| Basic Information | |
|---|---|
| Family ID | F022242 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 215 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAL |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 215 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.52 % |
| % of genes near scaffold ends (potentially truncated) | 63.26 % |
| % of genes from short scaffolds (< 2000 bps) | 60.93 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.465 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.488 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.023 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.326 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 22.06% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 215 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 8.37 |
| PF13673 | Acetyltransf_10 | 6.51 |
| PF05960 | DUF885 | 4.65 |
| PF13091 | PLDc_2 | 2.79 |
| PF04672 | Methyltransf_19 | 2.79 |
| PF00583 | Acetyltransf_1 | 2.33 |
| PF03795 | YCII | 1.86 |
| PF13472 | Lipase_GDSL_2 | 1.86 |
| PF02037 | SAP | 1.86 |
| PF01906 | YbjQ_1 | 1.86 |
| PF02567 | PhzC-PhzF | 1.40 |
| PF12850 | Metallophos_2 | 1.40 |
| PF00378 | ECH_1 | 1.40 |
| PF07992 | Pyr_redox_2 | 1.40 |
| PF08281 | Sigma70_r4_2 | 1.40 |
| PF02852 | Pyr_redox_dim | 1.40 |
| PF13360 | PQQ_2 | 0.93 |
| PF10009 | DUF2252 | 0.93 |
| PF07282 | OrfB_Zn_ribbon | 0.93 |
| PF00291 | PALP | 0.93 |
| PF00248 | Aldo_ket_red | 0.93 |
| PF05199 | GMC_oxred_C | 0.93 |
| PF04229 | GrpB | 0.93 |
| PF04542 | Sigma70_r2 | 0.93 |
| PF00196 | GerE | 0.93 |
| PF02627 | CMD | 0.93 |
| PF07719 | TPR_2 | 0.47 |
| PF13411 | MerR_1 | 0.47 |
| PF13469 | Sulfotransfer_3 | 0.47 |
| PF13649 | Methyltransf_25 | 0.47 |
| PF00753 | Lactamase_B | 0.47 |
| PF00698 | Acyl_transf_1 | 0.47 |
| PF07883 | Cupin_2 | 0.47 |
| PF11706 | zf-CGNR | 0.47 |
| PF07730 | HisKA_3 | 0.47 |
| PF02861 | Clp_N | 0.47 |
| PF12697 | Abhydrolase_6 | 0.47 |
| PF07690 | MFS_1 | 0.47 |
| PF01047 | MarR | 0.47 |
| PF04402 | SIMPL | 0.47 |
| PF10604 | Polyketide_cyc2 | 0.47 |
| PF01527 | HTH_Tnp_1 | 0.47 |
| PF03625 | DUF302 | 0.47 |
| PF13302 | Acetyltransf_3 | 0.47 |
| PF01925 | TauE | 0.47 |
| PF13462 | Thioredoxin_4 | 0.47 |
| PF00282 | Pyridoxal_deC | 0.47 |
| PF12323 | HTH_OrfB_IS605 | 0.47 |
| PF13602 | ADH_zinc_N_2 | 0.47 |
| PF00440 | TetR_N | 0.47 |
| PF00903 | Glyoxalase | 0.47 |
| PF07944 | Glyco_hydro_127 | 0.47 |
| PF01526 | DDE_Tnp_Tn3 | 0.47 |
| PF02371 | Transposase_20 | 0.47 |
| PF04389 | Peptidase_M28 | 0.47 |
| PF13006 | Nterm_IS4 | 0.47 |
| PF00067 | p450 | 0.47 |
| PF03965 | Penicillinase_R | 0.47 |
| PF01348 | Intron_maturas2 | 0.47 |
| PF00498 | FHA | 0.47 |
| PF07702 | UTRA | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 8.37 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 4.65 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.86 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 1.86 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.40 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.93 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.93 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.93 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.93 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.93 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.93 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.93 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.47 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.47 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.47 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.47 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.47 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.47 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.47 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.47 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.47 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.47 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.47 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.47 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.47 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.47 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.47 % |
| Unclassified | root | N/A | 39.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002910|JGI25615J43890_1019130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1128 | Open in IMG/M |
| 3300004082|Ga0062384_100351600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 933 | Open in IMG/M |
| 3300005163|Ga0066823_10112634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis | 570 | Open in IMG/M |
| 3300005436|Ga0070713_102359668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300005440|Ga0070705_101181469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya | 629 | Open in IMG/M |
| 3300005543|Ga0070672_100863773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 798 | Open in IMG/M |
