Metagenome / Metatranscriptome Family F022258

Overview

Basic Information

• Family ID: F022258
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 215
• Average Sequence Length: 39 residues
• Representative Sequence: MTIHKQRGGRYWYYWLVIVGGTLFVIAYYATDGFGLQP
• Number of Associated Samples: 156
• Number of Associated Scaffolds: 215

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 52.09 %
• % of genes near scaffold ends (potentially truncated): 11.63 %
• % of genes from short scaffolds (< 2000 bps): 78.14 %
• Associated GOLD sequencing projects: 146
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (50.233 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.860 % of family members)
• Environment Ontology (ENVO): Unclassified (24.651 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (46.512 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 28.79%
  β-sheet: 0.00%
  Coil/Unstructured: 71.21%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 215 Family Scaffolds
PF00480	ROK	30.23
PF00005	ABC_tran	7.91
PF14602	Hexapep_2	4.65
PF02151	UVR	1.86
PF12344	UvrB	1.40
PF01594	AI-2E_transport	1.40
PF02653	BPD_transp_2	1.40
PF00211	Guanylate_cyc	0.93
PF10099	RskA	0.93
PF01842	ACT	0.93
PF02557	VanY	0.93
PF02801	Ketoacyl-synt_C	0.47
PF01476	LysM	0.47
PF13396	PLDc_N	0.47
PF00264	Tyrosinase	0.47
PF05834	Lycopene_cycl	0.47
PF01408	GFO_IDH_MocA	0.47
PF00664	ABC_membrane	0.47
PF01894	UPF0047	0.47
PF03795	YCII	0.47
PF01839	FG-GAP	0.47
PF03972	MmgE_PrpD	0.47
PF07883	Cupin_2	0.47
PF02569	Pantoate_ligase	0.47
PF02913	FAD-oxidase_C	0.47
PF13556	HTH_30	0.47
PF02548	Pantoate_transf	0.47
PF01121	CoaE	0.47
PF00953	Glycos_transf_4	0.47
PF02737	3HCDH_N	0.47
PF00583	Acetyltransf_1	0.47
PF13379	NMT1_2	0.47
PF02261	Asp_decarbox	0.47
PF01869	BcrAD_BadFG	0.47
PF13432	TPR_16	0.47
PF13561	adh_short_C2	0.47
PF02734	Dak2	0.47
PF13091	PLDc_2	0.47
PF00106	adh_short	0.47
PF13191	AAA_16	0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 215 Family Scaffolds
COG1940	Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain	Transcription [K]	60.47
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	1.40
COG2173	D-alanyl-D-alanine dipeptidase	Cell wall/membrane/envelope biogenesis [M]	0.93
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.93
COG1876	LD-carboxypeptidase LdcB, LAS superfamily	Cell wall/membrane/envelope biogenesis [M]	0.93
COG0853	Aspartate 1-decarboxylase	Coenzyme transport and metabolism [H]	0.47
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.47
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	0.47
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.47
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	0.47
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.47
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.47
COG0237	Dephospho-CoA kinase	Coenzyme transport and metabolism [H]	0.47
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.47
COG0472	UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase	Cell wall/membrane/envelope biogenesis [M]	0.47
COG0432	Thiamin phosphate synthase YjbQ, UPF0047 family	Coenzyme transport and metabolism [H]	0.47
COG0414	Panthothenate synthetase	Coenzyme transport and metabolism [H]	0.47
COG0413	Ketopantoate hydroxymethyltransferase	Coenzyme transport and metabolism [H]	0.47
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	0.47
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.47
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.47

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.70 %
Unclassified	root	N/A	49.30 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.70 %
Unclassified	root	N/A	49.30 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	50.23 %
Unclassified	root	N/A	49.30 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.47 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	26.98 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.86 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.47 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.47 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.47 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.47 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	26.51 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.47 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.47 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	12.56 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3.26 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.47 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.47 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.47 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.47 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.93 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	7.44 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	2.79 %
Thermoleophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales	1.40 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.47 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.93 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae	1.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.47 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.93 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
unclassified Thermoleophilaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae	1.40 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.93 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Myxococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus	0.47 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
unclassified Myxococcus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus	0.47 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	49.30 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.79 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2.79 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1.40 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.47 %
Myxococcus sp. AB025B	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	0.47 %
