPNGADH* |
| Ga0137383_108218162 | 3300012199 | Vadose Zone Soil | VASTAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLENP |
| Ga0137382_103255271 | 3300012200 | Vadose Zone Soil | MAATPGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLEN |
| Ga0137382_107337911 | 3300012200 | Vadose Zone Soil | MCSAAGVTETVLYDTLVNYLISMARTVEGAMNRALEAIVSANDPKASAL |
| Ga0137382_108408141 | 3300012200 | Vadose Zone Soil | MASTPGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLEN |
| Ga0137363_100231324 | 3300012202 | Vadose Zone Soil | MAGAAGLTEAVLYDTLVNYLVSMARTVEGAMTRALDAIVGL |
| Ga0137363_117450391 | 3300012202 | Vadose Zone Soil | MASAAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVGLENPRTTG |
| Ga0137399_103454031 | 3300012203 | Vadose Zone Soil | MASAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIIS |
| Ga0137362_103456771 | 3300012205 | Vadose Zone Soil | MASTTAGLTEAALYDALVNYLVSMARAVEGAMNRSL |
| Ga0137381_100778212 | 3300012207 | Vadose Zone Soil | MAATPGHTEAVLYDTLVNYIISMTRTVEGAMNRALDAIVSLENLVRPNGADH* |
| Ga0137379_101778892 | 3300012209 | Vadose Zone Soil | MAATPGHTEAVLYDTLVNYLISMTRTVEGAMNRALDAIVSLENLVRPNGADH* |
| Ga0137377_112412931 | 3300012211 | Vadose Zone Soil | MAATPRLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLENLR |
| Ga0137384_102831432 | 3300012357 | Vadose Zone Soil | MAATPGHTEAVLYDTLVNYLISMTRTVEGAMNRALDA |
| Ga0137384_107242802 | 3300012357 | Vadose Zone Soil | MAATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLE |
| Ga0137384_108741211 | 3300012357 | Vadose Zone Soil | VASTAGLTEVVLYDTLVNYLVSMARTVEGAMNRALD |
| Ga0137360_101755692 | 3300012361 | Vadose Zone Soil | MASAAGVTETVRYDTLVNYLISMARTVEGAMNRALEAIVSVDD |
| Ga0137360_116509732 | 3300012361 | Vadose Zone Soil | MASAAGLSETILYDTLVNYLISMARTVESAMNRALDAIVS |
| Ga0137390_109048811 | 3300012363 | Vadose Zone Soil | MAATGGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLENP |
| Ga0137390_113289472 | 3300012363 | Vadose Zone Soil | MASAAGLTEAVLYDTLVNYLVSMSRTVEGAMTRALDAIVGLESS |
| Ga0137358_101930971 | 3300012582 | Vadose Zone Soil | MGSAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSADD |
| Ga0137359_108889902 | 3300012923 | Vadose Zone Soil | MAATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVS |
| Ga0137413_116947711 | 3300012924 | Vadose Zone Soil | MAATVGLTEVVLYDTLVNYLVSMARTVEGAMNRALDALVSLENSRTSV |
| Ga0137416_107511852 | 3300012927 | Vadose Zone Soil | MASTAAGLTEAVLYDALVNYLVSMARTVEGAMNRALDALTSLDN |
| Ga0137404_110154222 | 3300012929 | Vadose Zone Soil | MASTAAGLSEAVLYDTLVNYLVSMARTVEGAMNRALDALISH |
| Ga0137404_123292211 | 3300012929 | Vadose Zone Soil | MGSAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSVDDPKASGL |
| Ga0137407_123104702 | 3300012930 | Vadose Zone Soil | MASAAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESPR |
| Ga0126369_107110491 | 3300012971 | Tropical Forest Soil | MATIPRTTEPLVLDTLMNYLVSMARTVESAMNRALDAIVSLDNPR |
| Ga0181532_101131421 | 3300014164 | Bog | MATAPGLTEAVLYDVLVNYLVSMARVVESAMNRALDAITGFDN |
| Ga0181531_103193711 | 3300014169 | Bog | MTTGAGLTETVLYDTLMNYLVSMARTVEGAMNRALDSLVGLDNA |