| 3300005564|Ga0070664_102122388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300005602|Ga0070762_10946247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300005615|Ga0070702_100882823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300005764|Ga0066903_101251171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1382 | Open in IMG/M |
| 3300005921|Ga0070766_10753304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300006046|Ga0066652_100563361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1069 | Open in IMG/M |
| 3300006175|Ga0070712_100612567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 922 | Open in IMG/M |
| 3300006606|Ga0074062_12664309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis | 663 | Open in IMG/M |
| 3300006871|Ga0075434_102212813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis | 553 | Open in IMG/M |
| 3300009088|Ga0099830_11021351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300009089|Ga0099828_10848840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 817 | Open in IMG/M |
| 3300009098|Ga0105245_10059032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3454 | Open in IMG/M |
| 3300009101|Ga0105247_10203709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita → Nakamurella multipartita DSM 44233 | 1331 | Open in IMG/M |
| 3300009147|Ga0114129_12179911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300009174|Ga0105241_10219889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1596 | Open in IMG/M |
| 3300009698|Ga0116216_10501728 | Not Available | 734 | Open in IMG/M |
| 3300009700|Ga0116217_10540897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300009824|Ga0116219_10180965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1211 | Open in IMG/M |
| 3300009839|Ga0116223_10635972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300010046|Ga0126384_10036767 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
| 3300010048|Ga0126373_12247754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300010358|Ga0126370_10662302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 911 | Open in IMG/M |
| 3300010360|Ga0126372_10423451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1224 | Open in IMG/M |
| 3300010360|Ga0126372_11501254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 710 | Open in IMG/M |
| 3300010361|Ga0126378_10394021 | Not Available | 1497 | Open in IMG/M |
| 3300010361|Ga0126378_13402865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300010366|Ga0126379_10374869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1462 | Open in IMG/M |
| 3300010366|Ga0126379_10966185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea diastatica | 956 | Open in IMG/M |
| 3300010366|Ga0126379_11840092 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300010398|Ga0126383_10676558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
| 3300012207|Ga0137381_10366860 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300012209|Ga0137379_10511533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → unclassified Streptomycetaceae → Streptomycetaceae bacterium MP113-05 | 1109 | Open in IMG/M |
| 3300012360|Ga0137375_10142834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2352 | Open in IMG/M |
| 3300014969|Ga0157376_11240040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
| 3300015245|Ga0137409_10888002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 727 | Open in IMG/M |
| 3300016357|Ga0182032_11885730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300016371|Ga0182034_10663472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300017944|Ga0187786_10273592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis | 680 | Open in IMG/M |
| 3300017959|Ga0187779_10051751 | Not Available | 2396 | Open in IMG/M |
| 3300017959|Ga0187779_10072853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. ATCC PTA-5024 | 2031 | Open in IMG/M |
| 3300017972|Ga0187781_11033336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300017974|Ga0187777_11491161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani | 501 | Open in IMG/M |
| 3300017995|Ga0187816_10322050 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300018013|Ga0187873_1219662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300018034|Ga0187863_10037873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2813 | Open in IMG/M |
| 3300018037|Ga0187883_10092958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani | 1571 | Open in IMG/M |
| 3300018038|Ga0187855_10875299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300020582|Ga0210395_11128212 | Not Available | 578 | Open in IMG/M |
| 3300020583|Ga0210401_10901641 | Not Available | 743 | Open in IMG/M |
| 3300021171|Ga0210405_10074806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2669 | Open in IMG/M |
| 3300021402|Ga0210385_10451346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
| 3300021420|Ga0210394_10353231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300021474|Ga0210390_10290569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1384 | Open in IMG/M |