Bradyrhizobium yuanmingense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	0.47 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.47 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.47 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.47 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.47 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.47 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2124908044|A5_c1_ConsensusfromContig79106	Not Available	1437
2140918007|ConsensusfromContig58632	All Organisms → cellular organisms → Bacteria	1650
2170459013|GO6OHWN01D6H3G	Not Available	522
2189573002|GZIGXIF01D1AJX	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	533
3300000956|JGI10216J12902_103781859	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	684
3300000956|JGI10216J12902_105898945	Not Available	575
3300001536|A1565W1_10938541	All Organisms → cellular organisms → Bacteria	1064
3300001538|A10PFW1_11241281	Not Available	715
3300002184|JGI24770J26754_10241218	All Organisms → cellular organisms → Bacteria	605
3300002568|C688J35102_120928563	Not Available	2460
3300004153|Ga0063455_101433647	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	535
3300004157|Ga0062590_101974310	Not Available	604
3300004157|Ga0062590_102773602	Not Available	523
3300004463|Ga0063356_101580426	All Organisms → cellular organisms → Bacteria	975
3300004479|Ga0062595_101706797	Not Available	593
3300005356|Ga0070674_100814881	Not Available	807
3300005536|Ga0070697_101089286	All Organisms → cellular organisms → Bacteria	711
3300005563|Ga0068855_101359774	Not Available	733
3300005564|Ga0070664_100015732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	6191
3300005587|Ga0066654_10276890	Not Available	892
3300005718|Ga0068866_10000003	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	281675
3300005718|Ga0068866_10522759	All Organisms → cellular organisms → Bacteria	789
3300005719|Ga0068861_101866926	Not Available	597
3300005841|Ga0068863_100198922	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1927
3300005842|Ga0068858_100088454	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2882
3300005843|Ga0068860_101724799	Not Available	648
3300005937|Ga0081455_10188131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1558
3300005937|Ga0081455_10423012	Not Available	918
3300005937|Ga0081455_10484038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense	836
3300005985|Ga0081539_10016027	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	5391
3300006038|Ga0075365_10036183	Not Available	3198
3300006038|Ga0075365_10159526	All Organisms → cellular organisms → Bacteria	1571
3300006038|Ga0075365_10381009	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	995
3300006038|Ga0075365_11043064	Not Available	576
3300006046|Ga0066652_100014197	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	5254
3300006046|Ga0066652_100366645	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1302
3300006046|Ga0066652_100382731	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1276
3300006046|Ga0066652_100510162	Not Available	1119
3300006046|Ga0066652_100577322	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	1057
3300006092|Ga0082021_1098968	All Organisms → cellular organisms → Bacteria	2393
3300006173|Ga0070716_100660041	Not Available	794
3300006173|Ga0070716_100697595	Not Available	775
3300006175|Ga0070712_100949103	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	743
3300006175|Ga0070712_101068231	Not Available	700
3300006178|Ga0075367_10523234	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	753
3300006237|Ga0097621_101032544	Not Available	770
3300006573|Ga0074055_11196743	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1128
3300006580|Ga0074049_11850886	All Organisms → cellular organisms → Bacteria	702
3300006606|Ga0074062_11634783	Not Available	632
3300006804|Ga0079221_10913507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	646
3300006806|Ga0079220_10553336	Not Available	803
3300006854|Ga0075425_101065845	Not Available	921
3300006871|Ga0075434_100058877	Not Available	3818
3300006954|Ga0079219_10095903	All Organisms → cellular organisms → Bacteria	1441
3300006972|Ga0075518_1052656	Not Available	814
3300009011|Ga0105251_10240873	Not Available	815
3300009012|Ga0066710_100225807	Not Available	2689
3300009012|Ga0066710_102940470	Not Available	666
3300009137|Ga0066709_103204480	All Organisms → cellular organisms → Bacteria → Terrabacteria group	597
3300009147|Ga0114129_10617382	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1403
3300009148|Ga0105243_10687527	Not Available	996
3300009698|Ga0116216_10345692	Not Available	905
3300009789|Ga0126307_10266931	Not Available	1376
3300009818|Ga0105072_1121923	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	534
3300009840|Ga0126313_11336641	Not Available	593
3300009840|Ga0126313_11442331	Not Available	571
3300009840|Ga0126313_11528432	Not Available	555
3300009840|Ga0126313_11800663	Not Available	512
3300009868|Ga0130016_10673727	Not Available	633
3300009870|Ga0131092_10355101	Not Available	1391
3300009870|Ga0131092_10965130	Not Available	693
3300010036|Ga0126305_10541048	Not Available	779
3300010038|Ga0126315_10241371	All Organisms → cellular organisms → Bacteria	1100
3300010040|Ga0126308_10004616	All Organisms → cellular organisms → Bacteria	6369
3300010041|Ga0126312_10002132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	13194
3300010041|Ga0126312_10025042	All Organisms → cellular organisms → Bacteria	3983
3300010041|Ga0126312_11111052	Not Available	581
3300010041|Ga0126312_11146102	Not Available	572
3300010042|Ga0126314_10807293	Not Available	691
3300010043|Ga0126380_11073341	Not Available	684
3300010044|Ga0126310_10001568	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	8854
3300010147|Ga0126319_1171952	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	542
3300010166|Ga0126306_10085416	All Organisms → cellular organisms → Bacteria	2255
3300010333|Ga0134080_10338894	All Organisms → cellular organisms → Bacteria	683
3300010335|Ga0134063_10137448	Not Available	1127
3300010337|Ga0134062_10367038	All Organisms → cellular organisms → Bacteria	697