| Ga0181536_105228072 | 3300014638 | Bog | MATAAGLTEVVLHDTLVNYLISMARVVETAMNRALDAIVGFDNQRTA |
| Ga0137414_11823841 | 3300015051 | Vadose Zone Soil | MASAAAGLSEAVLYDTLVNYLVSMARTVEGAMNRALDALISHDSSRTS |
| Ga0137405_14269892 | 3300015053 | Vadose Zone Soil | MAATASLTEAVLYDALVNYLISMARTVESAMNRALDAS* |
| Ga0137420_12081891 | 3300015054 | Vadose Zone Soil | MAPAAGLTEAVLYDTLVNYLISMARVVESAMNRALDAIIAFDAFDNP |
| Ga0137418_103876411 | 3300015241 | Vadose Zone Soil | MAAATSLTEAVLYDTLVNYLISMARTVESAMNRALEAIV |
| Ga0134073_102323862 | 3300015356 | Grasslands Soil | MTTAAGLSEPVLYDTLVNYLVSMTRAVEGAMNRALQAIVSV |
| Ga0182041_121393051 | 3300016294 | Soil | MGSATGLTEVVLYDTLVNYLISMARVVESAMNRSLDAIIAFDN |
| Ga0182033_101385021 | 3300016319 | Soil | MAAAPDLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSARTA |
| Ga0182039_100968521 | 3300016422 | Soil | MAGAPDLTEAVLYDTLVNYLVSMARVVETAMNRALDAI |
| Ga0182038_110278881 | 3300016445 | Soil | MAGAPDLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSARTA |
| Ga0187806_11162091 | 3300017928 | Freshwater Sediment | MASTPGLTEVVLYDVLVNYLVSMARVVESAMNRALDAIVG |
| Ga0187778_111652021 | 3300017961 | Tropical Peatland | MESRSGLIETVLYDTLVNYLVSMARTVEGAMNRALDSLVGLNRAETVA |
| Ga0187781_109030121 | 3300017972 | Tropical Peatland | VAATAASTQAVYQDALVNYLISMARTVELNVNRALE |
| Ga0187858_106511051 | 3300018057 | Peatland | MATSPGLTETVLYDTLMNYLVSMARTVEGAMNRALDSL |
| Ga0187766_114800321 | 3300018058 | Tropical Peatland | MGSAAGLTEVVLYDTLVNYLISMARVVESAMNRSLDSL |
| Ga0187765_101817671 | 3300018060 | Tropical Peatland | MSTPAAGLTEVVLYDALVNYLVSMARTVESAMNRAL |
| Ga0187784_100337404 | 3300018062 | Tropical Peatland | MATAPGLTEAVLYDVLVNYLVSMARVVESAMNRAL |
| Ga0187771_100809173 | 3300018088 | Tropical Peatland | MATAAGLTEAVLYDALVNYLVSMARVVESAMNRALDAIVGFDN |
| Ga0066667_105905441 | 3300018433 | Grasslands Soil | MGTAAGITETVLYDTLVNYLISMARTVEGAMNRALEAIVSVDDPKAS |
| Ga0066667_107294121 | 3300018433 | Grasslands Soil | MAATASLTEAVLYDALVNYLISMARTVESAMNRALDA |
| Ga0182028_13560251 | 3300019788 | Fen | MATAAGLTEVVLHDALVNYLISMARVVETAMNRAWNAIVGFVQPADG |
| Ga0193733_11551421 | 3300020022 | Soil | MAATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDSIVSLENPRT |
| Ga0179594_100699981 | 3300020170 | Vadose Zone Soil | MASAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAI |
| Ga0179592_100114821 | 3300020199 | Vadose Zone Soil | MASTAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESPRT |
| Ga0179592_103027541 | 3300020199 | Vadose Zone Soil | MASTAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESARTS |
| Ga0210407_105197221 | 3300020579 | Soil | MAATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESP |
| Ga0210407_110968041 | 3300020579 | Soil | MGSPAGLTETVLYDTLVNYLVSMARTVEGAMNRAL |
| Ga0210403_103886682 | 3300020580 | Soil | MASTAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDA |
| Ga0210403_104959173 | 3300020580 | Soil | MASAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDA |
| Ga0210399_101631721 | 3300020581 | Soil | MAAAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLES |
| Ga0210399_103335412 | 3300020581 | Soil | MASASGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESSR |
| Ga0179596_103463412 | 3300021086 | Vadose Zone Soil | MAATPGLTEVVLYDTLVNYLVSMARTVEGAMNRAL |
| Ga0210406_103370841 | 3300021168 | Soil | MASAPGLTETVLYDALVNYLISMARLVESAMNRSLDAIIGFD |
| Ga0210406_105158241 | 3300021168 | Soil | MTTGSGLTETVLYDTLMNYLVSMARTVEGAMNRALDSLVGLDHAGT |
| Ga0210406_105359751 | 3300021168 | Soil | MTPAAGLTEAVLYDTLVNYLISMARVVESAMNRALDAIIAFDD |
| Ga0210400_115392051 | 3300021170 | Soil | MASAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLENS |
| Ga0210405_107037971 | 3300021171 | Soil | MASTPGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESSRTC |
| Ga0210405_110473561 | 3300021171 | Soil | MASFASGLTEAVLYDTLVNYLISMARVVESAMNRALDAIVGLDN |
| Ga0210408_104208242 | 3300021178 | Soil | MATTAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIV |
| Ga0210396_114332132 | 3300021180 | Soil | MTPAAGLTEAVLYDTLVNYLISMARVVESAMNRALDAIIAFD |
| Ga0210385_108546251 | 3300021402 | Soil | MASSTALTEAVLYETLVNYLVSMARTVEGAMNRALDAIVGVN |
| Ga0210397_105661291 | 3300021403 | Soil | MATAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLEGP |
| Ga0210387_114188831 | 3300021405 | Soil | MATTPGLTETVLYDTLMNYLVSMARTVEGAMNRALDSLVG |
| Ga0210386_103601262 | 3300021406 | Soil | MTPAAGLTEAVLYDTLVNYLISMARVVESAMNRAL |
| Ga0210383_100039501 | 3300021407 | Soil | MATAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAI |
| Ga0210394_103568261 | 3300021420 | Soil | MATPAGLTEVVLYDTLVNYLISMARVVETAMNRSLDAIIGFDN |
| Ga0210394_107108871 | 3300021420 | Soil | MAAIAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAI |
| Ga0210384_116575102 | 3300021432 | Soil | MTPAAGLTEAVLYDTLVNYLISMARVVESAMNRALDA |
| Ga0210391_100406411 | 3300021433 | Soil | MAATSGVTEAVLYDTLVNYLISMARVVESAMNRGLDAIVGFNNPRTAG |
| Ga0210402_115170151 | 3300021478 | Soil | MASTTAGLTEAVLYDALVNYLVSMARTVEGAMNRALDALTSLDSA |
| Ga0210409_100518544 | 3300021559 | Soil | MASTAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIISQDSARTA |
| Ga0126371_106598862 | 3300021560 | Tropical Forest Soil | MATTAGLTEAVLYDALVNYLVSMARTVESAMNRAL |
| Ga0126371_121196731 | 3300021560 | Tropical Forest Soil | MAGAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALD |
| Ga0212123_100292854 | 3300022557 | Iron-Sulfur Acid Spring | MASVTKITGVVLYDTLVNYLVSMSRTVEGAMNRALDALVNVDSSRT |
| Ga0247665_10172791 | 3300024219 | Soil | MGSSAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVSVDDPK |
| Ga0247666_10796442 | 3300024323 | Soil | MGSSAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIV |
| Ga0247668_10468431 | 3300024331 | Soil | MAATASLTEAVLYDALVNYLISMARTVESAMNRALDAIVSLESPRT |
| Ga0207686_116166001 | 3300025934 | Miscanthus Rhizosphere | MSASAGLTEAVLYDTLVNYLISMARTVEGAVNRALEAIVS |
| Ga0209155_11650021 | 3300026316 | Soil | MASTPTPRITESVMLDTLMNYLVSMARTVESAMNR |
| Ga0209647_11732271 | 3300026319 | Grasslands Soil | MAASASLTEAVLYDTLVNYLISMARTVESAMNRAL |
| Ga0209472_10930841 | 3300026323 | Soil | MATTGRLNESILLDTLMNYLVSMARTVESAMNRALDAIVSLDNPR |
| Ga0209266_12625162 | 3300026327 | Soil | MATTGRLNESILLDTLMNYLVSMARTVESAMNRALDAI |
| Ga0257173_10077791 | 3300026360 | Soil | MASAAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLESPRTA |
| Ga0257179_10270981 | 3300026371 | Soil | MASEADLTEAVLYDTLVHYLVSMARTVESAMNRALDA |
| Ga0257169_10002773 | 3300026469 | Soil | MCSAAGVTETVLYDTLVNYLISMARTVEGAMNRALETIVSVEDP |
| Ga0209806_11406661 | 3300026529 | Soil | MATTAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLENPRTG |
| Ga0209157_10547702 | 3300026537 | Soil | MGATAGFTEVVLYDTLVNYLVSMARTVEGAMNRAL |
| Ga0209056_104179561 | 3300026538 | Soil | MAATPGLTEAVLYDTLVNYLVSMARTVEGAMNRAL |
| Ga0179593_11550481 | 3300026555 | Vadose Zone Soil | MASAAAGLSEAVLYDTLVNYLVSMARTVEGAMNRAL |
| Ga0179587_111555462 | 3300026557 | Vadose Zone Soil | MTSSTTAASALTSAVMYETLLNYLVSMARTVEGAMNRALDAIVSLE |
| Ga0209735_11513142 | 3300027562 | Forest Soil | MASSAGLTEAVLYETLVNYLVSMARTVEGAMNRALD |
| Ga0209733_10732521 | 3300027591 | Forest Soil | MASVTKITGVVLYDTLVNYLVSMSRTVEGAMNRALDA |
| Ga0208988_11279612 | 3300027633 | Forest Soil | MASVTEITGVVLYDTLVNYLVSMSRAVEGAMNRALDALVNVDS |
| Ga0208990_10552872 | 3300027663 | Forest Soil | MASVTEITGVVLYDTLVNYLVSMSRTVEGAMNRALDALVNVDSSRT |
| Ga0209328_102596352 | 3300027727 | Forest Soil | MASVTQITGVVLYDTLVNYLVSMSRTVEGAMNRALDAL |
| Ga0209908_100357602 | 3300027745 | Thawing Permafrost | MTTSPSVLTDAIMYDTLVNYLVSMARTVEGAMNLSLIHIS |
| Ga0209177_100969512 | 3300027775 | Agricultural Soil | MTSAAGLTEAVLYDTLVNYMASMARTVEGAMNRALDAMVSLDTSRTAA |
| Ga0209448_101387821 | 3300027783 | Bog Forest Soil | MAGAAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVGV |
| Ga0209693_102846252 | 3300027855 | Soil | MASSAGLTEAVLYETLVNYLVSMARTVEGAMNRALDAIVGVNEQR |
| Ga0209701_101913221 | 3300027862 | Vadose Zone Soil | MGATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALD |
| Ga0209275_104595622 | 3300027884 | Soil | MASSAGLTEAVLYETLVNYLVSMARTVEGAMNRALDAIVGVN |
| Ga0209380_106982151 | 3300027889 | Soil | MASSAGLTEAVLYETLVNYLVSMARTVEGAMNRALDAIVGVNESRT |
| Ga0209698_105841852 | 3300027911 | Watersheds | MGSAAGLSEAVLHDALVNYLVSMARTVESAMNRALDA |
| Ga0209069_106054822 | 3300027915 | Watersheds | MTATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLD |
| Ga0265355_10200702 | 3300028036 | Rhizosphere | MASPAGMTEAVLYETLVNYLVSMARTVEGAMNRGLDAIVSVNDT |
| Ga0265349_10059061 | 3300028037 | Soil | MASPAGMTEAVLYETLVNYLVSMARTVEGAMNRGLD |
| Ga0307504_102267302 | 3300028792 | Soil | MATTPGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIV |
| Ga0308309_105438281 | 3300028906 | Soil | MASFASGLTEAVLYDTLVNYLISMARVVESAMNRALDAI |
| Ga0222749_101728441 | 3300029636 | Soil | MASSAGLTEAVLYETLVNYLVSMARTVEGAMNRALDAIVDVN |
| Ga0302304_100523381 | 3300029993 | Palsa | MTTSPSVLTDAVMYDTLVNYLVSMARTVEGAMNRALDA |
| Ga0302300_10734891 | 3300030042 | Palsa | MGTQAGFTETVLYDTLVHYLVSMARTVEGAMNRALDALMTFHSTPN |
| Ga0302181_104766382 | 3300030056 | Palsa | MGTQAGFTETVLYDTLVHYLVSMARTVEGAMNRALDALMTFHSTPNSPL |
| Ga0310037_103519151 | 3300030494 | Peatlands Soil | MAATAGLTEVVLYDTLVNYLVSMARTVEGAMNRALDSIVSL |
| Ga0302313_104187132 | 3300030693 | Palsa | MGTQAGFTETVLYDTLVHYLVSMARTVEGAMNRALDALMTF |
| Ga0302310_102774122 | 3300030737 | Palsa | MGTQAGFTETVLYDTLVHYLVSMARTVEGAMNRALDALMTFHSTPNSP |
| Ga0170834_1124288081 | 3300031057 | Forest Soil | MASVTKITEVVLYDTLVNYLVSMSRTVEGAMNRALDAVVN |