| 3300021560|Ga0126371_12328231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya | 647 | Open in IMG/M |
| 3300021560|Ga0126371_12761769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis | 595 | Open in IMG/M |
| 3300024325|Ga0247678_1063669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300025507|Ga0208188_1029488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1518 | Open in IMG/M |
| 3300025885|Ga0207653_10040317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1531 | Open in IMG/M |
| 3300025898|Ga0207692_10223112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300025915|Ga0207693_10811612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300025916|Ga0207663_10346047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
| 3300025945|Ga0207679_11376716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300026078|Ga0207702_10437315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300026116|Ga0207674_10384970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita → Nakamurella multipartita DSM 44233 | 1356 | Open in IMG/M |
| 3300027692|Ga0209530_1123826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300027855|Ga0209693_10209836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 958 | Open in IMG/M |
| 3300027879|Ga0209169_10103976 | Not Available | 1470 | Open in IMG/M |
| 3300028775|Ga0302231_10110542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1147 | Open in IMG/M |
| 3300028784|Ga0307282_10215340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300029999|Ga0311339_10015198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11777 | Open in IMG/M |
| 3300029999|Ga0311339_10426673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1374 | Open in IMG/M |
| 3300030007|Ga0311338_11148456 | Not Available | 741 | Open in IMG/M |
| 3300030056|Ga0302181_10299310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300030494|Ga0310037_10274851 | Not Available | 724 | Open in IMG/M |
| 3300030524|Ga0311357_10725417 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300030580|Ga0311355_10495387 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300030617|Ga0311356_10881194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300030741|Ga0265459_12560934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 629 | Open in IMG/M |
| 3300031236|Ga0302324_100249761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2769 | Open in IMG/M |
| 3300031544|Ga0318534_10764884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 543 | Open in IMG/M |
| 3300031573|Ga0310915_10556784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
| 3300031640|Ga0318555_10392582 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300031668|Ga0318542_10059913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1755 | Open in IMG/M |
| 3300031679|Ga0318561_10615323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300031713|Ga0318496_10448921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300031713|Ga0318496_10532320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300031719|Ga0306917_10013015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4867 | Open in IMG/M |
| 3300031723|Ga0318493_10714241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300031736|Ga0318501_10728845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300031740|Ga0307468_100887633 | Not Available | 771 | Open in IMG/M |
| 3300031744|Ga0306918_10841789 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031747|Ga0318502_10797577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea diastatica | 572 | Open in IMG/M |
| 3300031751|Ga0318494_10335659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| 3300031765|Ga0318554_10255561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300031765|Ga0318554_10632405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300031765|Ga0318554_10663322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300031770|Ga0318521_10092533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1651 | Open in IMG/M |
| 3300031777|Ga0318543_10318058 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031778|Ga0318498_10080747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1467 | Open in IMG/M |
| 3300031778|Ga0318498_10451917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300031781|Ga0318547_10593347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
| 3300031793|Ga0318548_10481547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300031805|Ga0318497_10116924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1441 | Open in IMG/M |
| 3300031805|Ga0318497_10800290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300031823|Ga0307478_10414187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1117 | Open in IMG/M |
| 3300031832|Ga0318499_10411903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300031835|Ga0318517_10366851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300031846|Ga0318512_10192187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 996 | Open in IMG/M |