3300010337|Ga0134062_10560922	Not Available	583
3300010364|Ga0134066_10281263	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	589
3300010373|Ga0134128_10647447	All Organisms → cellular organisms → Bacteria	1175
3300010379|Ga0136449_100033314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	12334
3300010400|Ga0134122_10075773	All Organisms → cellular organisms → Bacteria	2622
3300010400|Ga0134122_11059121	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	800
3300011119|Ga0105246_10260459	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1381
3300011119|Ga0105246_11245780	Not Available	687
3300012198|Ga0137364_10057654	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2612
3300012198|Ga0137364_10564697	All Organisms → cellular organisms → Bacteria	857
3300012201|Ga0137365_10250432	All Organisms → cellular organisms → Bacteria	1317
3300012201|Ga0137365_10397498	Not Available	1016
3300012201|Ga0137365_10406268	All Organisms → cellular organisms → Bacteria	1004
3300012204|Ga0137374_10005384	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	15211
3300012212|Ga0150985_102402599	Not Available	618
3300012212|Ga0150985_106443416	Not Available	641
3300012350|Ga0137372_10935345	Not Available	611
3300012355|Ga0137369_10056079	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3416
3300012356|Ga0137371_10845742	Not Available	696
3300012469|Ga0150984_104123898	Not Available	563
3300012930|Ga0137407_12361131	Not Available	508
3300012931|Ga0153915_12786673	Not Available	571
3300012948|Ga0126375_11718107	Not Available	545
3300012951|Ga0164300_10001455	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	5515
3300012958|Ga0164299_10385656	Not Available	895
3300012961|Ga0164302_10621182	Not Available	787
3300012961|Ga0164302_11168353	Not Available	613
3300012985|Ga0164308_10844392	Not Available	802
3300012986|Ga0164304_10489869	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	895
3300012987|Ga0164307_10261564	All Organisms → cellular organisms → Bacteria	1213
3300012988|Ga0164306_10170020	All Organisms → cellular organisms → Bacteria	1504
3300012988|Ga0164306_10494654	All Organisms → cellular organisms → Bacteria	939
3300012989|Ga0164305_11498427	Not Available	598
3300012989|Ga0164305_12177171	All Organisms → cellular organisms → Bacteria	510
3300013308|Ga0157375_10003070	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	14493
3300013772|Ga0120158_10262750	Not Available	856
3300014320|Ga0075342_1188987	Not Available	577
3300014325|Ga0163163_13346831	Not Available	500
3300014326|Ga0157380_13476541	Not Available	504
3300015162|Ga0167653_1000935	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7105
3300015168|Ga0167631_1000112	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	12355
3300015371|Ga0132258_10005487	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	24874
3300015371|Ga0132258_10072059	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	8016
3300015371|Ga0132258_10128012	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	6050
3300015371|Ga0132258_10822102	All Organisms → cellular organisms → Bacteria	2343
3300015371|Ga0132258_13036086	Not Available	1162
3300015371|Ga0132258_13467861	All Organisms → cellular organisms → Bacteria	1081
3300017657|Ga0134074_1138586	Not Available	847
3300017966|Ga0187776_10120991	All Organisms → cellular organisms → Bacteria	1581
3300018429|Ga0190272_11712232	Not Available	651
3300018432|Ga0190275_10312768	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1545
3300018432|Ga0190275_11607642	Not Available	728
3300018432|Ga0190275_11718582	Not Available	706
3300018432|Ga0190275_13320819	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	521
3300018466|Ga0190268_10990980	Not Available	668
3300018469|Ga0190270_10044800	All Organisms → cellular organisms → Bacteria	3023
3300018469|Ga0190270_10088502	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2327
3300018469|Ga0190270_10750585	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	975
3300018469|Ga0190270_11493430	All Organisms → cellular organisms → Bacteria	725
3300018469|Ga0190270_12001828	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	637
3300018469|Ga0190270_12307126	Not Available	599
3300018481|Ga0190271_10058185	All Organisms → cellular organisms → Bacteria	3339
3300018481|Ga0190271_10202299	Not Available	1978
3300018481|Ga0190271_10472893	All Organisms → cellular organisms → Bacteria	1361
3300018481|Ga0190271_10516721	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1307
3300018482|Ga0066669_10055775	All Organisms → cellular organisms → Bacteria	2527
3300019362|Ga0173479_10399869	Not Available	662
3300019377|Ga0190264_10321729	Not Available	951
3300020001|Ga0193731_1076441	Not Available	874
3300021363|Ga0193699_10386090	Not Available	581
3300022756|Ga0222622_10740559	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B	716
3300024187|Ga0247672_1072849	Not Available	585
3300025524|Ga0209817_1076029	Not Available	556
3300025725|Ga0209638_1073609	Not Available	1292
3300025817|Ga0210144_1000833	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	14135
3300025817|Ga0210144_1036449	Not Available	1531
3300025817|Ga0210144_1110031	Not Available	800
3300025885|Ga0207653_10412729	Not Available	529
3300025898|Ga0207692_10129868	Not Available	1421
3300025899|Ga0207642_10000002	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	658166
3300025899|Ga0207642_10749229	All Organisms → cellular organisms → Bacteria	618
3300025900|Ga0207710_10722850	Not Available	523
3300025915|Ga0207693_10427069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1036
3300025916|Ga0207663_10005118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	6590
3300025920|Ga0207649_10201005	All Organisms → cellular organisms → Bacteria	1408
3300025929|Ga0207664_10030590	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4113
3300025934|Ga0207686_11133159	Not Available	639
3300025937|Ga0207669_10198554	Not Available	1454
3300025937|Ga0207669_11229704	All Organisms → cellular organisms → Bacteria	635