| Ga0170824_1157719731 | 3300031231 | Forest Soil | MTTGAGLTETVLYDTLMNYLVSMARTVEGAMNRALDSLV |
| Ga0170824_1286487051 | 3300031231 | Forest Soil | MAATSGLTEVVLYDTLVNYLVSMARTVEGAMNRALDAIVSLEVKVNR |
| Ga0318516_101400981 | 3300031543 | Soil | MTAVPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSAR |
| Ga0318574_100090231 | 3300031680 | Soil | MTAAPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSARTAA |
| Ga0310686_1068867331 | 3300031708 | Soil | MASPAGMTEAVLYETLVNYLVSMARTVEGAMNRGLDAI |
| Ga0310686_1118957402 | 3300031708 | Soil | MASPVGQTEAVLYETLVNYLVSMARTVEGAMNRGLDAIVG |
| Ga0306917_101366321 | 3300031719 | Soil | MTAAPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFD |
| Ga0307469_114973682 | 3300031720 | Hardwood Forest Soil | MATPAGLTETVLYDTLVNYLISMARTVEGGMNRALEAIV |
| Ga0307468_1011489622 | 3300031740 | Hardwood Forest Soil | MTPAAGLTEAVLYDTLVNYLISMARVVESAMNRALD |
| Ga0307475_102769391 | 3300031754 | Hardwood Forest Soil | MSSTAGLTDIVLYDTLVNYLVSMARTVECAMNRALDAIVSLES |
| Ga0307475_107076301 | 3300031754 | Hardwood Forest Soil | MASSAGLTEAVLYETLVNYLVSMARTVEGAMNRALDAIVGVNDSRT |
| Ga0318521_101759601 | 3300031770 | Soil | MTAAPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAI |
| Ga0318547_108448632 | 3300031781 | Soil | MAAAPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSARTAT |
| Ga0318557_100989951 | 3300031795 | Soil | MTAAPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSART |
| Ga0318497_100529262 | 3300031805 | Soil | MTAAPGLTEAVLYDTLVNYLVSMARVVETAMNRALDAIVGFDSAR |
| Ga0318567_103003441 | 3300031821 | Soil | MDTKAPLTEPLMLDTLMNYLVAMARTVESAMNRALDAI |
| Ga0310917_107223742 | 3300031833 | Soil | MATIPRTTEPLVLDTLMNYLVSMARTVESAMNRALDA |
| Ga0318551_100464613 | 3300031896 | Soil | MDTKAPLTEPLMLDTLMNYLVAMARTVESAMNRALD |
| Ga0318520_106300012 | 3300031897 | Soil | MSTSAGLTETVLYDTLVNYLISMARTVEGAVNRALEAIVS |
| Ga0310912_108862412 | 3300031941 | Soil | MSTPAAGLTETVLYDALVNYLVSMARTVESAMNRALD |
| Ga0310913_109269972 | 3300031945 | Soil | MTAAPGLTEAVLNDTLINYLVSMARVVETAMNRARDALVGF |
| Ga0310909_104743331 | 3300031947 | Soil | MSSAAGLTEAVLYDTLVNYLISMARVVESAMNRSLDAIIAFEN |
| Ga0306926_109555521 | 3300031954 | Soil | MSTPAAGLTETVLYDALVNYLVSMARTVESAMNRA |
| Ga0307479_100259494 | 3300031962 | Hardwood Forest Soil | MASVSKITGAVLYDTLVNYLVSMSRTVEGAMNRALDALVNVNSTRTADL |
| Ga0307479_116357572 | 3300031962 | Hardwood Forest Soil | MASTSAGLTEAVLHDALVNYLVSMARTVEGAMNRALDALI |
| Ga0306922_108899681 | 3300032001 | Soil | MATAAGLTEAVLYDALVNYLVSMARTVESAMNRALDAIVGFA |
| Ga0318563_104781012 | 3300032009 | Soil | MATNPGLTETVLYDTLVNYLVSMARTVESAMNRGLDAIVSLHSPHTAG |
| Ga0318558_104632202 | 3300032044 | Soil | MAATPDLTEAVLYDTLVNYLISMARVVETAMNRALDAIVGFDGA |
| Ga0307471_1000027401 | 3300032180 | Hardwood Forest Soil | MAATAGLTEAVLYDTLVNYLVSMARTVEGAMNRALDAIVSLDIP |
| Ga0306920_1020100461 | 3300032261 | Soil | MTAAPGLTEAVLYDVLVNYLVSMARIVESAMNRALDAITGFDNPGT |
| Ga0335085_111191431 | 3300032770 | Soil | MATAPGLTETVLYDVLVNYLVSMARVVENAMNRALDAIIGFDNPKTA |
| Ga0335081_113324262 | 3300032892 | Soil | MATAAGLTEAVLYDALVNYLVSMARVVESAMNRALDAIIG |
| ⦗Top⦘ |