| 3300031859|Ga0318527_10232633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 783 | Open in IMG/M |
| 3300031860|Ga0318495_10473289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300031890|Ga0306925_10389286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1495 | Open in IMG/M |
| 3300031890|Ga0306925_11440600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300031894|Ga0318522_10226404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300031896|Ga0318551_10143940 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300031896|Ga0318551_10356817 | Not Available | 828 | Open in IMG/M |
| 3300031897|Ga0318520_10936731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300031912|Ga0306921_12390784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300031945|Ga0310913_11247082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300032008|Ga0318562_10168305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1265 | Open in IMG/M |
| 3300032008|Ga0318562_10367168 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300032008|Ga0318562_10469726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis | 730 | Open in IMG/M |
| 3300032052|Ga0318506_10242953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300032060|Ga0318505_10580807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea diastatica | 527 | Open in IMG/M |
| 3300032065|Ga0318513_10136396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1165 | Open in IMG/M |
| 3300032066|Ga0318514_10565183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
| 3300032067|Ga0318524_10056002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1888 | Open in IMG/M |
| 3300032261|Ga0306920_101773646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300032261|Ga0306920_102577385 | Not Available | 698 | Open in IMG/M |
| 3300032805|Ga0335078_10014770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11586 | Open in IMG/M |
| 3300032805|Ga0335078_12457664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300032828|Ga0335080_10819709 | Not Available | 960 | Open in IMG/M |
| 3300032896|Ga0335075_10422933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura fibrosa | 1404 | Open in IMG/M |
| 3300032897|Ga0335071_10470447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1209 | Open in IMG/M |
| 3300032955|Ga0335076_11349253 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300033134|Ga0335073_11154675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300033289|Ga0310914_11278695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya | 636 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.44% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.05% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.47% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.47% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00851260 | 2166559006 | Grass Soil | VDGLEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCFFAL |
| JGI25615J43890_10191301 | 3300002910 | Grasslands Soil | GFSLVSQADVDIWFRAPAGRVPDVLEIGLRGRRRPRVEAYWDGCLMAL* |
| Ga0062384_1003516001 | 3300004082 | Bog Forest Soil | AAGLDVWYRMPGGLRPDVLEIALHGKRRPRVEAYWDGCLYAL* |
| Ga0062594_1013089933 | 3300005093 | Soil | PAHVDGLEVWFRASAGRRPDVLEIGVRGRRHPRVEAYWDGCFFAL* |
| Ga0066823_101126342 | 3300005163 | Soil | ELWFRAPGGILPDVLEIGLHGRRRPRVEAYWDGCLFALGA* |
| Ga0070713_1023596682 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FELWFRAPGGIQPDVLEIGLRGSRRPRVEAYWDGCLFALGA* |
| Ga0070705_1011814692 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QTGQDGVEVWFRAPAGRMPDVLEIGLHGRRRPRVEAYWDGCRIAL* |
| Ga0070672_1008637733 | 3300005543 | Miscanthus Rhizosphere | GLPGFTEVPAAGFELWFRAPGGIQPHVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0070664_1021223882 | 3300005564 | Corn Rhizosphere | FTRIPVAGLELWFRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGV* |
| Ga0070762_109462471 | 3300005602 | Soil | AHTAGLEVWYRIPGDLRPDVLEIGLRGKRRPHVEAYWDGCIYAL* |
| Ga0070702_1008828231 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VEVWFRAPAGRVPDVLEIGLHGRRHPRVEAYWDGCRYAL* |
| Ga0066903_1012511711 | 3300005764 | Tropical Forest Soil | LMEIWFRAPGGRVPDVLEIGLRGRRRPRVEAYWDGCLIAL* |
| Ga0070766_106082862 | 3300005921 | Soil | RIPAGRLPDVLEIGLRGKRHPRVEAYWDGCTYAL* |
| Ga0070766_107533041 | 3300005921 | Soil | PDRFSPAHTAGLQVWYRIPGGRRPDVLEIGVRGKRRPHVEAYWDGCIYAL* |
| Ga0066652_1005633611 | 3300006046 | Soil | GLELWFRAPGGVTPDVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0075017_1016226872 | 3300006059 | Watersheds | PAHSADLEVWFRAPAGRMPDVLEIEMRGRRHPRVEAYWDGCAYAL* |
| Ga0075015_1007163813 | 3300006102 | Watersheds | FNPAHSDGLEVWFRAPAGRTPDVLEIGIRGRRHPRVEAYWDGCAFAL* |
| Ga0070712_1006125671 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AQAGDERPGVWFRAPAGRVPDVLEIGLRGRRRPQVEAYWDGCRYAL* |
| Ga0074062_126643091 | 3300006606 | Soil | QVPAAGLELWFRAPGGILPDVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0075434_1022128132 | 3300006871 | Populus Rhizosphere | PGGIQPDVLEIGLRGSRRPRVEAYWDGCLFALGA* |