3300025949|Ga0207667_11239589	Not Available	724
3300025972|Ga0207668_10481969	All Organisms → cellular organisms → Bacteria	1064
3300026089|Ga0207648_10000643	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	39180
3300026121|Ga0207683_10508360	Not Available	1113
3300026319|Ga0209647_1000007	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	229181
3300026319|Ga0209647_1068443	Not Available	1809
3300027288|Ga0208525_1021448	All Organisms → cellular organisms → Bacteria	753
3300027561|Ga0209887_1015462	All Organisms → cellular organisms → Bacteria	1905
3300027775|Ga0209177_10063775	Not Available	1081
3300027870|Ga0209023_10014399	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	7165
3300028381|Ga0268264_10023193	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5064
3300028556|Ga0265337_1000034	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	60151
3300028707|Ga0307291_1063915	Not Available	897
3300028710|Ga0307322_10219738	Not Available	522
3300028713|Ga0307303_10102387	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	657
3300028754|Ga0307297_10343167	Not Available	545
3300028755|Ga0307316_10001067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	8564
3300028755|Ga0307316_10006611	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3575
3300028768|Ga0307280_10245225	Not Available	643
3300028784|Ga0307282_10215036	Not Available	920
3300028784|Ga0307282_10545911	All Organisms → cellular organisms → Bacteria	563
3300028787|Ga0307323_10235588	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	660
3300028793|Ga0307299_10101781	All Organisms → cellular organisms → Bacteria	1074
3300028802|Ga0307503_10000048	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	81515
3300028878|Ga0307278_10068995	All Organisms → cellular organisms → Bacteria	1595
3300028878|Ga0307278_10143594	Not Available	1070
3300029990|Ga0311336_11659265	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	564
3300031114|Ga0308187_10372076	Not Available	557
3300031199|Ga0307495_10127065	Not Available	635
3300031228|Ga0299914_10179620	Not Available	1878
3300031228|Ga0299914_10783745	Not Available	796
3300031229|Ga0299913_10037348	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4599
3300031229|Ga0299913_10445484	Not Available	1282
3300031652|Ga0315553_10044796	Not Available	2526
3300032002|Ga0307416_102252418	Not Available	646
3300032160|Ga0311301_10021966	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	17783
3300032180|Ga0307471_102219446	Not Available	692
3300033433|Ga0326726_10557548	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1099
3300034781|Ga0334935_017946	Not Available	1843
3300034781|Ga0334935_073195	All Organisms → cellular organisms → Bacteria	925

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	73.49%
Host-Associated	Host-Associated	24.65%
Engineered	Engineered	1.86%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	69.30%
Plants	Host-Associated → Plants	24.65%
Aquatic	Environmental → Aquatic	4.19%
Wastewater	Engineered → Wastewater	1.86%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	68.37%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.30%
Roots	Host-Associated → Plants → Roots	3.26%
Freshwater	Environmental → Aquatic → Freshwater	1.86%
Marine	Environmental → Aquatic → Marine	1.86%
Activated Sludge	Engineered → Wastewater → Activated Sludge	1.86%
Peat	Environmental → Terrestrial → Peat	0.93%
Sediment	Environmental → Aquatic → Sediment	0.47%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	60.00%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.91%
Loam	Environmental → Terrestrial → Soil → Loam	5.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.58%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.72%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.72%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	2.33%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	1.86%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.40%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.93%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.93%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	0.93%
Sand	Environmental → Terrestrial → Soil → Sand	0.93%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.93%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.93%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.47%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.47%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.47%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.47%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	43.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.91%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.65%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	3.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.72%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.26%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	2.33%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.86%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	1.86%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.40%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.93%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.93%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.93%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	0.93%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.93%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.47%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.47%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.47%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.47%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	21.86%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	6.98%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.79%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.33%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.33%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	2.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.86%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.86%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.40%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.40%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.40%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.40%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.40%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.40%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.93%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.93%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.93%
Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust	0.93%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.93%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.47%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.47%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.47%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.47%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.47%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.47%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.47%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.47%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.47%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.47%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.47%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.47%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.47%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.47%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.47%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.47%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.47%
Wastewater Treatment Plant	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant	0.47%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2124908044	Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5	Environmental
2140918007	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all	Environmental
2170459013	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm	Environmental
2189573002	Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300001536	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina	Environmental
3300001538	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina	Environmental
3300002184	Freshwater and sediment microbial communities from Lake Erie, Canada	Environmental
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006092	Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore	Engineered
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental
3300006580	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)	Environmental
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300006972	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A	Environmental
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009698	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG	Environmental
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental
3300009868	Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant	Engineered
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300015162	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)	Environmental
3300015168	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental
3300020001	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2	Environmental
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental
3300024187	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13	Environmental
3300025524	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A (SPAdes)	Environmental
3300025725	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)	Environmental
3300025817	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes)	Environmental
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental
3300027288	Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)	Environmental
3300027561	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)	Environmental
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental
3300027870	Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)	Environmental
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Host-Associated
3300028707	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148	Environmental
3300028710	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380	Environmental
3300028713	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184	Environmental
3300028754	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157	Environmental
3300028755	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356	Environmental
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental
3300028793	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159	Environmental
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental
3300029990	I_Fen_N2 coassembly	Environmental
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental
3300031652	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40	Environmental
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300034781	Biocrust microbial communities from Mojave Desert, California, United States - 31SMC	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
A5_c1_00017160	2124908044	Soil	MAIHRQRGGRYWHYWAIIIGGTIFVIAYYASDGFGVTP
A_all_C_02099150	2140918007	Soil	PSARRRQELTLAIHRQRGGRYWHYWAIIIGGTIFVIAYYASDGFGVTP
N57_01892450	2170459013	Grass Soil	MAIHKGRSGAGTYWYYWLVIVGGTIFVIAAYATDMFGLKP
FE1_07396270	2189573002	Grass Soil	MTIHKQRGGRYWYYWLVIVGGTLFVIAYYATDGFGLQP
JGI10216J12902_1037818592	3300000956	Soil	VIHPQKGGRYWYYWVVIVGGTIFVIAALATDMFGTGP*
JGI10216J12902_1058989451	3300000956	Soil	PQRGGRYWYYWAVIIGGTIFVIVALATDMFGTGS*
A1565W1_109385413	3300001536	Permafrost	MTIHKRRGGGYWYYWVLLIGGTIFVIAYFSTDGFGLSP*
A10PFW1_112412812	3300001538	Permafrost	MTIHKRRGGGYWYYWVLLIGGTTFVIAYFSTDGFGLSP*
JGI24770J26754_102412182	3300002184	Freshwater And Sediment	MTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLTP*
C688J35102_1209285632	3300002568	Soil	MAIHKGRSGSGTYWYYWLVIVGGTIFVIAALATDMFGLKP*
Ga0063455_1014336472	3300004153	Soil	LTIHKSRYGTYWYYWVIIIGGVAFVIAAYATNGFGTGAA*
Ga0062590_1019743101	3300004157	Soil	RLTVAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP*
Ga0062590_1027736021	3300004157	Soil	VTIHKQRGGRYWYYWVIIIGGTIFVVAALATDMFGLGSGY*
Ga0063356_1015804262	3300004463	Arabidopsis Thaliana Rhizosphere	MTIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAA*
Ga0062595_1017067971	3300004479	Soil	VTIHRQRGGRYWYYWVIIIGGTIFVVAALATDMFGLGSGY*
Ga0070674_1008148811	3300005356	Miscanthus Rhizosphere	PRSRAEMAIHRPRGGHYWYYWLIIVGGTIFVIAYYATDGFGLQP*
Ga0070697_1010892861	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	RGDRRAPTGGRPGMTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP*
Ga0068855_1013597742	3300005563	Corn Rhizosphere	MTIHKPRGGLYWRYWAVLIAGSAFVIAYLLTDGFGLQP*
Ga0070664_1000157326	3300005564	Corn Rhizosphere	MAIHRPRGGHYWYYWLVIIGGTILVIAFYATDGFGLQP*
Ga0066654_102768902	3300005587	Soil	MAIHKGRSGAGTYWYYWLVIVGGTIFVIAAYATDMFGLKP*
Ga0068866_10000003146	3300005718	Miscanthus Rhizosphere	MAIHKPSGGLYWRYWAILIGGSAFVVAYLLTDGFGLQP*
Ga0068866_105227592	3300005718	Miscanthus Rhizosphere	VTIHRQRGGRYWYYWVIIVGGLAFVIAYYATDGFGLSP*
Ga0068861_1018669262	3300005719	Switchgrass Rhizosphere	MTIHKPRGGHYWRYRVVLIGGSAFVVAYLITDGFGLRP*
Ga0068863_1001989223	3300005841	Switchgrass Rhizosphere	MAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGISR*
Ga0068858_1000884544	3300005842	Switchgrass Rhizosphere	MAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGIAR*
Ga0068860_1017247992	3300005843	Switchgrass Rhizosphere	MAIHRPRGGHYWRYWLVLIGGGTFVIAYLLTGGFGLQP*
Ga0081455_101881313	3300005937	Tabebuia Heterophylla Rhizosphere	MTIHKQRGGRYWYYWLVIIGGTIFVIAAVATDMFGLGGSY*
Ga0081455_104230122	3300005937	Tabebuia Heterophylla Rhizosphere	MTIHRQRGGRYWYYWVIIIGGTAFVIAAIATDMFGLGGGY*
Ga0081455_104840382	3300005937	Tabebuia Heterophylla Rhizosphere	MTIHKQRGGRYWYYWVLIIGGAIFVIAALATDMFGLGGY*
Ga0081539_100160272	3300005985	Tabebuia Heterophylla Rhizosphere	MTTHKQRGGRYWYYWVVIVGGTLFVIAYFASDGFGLGS*
Ga0075365_100361833	3300006038	Populus Endosphere	VAIHPQRGGRYWYYWVLIVGGLVFVIAYYATDGFGLG*
Ga0075365_101595262	3300006038	Populus Endosphere	MTIHKRRLDGYWHYWVIIVGGVLFVIAYYATDGFGLA*
Ga0075365_103810092	3300006038	Populus Endosphere	MTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLAP*
Ga0075365_110430642	3300006038	Populus Endosphere	MAIHPQRGGRYWYYWVLIVGGLVFVIAYYATDGFGLG*
Ga0066652_1000141974	3300006046	Soil	VTIHRQRGGRYWYYWVVLVGGVLFVVAFYATDGFGLSP*
Ga0066652_1003666452	3300006046	Soil	VTIHAQRGGRYWHYWVIIVGGLAFVIAAYATDGFGTGAV*
Ga0066652_1003827312	3300006046	Soil	MTIHKQRGGRYWYYWVIIVGGTIFVIAAYATDMFGLKP*
Ga0066652_1005101622	3300006046	Soil	MAIHRQRGGTYWYYWLIIVGGTILVIAAYATDMFGLQP*
Ga0066652_1005773222	3300006046	Soil	VTIHNQRGGRYWYYWAVIVGGLVFVAAYYASDGFGLSP*
Ga0082021_10989682	3300006092	Wastewater Treatment Plant	MAIHPQRGGRYWYYWVLIVGGAIFVIAYYATDGFGLAA*
Ga0070716_1006600412	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MTIHKQRGGRYWYYWLIIVGGILFVVAYYASDGFGLKP*
Ga0070716_1006975952	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	AGQRLTMAIHRPRGGHYWRYWLVLIGGSAFVIAYLLTDGFGLQP*
Ga0070712_1009491032	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	PRRPQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0070712_1010682312	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	VAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP*
Ga0075367_105232342	3300006178	Populus Endosphere	MTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP*
Ga0097621_1010325442	3300006237	Miscanthus Rhizosphere	MAIHRPRGGHYWYYWLIIVGGTIFVIAYYATDGFGLQP*
Ga0074055_111967432	3300006573	Soil	MAIHKQRGGRYWYYWLIIVGGIVFVIAYYASGGFGLRP*
Ga0074049_118508862	3300006580	Soil	VAIHKRRGGGYWYYWLVIVAGTIFVVAFYATDGFGLRP*
Ga0074062_116347832	3300006606	Soil	VAIHKRRGGGYWYYWLVIVAGTIFVIAFYATDGFGLRR*
Ga0079221_109135072	3300006804	Agricultural Soil	HRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP*
Ga0079220_105533362	3300006806	Agricultural Soil	VAIHKRRGGGYWYYWLVIVGGILFVIAYYATDGFGLKP*
Ga0075425_1010658453	3300006854	Populus Rhizosphere	MTIHRQRGGRYWYYWVVIFGGIAFVIAYFATDGFGLAP*
Ga0075434_1000588773	3300006871	Populus Rhizosphere	MTIHRQRGGRYWYYWVIIVGGIAFVVAYYATDGFGLSP*
Ga0079219_100959032	3300006954	Agricultural Soil	MTIHRPRGGHYWRYWVVLIGGSAFVIAYLLTDGFGLRP*
Ga0075518_10526562	3300006972	Arctic Peat Soil	MAIHRQRGGRYWYYWVIIIGGTIFVIAYYASDGFGVTP*
Ga0105251_102408732	3300009011	Switchgrass Rhizosphere	AIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGISR*
Ga0066710_1002258072	3300009012	Grasslands Soil	VTIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAV
Ga0066710_1029404702	3300009012	Grasslands Soil	MTIHKQPGGSYWYYWVVIIGGIVFVVAYFATDGFGLAP
Ga0066709_1032044802	3300009137	Grasslands Soil	TIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAV*
Ga0114129_106173822	3300009147	Populus Rhizosphere	MTVHRQRGGRYWYYWVIILGGIAFVIAYYATDGFGLSP*
Ga0105243_106875272	3300009148	Miscanthus Rhizosphere	MAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLQP*
Ga0116216_103456921	3300009698	Peatlands Soil	MAIHKQRGGRYWYYWVVIIGGAALVIAYYLTNGFGAKP*
Ga0126307_102669312	3300009789	Serpentine Soil	MTIHRPRGGHYWYYWLVIVGGSVFVIAFYATDGFGLQP*
Ga0105072_11219232	3300009818	Groundwater Sand	VTIHRQRGGRYWYYWVFILGGTVFVIAALATDMFGLG*
Ga0126313_113366412	3300009840	Serpentine Soil	MTIHKQPGGRYWYYWAIILGGIAFAVAFYATDGFGLSP*
Ga0126313_114423312	3300009840	Serpentine Soil	MTIHKRRGGGYWYYWLVIVGGALFVIAYYATDGFGLQP*
Ga0126313_115284321	3300009840	Serpentine Soil	MAIHDQRGGRYWYYWLIIVGGTIFVIAYYASDGFGLGQ*
Ga0126313_118006632	3300009840	Serpentine Soil	MTIHRPRGGHYWYYWLVIVGGVVFVIAFYATDGFGLQP*
Ga0130016_106737271	3300009868	Wastewater	MTIHRQRGGRYWYYWVVIIGGLVLAIAFYATDGFGLAP*
Ga0131092_103551012	3300009870	Activated Sludge	MAIHRQRGGRYWYYWAIIIGGTIFVVVALATDMFGLGSGY*
Ga0131092_109651301	3300009870	Activated Sludge	MTIHRQRGGRYWYYWVVIIGGLAFAIAFYATDGFGLAT*
Ga0126305_105410482	3300010036	Serpentine Soil	MTIHRPRGGHYWYYWLVIVGGTIFVIAFYATDGFGLQP*
Ga0126315_102413712	3300010038	Serpentine Soil	VTIHKRRGGGYWYYWVIIIGGTALVIAYIATDGFGLSS*
Ga0126308_100046169	3300010040	Serpentine Soil	VTIHNRRGGGYWYYWLIIVGGIVFVIAALATDMFGLGSGY*
Ga0126312_1000213215	3300010041	Serpentine Soil	MTIHKQRGGRYWYYWLVIIGGSAFVIVALATDMFGLGSSY*
Ga0126312_100250425	3300010041	Serpentine Soil	VTIHKQRGGRYWYYWMAIVGGLVFVIAYYATDGFGLAP*