| Ga0099830_110213512 | 3300009088 | Vadose Zone Soil | GMEIWFRAPAGRVPDVLEVGLHGRRKPRVEAYWDGCLIAL* |
| Ga0099828_103670421 | 3300009089 | Vadose Zone Soil | PADSDGLEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCAYAL* |
| Ga0099828_108488401 | 3300009089 | Vadose Zone Soil | FRAPAGRVPDVLEIGLRGRRRPRVEAYWDGCLMAL* |
| Ga0105245_100590321 | 3300009098 | Miscanthus Rhizosphere | LPGFTEVPAAGFELWFRAPGGIQPHVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0105247_102037092 | 3300009101 | Switchgrass Rhizosphere | VAGLELWFRALAGVHPDVLEIVVRGKRRPRVEAYWDGCLFALGV* |
| Ga0114129_121799111 | 3300009147 | Populus Rhizosphere | GLPGFTQVPAAAFELWFRAPGGIQPDVLEIGLRGSRRPRVEAYWDGCLFALGA* |
| Ga0105241_102198892 | 3300009174 | Corn Rhizosphere | VAGLELWFRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGV* |
| Ga0116221_10472321 | 3300009523 | Peatlands Soil | SDGLDVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFVL* |
| Ga0116221_14132651 | 3300009523 | Peatlands Soil | SDGLDVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFAL* |
| Ga0116225_13302371 | 3300009524 | Peatlands Soil | DVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCAFAL* |
| Ga0116216_101213781 | 3300009698 | Peatlands Soil | DGLEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFAL* |
| Ga0116216_105017281 | 3300009698 | Peatlands Soil | AGGLEIWFRAPGGRVPDVLEIAMKGKRHPHVEAFWDGCSYML* |
| Ga0116216_109015872 | 3300009698 | Peatlands Soil | LEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFAL* |
| Ga0116217_105408972 | 3300009700 | Peatlands Soil | RAPAGPHPDVLEIGLRGKRHPRVEAYWDGCLFALGA* |
| Ga0116219_101504953 | 3300009824 | Peatlands Soil | WFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFVL* |
| Ga0116219_101809652 | 3300009824 | Peatlands Soil | LAADGVEVRFRRFGSRDPEVLQIALRGRRRPRLEAYWDGCLYAT* |
| Ga0116223_106359721 | 3300009839 | Peatlands Soil | RIPGGRRPDVLEIGLRGKRRPRVEAYWDGCFYAL* |
| Ga0126384_100367672 | 3300010046 | Tropical Forest Soil | VSQTGVEVWFRAPAGRLPDVLKVGLRGRRRPRVEADWDGCRIAL* |
| Ga0126373_122477541 | 3300010048 | Tropical Forest Soil | QDGVEVWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRIAL* |
| Ga0134064_104549441 | 3300010325 | Grasslands Soil | HVDGLEVWFRAAAGRMPDVLEIGVRGRRHPRVEAYWDGCSFAL* |
| Ga0134063_107505332 | 3300010335 | Grasslands Soil | AHADGLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCSFAV* |
| Ga0126370_106623021 | 3300010358 | Tropical Forest Soil | SRLPEAELTGVEVLFRAPGGRMPEFLEIDLRGRRHPRVEAYWEGCLMAL* |
| Ga0126376_109817583 | 3300010359 | Tropical Forest Soil | SPAPAGLEIWFRAPAGRLPEVLEIEMRGRRRPRVEAYWDGCVIAL* |
| Ga0126372_100654541 | 3300010360 | Tropical Forest Soil | ELWFRTPAGRMPDVLEIGVRGRRHPRVEAYWDGCSFVL* |
| Ga0126372_104234513 | 3300010360 | Tropical Forest Soil | PGGNLPDVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0126372_115012541 | 3300010360 | Tropical Forest Soil | IWFRAPAGRVPDVLEIGVRGRRRPRVEAYWDGCLIAL* |
| Ga0126378_103940213 | 3300010361 | Tropical Forest Soil | ATEAPPGLTGFTQVPAAGLELWFRAPGGIVPDVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0126378_109105012 | 3300010361 | Tropical Forest Soil | VAHPELEIWFRAPGDREPDVLEVGMHGRRHPKVEAYWDGCLIAL* |
| Ga0126378_134028652 | 3300010361 | Tropical Forest Soil | ARVPATGLELWFRAPAGTRPEILEIGLRGRRHPRVEAYWDGCLFALNG* |
| Ga0126379_103748691 | 3300010366 | Tropical Forest Soil | SLVPHDLMEIWFRAPGGRVPDVLEIGLRGRRRPRVEAYWDGCLIAL* |
| Ga0126379_109661851 | 3300010366 | Tropical Forest Soil | ELWGFVPVPVEGLELWFRAPAGTGPDVLEIGLRGRRRPRVEAYWDGCLFALTV* |
| Ga0126379_118400921 | 3300010366 | Tropical Forest Soil | VQAAGIEVFFRPRAGRFPEVLEIGLRGKRRPRVEAYWDGLRIAL* |
| Ga0136449_1001314168 | 3300010379 | Peatlands Soil | FHPALSDGLEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFAL* |
| Ga0136449_1017197002 | 3300010379 | Peatlands Soil | RAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFAL* |
| Ga0136449_1025898983 | 3300010379 | Peatlands Soil | FRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFAL* |
| Ga0126383_106765583 | 3300010398 | Tropical Forest Soil | FRAPGGNLPDVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0137380_101049261 | 3300012206 | Vadose Zone Soil | AHVDGLEVWFRASAGRMPDVLEIAVRGRRHPRVEAYWDGCSFVL* |
| Ga0137381_103668603 | 3300012207 | Vadose Zone Soil | WPGFNPVHAEGLEVWFRGPAGRMPDVLEIGLRGRRHPRVDAYWDSCSFAW* |
| Ga0137381_109473173 | 3300012207 | Vadose Zone Soil | AHVDGLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCSFAL* |
| Ga0137379_105115334 | 3300012209 | Vadose Zone Soil | VEIWFRAPAGRVPDVLEIGLRGRRRPRVEAYWDGCLIAL* |
| Ga0137384_101202575 | 3300012357 | Vadose Zone Soil | RAPAGRMPDVLEIGMRGRRHPRIEAYWDGCTFAL* |
| Ga0137384_115761332 | 3300012357 | Vadose Zone Soil | VPGAPAGLEIWFRAPAGRFPDMLEIAMRGKRRPRIEAYWDGCSIAL* |
| Ga0137375_101428341 | 3300012360 | Vadose Zone Soil | RLVPQTGQDGVEVWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRIAL* |
| Ga0137390_100460621 | 3300012363 | Vadose Zone Soil | IWFRAPAGRMPDVLEIGLHGKRRPRVGAYWDGCSIAL* |
| Ga0137390_102486582 | 3300012363 | Vadose Zone Soil | FSPADSDGLEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCAYAL* |
| Ga0157376_112400402 | 3300014969 | Miscanthus Rhizosphere | AGLELWFRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGV* |
| Ga0137409_108880022 | 3300015245 | Vadose Zone Soil | GLSGFTRVPAAGLELWFRAPGGILPDVLEIGLRGRRRPRVEAYWDGCLFALGA* |
| Ga0182032_118857302 | 3300016357 | Soil | GLDIWFRAPAGTLPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0182034_106634723 | 3300016371 | Soil | GKDGVEVWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCLIAL |
| Ga0187786_102735922 | 3300017944 | Tropical Peatland | GLELWFRAPGGFLPDVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0187779_100517514 | 3300017959 | Tropical Peatland | GLELWFRAPAGLGPDVLEIGLRGRRHPRVEAYWDGCLFALTA |
| Ga0187779_100728533 | 3300017959 | Tropical Peatland | GFSPVSSAGLDVWFRLPSGQLPDVLEIGLHGKRHPRVEAYWDGCSFAL |
| Ga0187781_110333362 | 3300017972 | Tropical Peatland | VDADGLEIWFRAPGGRVPDVLEIALKGKRRPHVEAYWDGCSYML |
| Ga0187777_114911611 | 3300017974 | Tropical Peatland | EVSPAGLDVWYRIPGGRRPDVLEIGVRGKRRPRVEAYWDGCSFALLEPVWN |
| Ga0187816_103220501 | 3300017995 | Freshwater Sediment | FSLVSQVGVEIWFRAPAGRLPDVLEIGLHGRRHPRVEAYWDGCQFVL |
| Ga0187873_12196621 | 3300018013 | Peatland | VARLELWFRAPAGPHPDVLEIGLRGKRHPRVEAYWDGCLFALGA |
| Ga0187863_100378731 | 3300018034 | Peatland | FRAPAGPHPDVLEIGLRGKRHPRVEAYWDGCLFALGA |
| Ga0187883_100929582 | 3300018037 | Peatland | RAPAGPHPDVLEIGLRGKRHPRVEAYWDGCLFALGA |
| Ga0187855_108752991 | 3300018038 | Peatland | TAGLEVWYRMPGSRRPEVLEIGLHGKRRPRVEAYWDGCLYAL |
| Ga0187784_115544082 | 3300018062 | Tropical Peatland | DTDGLEVWFRAPGGRLPDVLEIALKGKRRPRVEAFWDGCAYML |
| Ga0187769_108762912 | 3300018086 | Tropical Peatland | SPGLDVWFRIPAGRAPDVLEIVLRGKRHPRVEAYWDGCIYAL |
| Ga0206354_113279511 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCYFAL |
| Ga0210395_103679983 | 3300020582 | Soil | WFRAPGERRPDVLEIGLAGRRRARVEAYWDGCLMAM |
| Ga0210395_111282121 | 3300020582 | Soil | DRFSPAHTAGLQVWYRIPGGRRPDVLEIGVRGKRRPHVEAYWDGCIYAL |
| Ga0210401_109016411 | 3300020583 | Soil | SPAHTAGLQVWYRIPGGRRPDVLEIGVRGKRRPHVEAYWDGCIYAL |
| Ga0210405_100748064 | 3300021171 | Soil | QVWYRIPGGRRPDVLEIGVRGKRRPHVEAYWDGCVYAL |
| Ga0210408_108145662 | 3300021178 | Soil | PAHADGLELWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAV |
| Ga0210385_104513462 | 3300021402 | Soil | PAHTAGLEVWYRIPGDRRPDVLEVEVRGKRRPHVEAYWDGCIYAL |
| Ga0210383_104717952 | 3300021407 | Soil | SLEVWFRAPAGRMPDVLEIGIRGRRHPRVEAYWDGCAFAL |
| Ga0210394_103532311 | 3300021420 | Soil | TQVPAAGLELWFRAPGGILPDVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0210390_102905691 | 3300021474 | Soil | YRIPGGRRPDVLEIGVRGKRRPHVEAYWDGCIYAL |
| Ga0210392_110239852 | 3300021475 | Soil | WFRAPAGRMPDVLEIGARGRRHPRAEAYWDGCYFAM |
| Ga0210398_116059471 | 3300021477 | Soil | WFRAPGGRLPDFLEIELRGRRHPRVEAYWDGCSYAL |
| Ga0210402_101001324 | 3300021478 | Soil | DSLEVWFRAPAGRMPDVLEIGIRGRRHPRVEAYWDGCAFAL |
| Ga0126371_123282312 | 3300021560 | Tropical Forest Soil | FRAPAGRVPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0126371_127617691 | 3300021560 | Tropical Forest Soil | PAAGLELWFRAPGGIMPDVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0179589_105445802 | 3300024288 | Vadose Zone Soil | EVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCYFAL |
| Ga0247678_10636691 | 3300024325 | Soil | GVEVWFRAPAGRVPDVLEIGLHGRRHPRVEAYWDGCRYAL |
| Ga0208188_10294884 | 3300025507 | Peatland | FRSVPGAGLELSFRGLGDRQPDVLEIGLRGRRRPRVEAYWDGCVLAL |
| Ga0207653_100403171 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | TAAGFELWFRAPGGIQPHVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0207692_102231121 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGA |
| Ga0207693_108116122 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FTRIPVAGLELWFRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGV |
| Ga0207663_103460471 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ELWFRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGA |
| Ga0207679_113767162 | 3300025945 | Corn Rhizosphere | FRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGV |
| Ga0207702_104373153 | 3300026078 | Corn Rhizosphere | FELWFRAPGGIQPHVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0207674_103849701 | 3300026116 | Corn Rhizosphere | AGLELWFRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLFALGV |
| Ga0209240_10721143 | 3300026304 | Grasslands Soil | GVEIWFRAAAGRMPDVLEIGLHGKRRPRVEAYWDGCSIAL |
| Ga0209333_11682782 | 3300027676 | Forest Soil | FSQVRSAGLDLWFRAPAGRRPDFLEIGLRGRRRPRVEAYWDGCSYVL |
| Ga0209530_11238261 | 3300027692 | Forest Soil | GFSPAHTDGLEVWYRMPGGRRPEVLEIGLHGKRRPRVEAYWDGCLYAL |
| Ga0209693_102098361 | 3300027855 | Soil | GLEVWYRIPGDLRPDVLEIGLRGKRRPHVEAYWDGCIYAL |
| Ga0209169_101039761 | 3300027879 | Soil | HALAAAPADLEIWFRAPAGRLPEVLEIGMRGRRRPRVEAYWDGCLFAL |
| Ga0209380_103672982 | 3300027889 | Soil | GLEVWFRAPGGRLPDFLEIELRGRRHPRVEAYWDGCSYAL |