Ga0126312_111110522	3300010041	Serpentine Soil	VTIHRQRGGRYWYYWVVIIGGIAFVIAYYATDGFGLSG*
Ga0126312_111461022	3300010041	Serpentine Soil	VTIHKRRGGGYWYYWVIIVGGIAFVIAFYATDGFGLSP*
Ga0126314_108072932	3300010042	Serpentine Soil	MTIHRPRGGHYWYYWLVIIGGTIFVIAYYATDGFGLQP*
Ga0126380_110733411	3300010043	Tropical Forest Soil	ARRQAEMAIHQPRGGGYWYYWLILVGGIVLVIAYYASDGFGLKP*
Ga0126310_100015683	3300010044	Serpentine Soil	VTIHRQRAGRYWYYWLVILGGIALVVAVLAIDGFGLGY*
Ga0126319_11719522	3300010147	Soil	MTIHKQRYGRYWYYWVVIIGVIVFVVAYYASDGFGLQP*
Ga0126306_100854162	3300010166	Serpentine Soil	MTIHRPRGGHYWYYWLVIVGGTIFVIAFYATDGFGLQR*
Ga0134080_103388941	3300010333	Grasslands Soil	MTIHKQRGGTYWYYWVVIIGGTILVVAAYATDMFGLKP*
Ga0134063_101374482	3300010335	Grasslands Soil	MTIHKQRGGRYLYFWVIIVGGTIFVIAAYATDMFGLKP*
Ga0134062_103670382	3300010337	Grasslands Soil	LTIHKSRYGTYWYYWVIMIGGVAFVIAAYATNGFGTGAA*
Ga0134062_105609222	3300010337	Grasslands Soil	MTIHRGRSGAGRYWYYWVVIVGGTAFVIAAYATDMFGLKP*
Ga0134066_102812632	3300010364	Grasslands Soil	APGQHRQRVTIHRQRGGRYWYYWVVLVGGVLFVVAFYATDGFGLSP*
Ga0134128_106474473	3300010373	Terrestrial Soil	MAIHKRRGGGYWHYWVVIVGGTLFVFAYYLTDGFGLKP*
Ga0136449_1000333142	3300010379	Peatlands Soil	MAIHKQRGGRYWYYWVVIIGGTALVIAYYLTNGFGAKP*
Ga0134122_100757731	3300010400	Terrestrial Soil	MTIHKPRGGLYWRYWAVLIGGSAFVIAYLLTDGFGLQP*
Ga0134122_110591212	3300010400	Terrestrial Soil	VTIHKPRGGRYWYYWVLLIGGTIFVIAALATDMFGLGTY*
Ga0105246_102604593	3300011119	Miscanthus Rhizosphere	GDPRRPQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0105246_112457802	3300011119	Miscanthus Rhizosphere	MAIHRPRGGHYWYYWLVIIGGTVFVIAYYATDGFGLQP*
Ga0137364_100576542	3300012198	Vadose Zone Soil	MTIHKQRGGRYWYFWVIIVGGTIFVIAAYATDMFGLKP*
Ga0137364_105646972	3300012198	Vadose Zone Soil	MAIHRQRGGTYWYYWVIIVGGTILVVAAYATDMFGLKP*
Ga0137365_102504323	3300012201	Vadose Zone Soil	MAIHKQRGGRYWYYWLIIVGGTLFVIAYYATGGFGLKP*
Ga0137365_103974983	3300012201	Vadose Zone Soil	MTIHKQPGGRYWYYWVIIIGGAIFVIAAYATGYFGLKP*
Ga0137365_104062683	3300012201	Vadose Zone Soil	MTIHRRRGGGYWYYWLVIIGGVLFVIAYYATNGFGLAP*
Ga0137374_1000538411	3300012204	Vadose Zone Soil	VTIHKRRGGGYWYYSLIIVGGTVFVIAYFATDGFGLSP*
Ga0150985_1024025992	3300012212	Avena Fatua Rhizosphere	VAIHRPRGGHYWYYWLVIIGGTIFVIAFYATDGFGLQP
Ga0150985_1064434161	3300012212	Avena Fatua Rhizosphere	MAIHRPRGGHYWHYWLVIVGGTILVVAYYATDGFGLQP*
Ga0137372_109353452	3300012350	Vadose Zone Soil	MAIHKGKSGSGTYWYYWLVIVGGTIFVIAAYATDMFGLKP*
Ga0137369_100560795	3300012355	Vadose Zone Soil	VTIHKRRGGGYWYYWMIIVGGTVFVIAYFATDGFGLSP*
Ga0137371_108457421	3300012356	Vadose Zone Soil	MAIHKQRGGPYWYYWVVIVGGTIFVIAAYATDMFGLRP*
Ga0150984_1041238982	3300012469	Avena Fatua Rhizosphere	MAIHRPRGGHYRYYWLVIVGGTILVIAYYATDGFGLQP*
Ga0137407_123611312	3300012930	Vadose Zone Soil	GRVMTIHKRRGGGYWYYWVLLLGGTIFVITYIATDGFGMSP*
Ga0153915_127866732	3300012931	Freshwater Wetlands	MAIHKPRGGGYWYYWAIVVGGTIFVIAYFATDGFGLKP*
Ga0126375_117181071	3300012948	Tropical Forest Soil	MAIHRKRGGPYWYYWVVIVGGAIFVIAYYATDGFGLQP*
Ga0164300_100014555	3300012951	Soil	MAIHKQRGGRYWYYWVIIVGGILFVVAYYATDGFGLQP*
Ga0164299_103856562	3300012958	Soil	MAIHRQRGGRYWYYWLVIVGGTIFVIAYYLTDGFGLKP*
Ga0164302_106211822	3300012961	Soil	MTIHPQRGGRYWYYWVVIIGGIVFVVAYFATDGFGLAP*
Ga0164302_111683531	3300012961	Soil	MAIHRPRGGHYWYYWLVIVGGTIFVIAYYATDGFGLQP*
Ga0164308_108443921	3300012985	Soil	PQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0164304_104898692	3300012986	Soil	VAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0164307_102615643	3300012987	Soil	VAIHRRRGGGYWYYWLVIVGGTLFVIAYFATDGFGLKP*
Ga0164306_101700203	3300012988	Soil	MAIHKRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLKP*
Ga0164306_104946542	3300012988	Soil	VTIHRQPGGRYWYYWVIIVGGLAFVIAYYVTDGFGLSP*
Ga0164305_114984272	3300012989	Soil	VTIHRQRGGRYWYYWVIIVGGVAFVIAYYATDGFGLSP
Ga0164305_121771712	3300012989	Soil	VAIHRRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLSP*
Ga0157375_1000307015	3300013308	Miscanthus Rhizosphere	MAIHRQRGGRYWYYWLIIVGGTLFVIAYFASDGFGLQP*
Ga0120158_102627502	3300013772	Permafrost	VTIHRQRFGTYWYYWVIIVGGVIFVIAAYATNGFGTGAT*
Ga0075342_11889871	3300014320	Natural And Restored Wetlands	VAIHKRRGGGYWYYWLVIVGGTAFVIAYLVTDGFGLS
Ga0163163_133468312	3300014325	Switchgrass Rhizosphere	MAIHKQHGGRYWYYWLIIVAGIIFVIAYYASDGFGLKP*
Ga0157380_134765412	3300014326	Switchgrass Rhizosphere	MTIHKQRGGRYWYYWVLIIGGTIFVVAALATDMFGLGS
Ga0167653_10009358	3300015162	Glacier Forefield Soil	VTIHRPRYGTYWYYWVIIIGGVAFVVAAYATNGFGTGAV*
Ga0167631_10001124	3300015168	Glacier Forefield Soil	MTIHKTRFSGYWHYWLVIVVGIVFVIAYFASDGFGLQP*
Ga0132258_1000548719	3300015371	Arabidopsis Rhizosphere	MAIHRPRGGGYWYYWLIIVGGIVFVIAYYASDGFGLSP*
Ga0132258_100720599	3300015371	Arabidopsis Rhizosphere	MAIHRQRGGRYWCCWLIIVGGTIFVVLALATDMFGLGASP*
Ga0132258_101280127	3300015371	Arabidopsis Rhizosphere	MTIHKRRGGQYWYYWLVIVGGSIFVVAYYLTDGFGLQP*
Ga0132258_108221023	3300015371	Arabidopsis Rhizosphere	MTIHKPRGGLYWRYWAVLIGGSAFVVAYLLTDGFGLQP*
Ga0132258_130360862	3300015371	Arabidopsis Rhizosphere	MAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLRP*
Ga0132258_134678613	3300015371	Arabidopsis Rhizosphere	MTIHKQRGGRYWYYWVIIIGGTIFVIAALATDMFGL
Ga0134074_11385862	3300017657	Grasslands Soil	MTIHKQRGGRYWYYWVIIVGGTIFVIAAYATDMFGLKP
Ga0187776_101209912	3300017966	Tropical Peatland	MTIHRQRGGRYWCYWAMLIGGTIFVIAYFATDGFGLTP
Ga0190272_117122322	3300018429	Soil	VIHPQKGGRYWYYWLAIVGGTVFVIAALATDMFGTGG
Ga0190275_103127682	3300018432	Soil	MTIHPQRGGRYWYYWVLLVGGTIFVIAYYATDGFGRT
Ga0190275_116076422	3300018432	Soil	VIHPQRGGRYWYYWAVIIGGTIFVIVALATDMFGTGS
Ga0190275_117185822	3300018432	Soil	MTIHKQRGGTYWYLWLVIVGGTIFVIAALATDMFGLGA
Ga0190275_133208192	3300018432	Soil	VIHPQKGGRYWYYWAIIIGGTIFVIAAYATDMFGTGS
Ga0190268_109909802	3300018466	Soil	VTIHKQRGGRYWYYWVLIIGGTIFVIAALATDMFGLGSGY
Ga0190270_100448005	3300018469	Soil	VTIHKQRGGRYWYYWVLIIGGAIFVIAALATDMFGLGGY
Ga0190270_100885022	3300018469	Soil	VIHPQRGGRYWYYWVLIIGGTIFVVAALATDMFGTGN
Ga0190270_107505852	3300018469	Soil	VIHPQRGGRYWYYWSVIIGGTIFVIVALATDMFGTGS
Ga0190270_114934302	3300018469	Soil	VTIHRRRGGGYWYYWVLLIGGTIFVIAALATDMFGLGSY