| Ga0209415_108840371 | 3300027905 | Peatlands Soil | AGLEIWFRAPGGRLPDVLEVELRGRRHPRVEAYWDGCSYAL |
| Ga0302231_101105421 | 3300028775 | Palsa | TAGLEVWYRMPGGRRPEVLEIGLHGKRRPRVEAYWDGCLYAL |
| Ga0307282_102153401 | 3300028784 | Soil | GPPGFAQVPAAGFELWFRAPGGIQPDVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0311368_104755242 | 3300029882 | Palsa | QVLSSGLDLWFRAPADRLPDFLEIGLRGRRHPRVEAYWDGCSYVL |
| Ga0311339_100151981 | 3300029999 | Palsa | GLELWFRGRGEIVPDVLEIGLQGRRRPRIEAYWDGCLFALDG |
| Ga0311339_104266733 | 3300029999 | Palsa | TTPAADVSGFIPVRAASLDIWFRAPAGQQPDMLEIGMHGKRHPRVEAYWDGCLFAL |
| Ga0311338_111484562 | 3300030007 | Palsa | PVPTASLDIWFRAPAGQQPDVLEIGIHGKRHPRVEAYWDGCLFAL |
| Ga0302306_100600083 | 3300030043 | Palsa | RSAGVDLWFRAPAGRLPDFLEIGLRGRRHPRVEAYWDGCSYVL |
| Ga0302181_102993101 | 3300030056 | Palsa | IPVHTTGLDIWFRAPSGQQPDVLEIGMHGRRHPRVEAYWDGCLFAL |
| Ga0310037_102748511 | 3300030494 | Peatlands Soil | GLEIWFRAPGGRVPDVLEIAMKGKRHPHVEAFWDGCSYML |
| Ga0311372_129027532 | 3300030520 | Palsa | DLWFRAPAGRLPDFLEIGLRGRRHPRVEAYWDGCGYVL |
| Ga0311357_107254171 | 3300030524 | Palsa | LSGFTRVPVAGLELWFRRRGEVVPDVLEIGVRGKRRPRIEAYWDGCLFALDG |
| Ga0311355_104953871 | 3300030580 | Palsa | DLSGFTRVPVAGLELWFRRRGEVVPDVLEIGVRGKRRPRIEAYWDGCLFALDG |
| Ga0311356_108811942 | 3300030617 | Palsa | VWYRMPGGRRPEVLEIGLHGKRRPRVEAYWDGCLYAL |
| Ga0265459_125609341 | 3300030741 | Soil | SGFTRVPVAGLELWFRRRGEVVPEVLEIGIRGKRRPRIEAYWDGCLFALDG |
| Ga0265744_1079222 | 3300031017 | Soil | LEVWFRAPAGRMPDVLEIEMRGRRHPRVEAYWDGCTYAL |
| Ga0302324_1002497616 | 3300031236 | Palsa | PDLSGFTRVPVAGLELWFRRRGEVVPDVLEIGVRGKRRPRIEAYWDGCLFALDG |
| Ga0318534_107648841 | 3300031544 | Soil | FRPVPHDEVELWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRFAL |
| Ga0318571_103933741 | 3300031549 | Soil | FRVPAGAPPEVLEIGLRGRRRPRVEAYWDGCAFALSA |
| Ga0310915_105567841 | 3300031573 | Soil | FRLAPADGLDIWFRAPAGTLPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0318555_103925821 | 3300031640 | Soil | FRVPAGAPPEVLEIGLRGRRRPRVEAYWDGCLFALSA |
| Ga0318542_100599133 | 3300031668 | Soil | FAPVPAEGLELWFRAPAGPGPDVLEIGLRGRRRPRVEAYWDGCLFALTA |
| Ga0318561_106153231 | 3300031679 | Soil | RAGGLEVCFRGPAGRVPDVLEIGLRGRRRPKVEAYWDGCLFAL |
| Ga0318561_106794121 | 3300031679 | Soil | FSPVNSAGLDVWFRIPAGRLPDVLEIGLRGRRHPRVEAYWDGCAYAL |
| Ga0318496_101654813 | 3300031713 | Soil | FRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCSFAL |
| Ga0318496_104489212 | 3300031713 | Soil | HLAGLEVWYRIPGDRRPDVLEIGMRGKRRPRVEAYWDGCIYAL |
| Ga0318496_105323201 | 3300031713 | Soil | AGLEVWCRIPGVRRPDVLEIALRGRRRPRVEAYWDGCIYAL |
| Ga0306917_100130156 | 3300031719 | Soil | FSPVRLTGLDIWYRIPGGRRPDVLEIAMRSKRRPRIKAYWDGCVYAL |
| Ga0318493_107142411 | 3300031723 | Soil | VEIWFRVPAGRVPDVLEIGVRGRRRPRVEAYWDGCLIAL |
| Ga0318501_107288452 | 3300031736 | Soil | LEVWCRIPGVRRPDVLEIALRGRRRPRVEAYWDGCIYAL |
| Ga0307468_1008876331 | 3300031740 | Hardwood Forest Soil | IPVAGLELWFRALAGVHPDVLEIGVRGKRRPRVEAYWDGCLYALGA |
| Ga0306918_108417891 | 3300031744 | Soil | FSLVPHDGLEIWFRAPGGRVPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0318502_107975772 | 3300031747 | Soil | APVPAEGLELWFRAPAGPGPDVLEIGLRGRRRPRVEAYWDGCLFALTA |
| Ga0318492_107364081 | 3300031748 | Soil | GLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAL |
| Ga0318494_103356592 | 3300031751 | Soil | VWYRIPGGRRPDVLEIELRGKRRPRVEAYWDGCIYAL |
| Ga0318554_102555611 | 3300031765 | Soil | RVPAGAPPEVLEIGLRGRRRPRVEAYWDGCAFALSA |
| Ga0318554_102904152 | 3300031765 | Soil | FSPAYADGLEVWFRAPAGQMPDVLEVGVRGRRHPRVEAYWDGCSFAL |
| Ga0318554_106324052 | 3300031765 | Soil | PSEFSPVHLAGLDVWYRIPGGRRPDVLEIGLRGKRRPRVAAYWDGCIYVL |
| Ga0318554_106633221 | 3300031765 | Soil | RLAPAAGLDIWFRAPAGTLPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0318526_104718942 | 3300031769 | Soil | DGLEIWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAL |
| Ga0318521_100925333 | 3300031770 | Soil | DGFTLVSQAGAEIWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRIAL |
| Ga0318546_103007733 | 3300031771 | Soil | FRIPAGRLPDVLEIGLRGRRHPRVEAYWDGCAYAL |
| Ga0318543_103180582 | 3300031777 | Soil | EIWFRAPGGRVPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0318543_105185832 | 3300031777 | Soil | LELWFRVPAGAPPEVLEIGLRGRRRPRVEAYWDGCAFALSA |
| Ga0318498_100807471 | 3300031778 | Soil | IWYRIPGGRRPDVLEIGLRGKRRPRVEAYWDGCIYAL |
| Ga0318498_104519171 | 3300031778 | Soil | FRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRIAL |
| Ga0318547_105933471 | 3300031781 | Soil | DEAGLEIWYRIPGGRRPDVLEIGLRGKRRRRVEAYWDGCIYAL |
| Ga0318548_104815471 | 3300031793 | Soil | SGFSPLHAAGLEVWYRIPGGRRPDVLEIELRGKRRPRVEAYWDGCIYAL |
| Ga0318497_101169242 | 3300031805 | Soil | AGFRPVPHDEVELWFRAPAGRVPDVLEIGVHGRRRPRVEAYWDGCRIAL |
| Ga0318497_108002901 | 3300031805 | Soil | PVHLAGLDVWYRIPGGRRPDVLEIGLHGKRRPRVEAYWDGCIYAL |
| Ga0318497_108396281 | 3300031805 | Soil | YADGLEVWFRAPAGQMPDVLEVGVRGRRHPRVEAYWDGCSFAL |
| Ga0318568_103076191 | 3300031819 | Soil | VWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCSFAL |
| Ga0307478_104141871 | 3300031823 | Hardwood Forest Soil | LEVWYRIPGGRRPDVLEIGLRGKRRPHVEAYWDGCIYAL |
| Ga0318499_104119032 | 3300031832 | Soil | GFSPADADGLEVWFRAPAGRMPDVLEIGLRGRRHPRVEAYWDGCSFVL |
| Ga0318517_103668511 | 3300031835 | Soil | PLEVWFRAPGGRQPDVLEIGLRGRRRARVEAYWDGCLMAM |
| Ga0318512_101921873 | 3300031846 | Soil | TRVPAAGLELWFRAPGGILPEVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0318527_102157381 | 3300031859 | Soil | YRSPGGRRPDVLEIAMRGKRRPRIKAYWDGCVYAL |
| Ga0318527_102326332 | 3300031859 | Soil | LDIWFRAPAGTLPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0318495_104732891 | 3300031860 | Soil | LDGFTLVSQAGAEIWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRIAL |
| Ga0306919_108870142 | 3300031879 | Soil | FSPAYADGLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAL |
| Ga0306919_111228391 | 3300031879 | Soil | FRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAL |
| Ga0306925_103892861 | 3300031890 | Soil | GFSLVSRDGVEIWFRRPAGRVPDVLEIDVRGRRRPRVEAYWDGCLVAL |
| Ga0306925_114406002 | 3300031890 | Soil | LVSQAGVEIWFRVPAGRVPDVLEIGVRGRRRPRVEAYWDGCLIAL |
| Ga0318536_103431861 | 3300031893 | Soil | SQYALMRGRRPDVLEIAMRGKRRPRIKAYWDGCVYAL |
| Ga0318522_102264042 | 3300031894 | Soil | VSQAGAEIWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRIAL |
| Ga0318551_101439403 | 3300031896 | Soil | GFSPAYADGLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAL |
| Ga0318551_103568172 | 3300031896 | Soil | EVELWFRAPAGRVPDVLEIGLHGRRRPRVEAYWDGCRFAL |
| Ga0318520_109367311 | 3300031897 | Soil | FSPVHLAGLDVWYRIPGGRRPDVLEIGLRGKRRPRVEAYWDGCIYAL |
| Ga0306923_112615161 | 3300031910 | Soil | VWFRIPSGRVPDVLEIGLRGKRRPRVEAYWDGCTYAL |
| Ga0306921_123907841 | 3300031912 | Soil | DGLDIWFRAPAGRLPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0310913_112470821 | 3300031945 | Soil | PSGFSPLYEAGLEIWYRIPGGRRPDVLEIGLRGKRRPRVEAYWDGCIYAL |
| Ga0318562_101683051 | 3300032008 | Soil | LELWFRAPAGPGPDVLEIGLRGRRRPRVEAYWDGCLFALTA |
| Ga0318562_103671681 | 3300032008 | Soil | LELWFRVPAGAPPDVLEIGLRGRRRPRVEAYWDGCLFALSA |
| Ga0318562_104697261 | 3300032008 | Soil | VPAAGLELWFRAPGGILPEVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0318507_101274251 | 3300032025 | Soil | GLDVWFRIPAGRLPDVLEIGLRGRRHPRVEAYWDGCAYAL |
| Ga0318559_100798603 | 3300032039 | Soil | WFRIPSGQLPDVLEIGLRGKRHPRVEAYWDGCSFAL |
| Ga0318506_101192143 | 3300032052 | Soil | SGFSPVNSAGLDVWFRIPAGRLPDVLEIGLRGRRHPRVEAYWDGCAYAL |
| Ga0318506_102429531 | 3300032052 | Soil | SPVRLTGLDIWYRIPGGRRPDVLEIAMRGKRRPRIKAYWDGCVYAL |
| Ga0318505_105808072 | 3300032060 | Soil | YEAGLEIWYRIPGGRRPDVLEIGLRGKRRPRIEAYWDGCIYAL |
| Ga0318513_101363961 | 3300032065 | Soil | LSGFAPVPAEGLELWFRAPAGPGPDVLEIGLRGRRRPRVEAYWDGCLFALTA |
| Ga0318514_105651831 | 3300032066 | Soil | SGFRLAPADGLDIWFRAPAGTLPDVLEIGLRGRRRPRVEAYWDGCLIAL |
| Ga0318524_100560021 | 3300032067 | Soil | PVPAEGLELWFRAPAGPGPDVLEIGLRGRRRPRVEAYWDGCLFALTA |
| Ga0318524_101684502 | 3300032067 | Soil | ACADGLEVWFRAPAGQMPDVLEIGIRGRRHPRVEAYWDGCAFAI |
| Ga0318524_102323611 | 3300032067 | Soil | DGLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAL |
| Ga0311301_105866664 | 3300032160 | Peatlands Soil | GLEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCTFAL |
| Ga0311301_108162891 | 3300032160 | Peatlands Soil | GGLEIWFRAPGGRLPDVLEIAMKGKRHPRVEAYWDGCSYML |
| Ga0306920_1017736462 | 3300032261 | Soil | SPVHLAGLDVWYRIPGGRRPDVLEIGLRGKRRPRVEAYWDGCIYAL |
| Ga0306920_1025773853 | 3300032261 | Soil | VWFRAPGGRVPDVLEIGLRGRRRPRVEAYWDGCQIAL |
| Ga0306920_1040357181 | 3300032261 | Soil | SDSLEVWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCSFAL |
| Ga0335079_112434712 | 3300032783 | Soil | GLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCAFAV |
| Ga0335079_114496972 | 3300032783 | Soil | FNPAYADGLEVWFRAPAGRMPDVLEIAIRGRRHPRVEAYWDGCAFAL |
| Ga0335078_100147706 | 3300032805 | Soil | VAGLELWFRALAGAHPDVLEIGVRGKRRPRVEAYWDGCLFALGA |
| Ga0335078_124576641 | 3300032805 | Soil | PGFTRVPAEGLELWFRAPGGILPDVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0335080_105253181 | 3300032828 | Soil | ADGLEIWFRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCSFAL |
| Ga0335080_108197093 | 3300032828 | Soil | AEGLELWFRAPGGILPDVLEIGLRGRRRPRVEAYWDGCLFALGA |
| Ga0335069_1000280828 | 3300032893 | Soil | PACADGLEVWFRAPAGRMPDVLEIGIRGRRHPRVEAYWDGCAFAL |
| Ga0335074_108859041 | 3300032895 | Soil | FRAPAGRMPDVLEIGMRGRRHPRVEAYWDGCSFAL |
| Ga0335075_104229331 | 3300032896 | Soil | RPWHAAGLDIWCRIPSGRRPDVLEIGLHGKRRPRVEAYWDGCIYAL |
| Ga0335071_104704471 | 3300032897 | Soil | PAPGLDLWFRAPAGVQPDVLEIALHGRRRPRVEAYWDGCLYALTG |
| Ga0335072_109113523 | 3300032898 | Soil | SPAHADGLEVWFRAPAGRMPDVLEIGVRGRRHPRVEAYWDGCYFAL |
| Ga0335076_113492531 | 3300032955 | Soil | LWFLAPAGVRPDVLEIALHGRRRPRVEAYWDGCLYALTG |
| Ga0335073_111546751 | 3300033134 | Soil | EVWYRIPGDRRPDVLEIGLRGKRRPHVEAYWDGCIYAL |
| Ga0310914_112786951 | 3300033289 | Soil | TGQDGVEVWFRAPGGRVADVLEIGLRGRRRPRVEAYWDGCQIAL |
| ⦗Top⦘ |