Ga0190270_120018282	3300018469	Soil	PTTMTIHKQRGGRYWYYWLLIIGGTIFVIAALATDMFGLGGGY
Ga0190270_123071262	3300018469	Soil	VIHPQRGGRYWYYWVLIVGGTIFVIAALATDMFGTGS
Ga0190271_100581855	3300018481	Soil	VTIHKQRGGRYWYYWVLIVGGIIFVIAALATDMFGLGGY
Ga0190271_102022992	3300018481	Soil	VIHPQKGGRYWYYWVLIVGGTIFVIAALATDMFGTGY
Ga0190271_104728934	3300018481	Soil	VTIHKQRGGRYWYYWLVIIGGTIFVIAALATDMFGLGSS
Ga0190271_105167213	3300018481	Soil	VIHPQKGGRYWYYWVVIIGGAIFVIAALATDMFGLGST
Ga0066669_100557753	3300018482	Grasslands Soil	MTIHKQRGGRYWYFWVIIVGGTIFVIAAYATDMFGLKP
Ga0173479_103998692	3300019362	Soil	MAIHKRRGGGYWYYWVVIVGGALFVIAYYATDGFGLQP
Ga0190264_103217292	3300019377	Soil	MTIHKQRGGRYWYYWVLIIGGTIFVVVALATDMFGLGGGY
Ga0193731_10764412	3300020001	Soil	MAIHRQRGGRYWYYWAIIIGGTIFVIAYFASDGFGLQP
Ga0193699_103860902	3300021363	Soil	VAIHKQRGGRYWYYWLVIVGGTLFVIAFYATDGFGLQR
Ga0222622_107405592	3300022756	Groundwater Sediment	MTIHRQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS
Ga0247672_10728492	3300024187	Soil	MTIHKPRGGLYWRYWAVLIGGSAFVIAYLLTDGFGLQP
Ga0209817_10760292	3300025524	Arctic Peat Soil	MAIHRQRGGRYWYYWVIIIGGTIFVIAYYASDGFGVTP
Ga0209638_10736092	3300025725	Arctic Peat Soil	MAIHKQRGGRYWYYWAIIVAGTLFVIAYYATDGFGLTP
Ga0210144_10008334	3300025817	Natural And Restored Wetlands	MAIHSPPGGRYWYYWLVVVGGTIFVIAYYLTDGFGLKP
Ga0210144_10364492	3300025817	Natural And Restored Wetlands	MAIHRQRGGRYWYYWLVIIGGTAFVIAYLATDGFGLQP
Ga0210144_11100312	3300025817	Natural And Restored Wetlands	MAIHNPRGGRYWYYWLVVVGGTVFVIAYYLTDGFGLKP
Ga0207653_104127292	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MTIHRPRGGHYWRYWLILIGGSAFAVAYLLTDGFGLQP
Ga0207692_101298682	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MAIHQPRGGGYWYYWLIIVGGTLFVIAYYATDGFGLKP
Ga0207642_10000002398	3300025899	Miscanthus Rhizosphere	MAIHKPSGGLYWRYWAILIGGSAFVVAYLLTDGFGLQP
Ga0207642_107492292	3300025899	Miscanthus Rhizosphere	VTIHRQRGGRYWYYWVIIVGGLAFVIAYYATDGFGLSP
Ga0207710_107228502	3300025900	Switchgrass Rhizosphere	MAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGIAR
Ga0207693_104270692	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	VAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP
Ga0207663_100051187	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MTIHRPRGGHYWRYWAVLIGGTAFVLAYLLTDGFGLQP
Ga0207649_102010052	3300025920	Corn Rhizosphere	MAIHRPRGGHYWYYWLVIIGGTILVIAFYATDGFGLQP
Ga0207664_100305904	3300025929	Agricultural Soil	MAIHRRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLKP
Ga0207686_111331592	3300025934	Miscanthus Rhizosphere	MAIHRPRGGHYWYYWLVIVGGTILVIAYYATDGFGLQP
Ga0207669_101985542	3300025937	Miscanthus Rhizosphere	MAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLQP
Ga0207669_112297041	3300025937	Miscanthus Rhizosphere	HKRRGGGYWYYWLLLIGGTIFVIAALLTDGFGTGAGY
Ga0207667_112395892	3300025949	Corn Rhizosphere	MTIHKPRGGLYWRYWAVLIAGSAFVIAYLLTDGFGLQP
Ga0207668_104819693	3300025972	Switchgrass Rhizosphere	MAIHKQRGGRYWYYWAIIIAGTIFVIAYYATDGFGLTP
Ga0207648_100006437	3300026089	Miscanthus Rhizosphere	MTIHKPRGGHYWRYRVVLIGGSAFVVAYLITDGFGLRP
Ga0207683_105083602	3300026121	Miscanthus Rhizosphere	MAIHKPRGGLYWRYWAILIGGGAFVIAYLLTDGFGLQP
Ga0209647_100000733	3300026319	Grasslands Soil	MAIHKQRGGRYWYYWLIIVGGTLFVIAYFATDGFGLRP
Ga0209647_10684433	3300026319	Grasslands Soil	MAIHKQRGGRYWYYWLIIVGGTLFVIAYYATEGFGLAP
Ga0208525_10214482	3300027288	Soil	MAIHRPRGGGYWYYWLIIVAGTVFVIAYFATDGFGLKP
Ga0209887_10154623	3300027561	Groundwater Sand	VTIHRQRGGRYWYYWVFILGGTVFVIAALATDMFGLG
Ga0209177_100637752	3300027775	Agricultural Soil	MTIHRPRGGHYWRYWVVLIGGSAFVIAYLLTDGFGLRP
Ga0209023_100143994	3300027870	Freshwater And Sediment	MTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLTP
Ga0268264_100231938	3300028381	Switchgrass Rhizosphere	MAIHRPRGGHYWRYWLVLIGGGTFVIAYLLTGGFGLQP
Ga0265337_100003421	3300028556	Rhizosphere	MAIHKQRGGSYWYYWLIIVGGTIFVIAYFATDGFGLTP
Ga0307291_10639152	3300028707	Soil	VTIHKQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS
Ga0307322_102197382	3300028710	Soil	MAIHKPRGGHYWYYWLIILGGTAFVIAFYATDGFGLQP
Ga0307303_101023871	3300028713	Soil	HRQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS
Ga0307297_103431672	3300028754	Soil	MAIHPQRGGRYWYYWVLLIGGTIFVIAYYATDGFGLAV
Ga0307316_100010673	3300028755	Soil	MAIHKQPGGRYWYYWLIIVGGTIFVVAYYASDGFGLAK
Ga0307316_100066114	3300028755	Soil	MTIHRQRGGSYWYYWVVIIGGTAFVIAAFATDMFGMGS
Ga0307280_102452252	3300028768	Soil	MAIHRPRGGHYWYYWLVIIGGTIFVIAYYATDGFGLQP
Ga0307282_102150362	3300028784	Soil	VAIHRQRGGGYWYYWLVIVGGIVFVIAFYATDGFGLQP
Ga0307282_105459112	3300028784	Soil	MAIHKGRSGAGRYWYYWVVIVGGTAFVIAAYATDMFGLKP
Ga0307323_102355881	3300028787	Soil	MAIRKQRGGGYWYYWLVIVGGIAFVIAFYATNGFGLQP
Ga0307299_101017813	3300028793	Soil	MTIHRQRGCRYWYYWVIIIGGTAFVIAAFATDMFGMGS
Ga0307503_1000004835	3300028802	Soil	MAIHRPRGGHYWRYWLILIGGSAFVIAYLLTDGFGLQP
Ga0307278_100689952	3300028878	Soil	MTIHKRRGGGYWYYWVLLIGGTIFVIAYLSTDGFGLSP
Ga0307278_101435944	3300028878	Soil	VTIHKQPGGRYWYYWVIIIGGVALLIAYYATRGFGLSP
Ga0311336_116592652	3300029990	Fen	MAIHKQRGGRYWYYWLVIVGGTIFVIAYVATDGFGLKQ
Ga0308187_103720762	3300031114	Soil	MTIHRQRGGRYWYYWVVIIGGTAFVIAAFATDMFGMGS
Ga0307495_101270652	3300031199	Soil	MTIHKRRGGPYWYYWLVIIGGTVFVIAYYLTDGFGVKP
Ga0299914_101796201	3300031228	Soil	MTVHKRRGGGYWYYWVFLIGGAIFVIAYLITGGFGLGV
Ga0299914_107837452	3300031228	Soil	MTIHKQRGGRYWYYWVVIIGGIVFVVAALATDMFGLGTY
Ga0299913_100373483	3300031229	Soil	MTIHRQRGGRYWYYWVLIIGGIVFLVAALATDMFGLDYY
Ga0299913_104454842	3300031229	Soil	VTIHRQRGGRYWYYWVLLIGGTIFVIAALATDMFGLGGY
Ga0315553_100447963	3300031652	Salt Marsh Sediment	MAIHKPRRGRYWYYWLVIVGGTLFVIAYIVTDSFGLKP
Ga0307416_1022524181	3300032002	Rhizosphere	MTIHRQRGGRYWYYWVIIVGGTAFVIAAIATDMFGLGSGY
Ga0311301_1002196612	3300032160	Peatlands Soil	MAIHKQRGGRYWYYWVVIIGGTALVIAYYLTNGFGAKP
Ga0307471_1022194462	3300032180	Hardwood Forest Soil	MTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSPLASGAT
Ga0326726_105575482	3300033433	Peat Soil	MAIHKRRGGGYWYYWLVIVGGIVFVIAFYATEGFGLQP
Ga0334935_017946_1268_1384	3300034781	Biocrust	MTIHKQRGGRYWYYWVLIVGGALFVIAYYATEGFGLAP
Ga0334935_073195_557_673	3300034781	Biocrust	MTIHKQRGGRYWYYWVLIVGGIFFVIAYYATDGFGLAP