Metagenome Family F022157

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F022157
Family Type	Metagenome
Number of Sequences	215
Average Sequence Length	39 residues
Representative Sequence	MWDVLVTFMLMLFGAFVVIAFGAILIWTLYLLQNEADND
Number of Associated Samples	116
Number of Associated Scaffolds	215

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	87.44 %
% of genes near scaffold ends (potentially truncated)	17.21 %
% of genes from short scaffolds (< 2000 bps)	69.77 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (38.605 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (32.093 % of family members)
Environment Ontology (ENVO)	Unclassified (80.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (84.186 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 215 Family Scaffolds
PF08291	Peptidase_M15_3	10.23
PF13412	HTH_24	8.84
PF09588	YqaJ	7.44
PF02592	Vut_1	3.26
PF00149	Metallophos	1.86
PF08774	VRR_NUC	1.86
PF12705	PDDEXK_1	1.40
PF06067	DUF932	1.40
PF01807	zf-CHC2	1.40
PF01047	MarR	1.40
PF11753	DUF3310	0.93
PF06378	DUF1071	0.93
PF03245	Phage_lysis	0.93
PF08241	Methyltransf_11	0.93
PF01870	Hjc	0.93
PF13392	HNH_3	0.93
PF05866	RusA	0.47
PF07120	DUF1376	0.47
PF00145	DNA_methylase	0.47
PF03237	Terminase_6N	0.47
PF00182	Glyco_hydro_19	0.47
PF01612	DNA_pol_A_exo1	0.47
PF04404	ERF	0.47
PF00166	Cpn10	0.47
PF01391	Collagen	0.47
PF00476	DNA_pol_A	0.47

COG ID	Name	Functional Category	% Frequency in 215 Family Scaffolds
COG1738	Queuosine precursor transporter YhhQ, DUF165 family	Translation, ribosomal structure and biogenesis [J]	3.26
COG0358	DNA primase (bacterial type)	Replication, recombination and repair [L]	1.40
COG1591	Holliday junction resolvase Hjc, archaeal type	Replication, recombination and repair [L]	0.93
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	0.47
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	0.47
COG0749	DNA polymerase I, 3'-5' exonuclease and polymerase domains	Replication, recombination and repair [L]	0.47
COG3179	Chitinase, GH19 family	Carbohydrate transport and metabolism [G]	0.47
COG3756	Uncharacterized conserved protein YdaU, DUF1376 family	Function unknown [S]	0.47
COG3979	Chitodextrinase	Carbohydrate transport and metabolism [G]	0.47
COG4570	Holliday junction resolvase RusA (prophage-encoded endonuclease)	Replication, recombination and repair [L]	0.47

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	77.21 %
Unclassified	root	N/A	22.79 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	68.37 %
Unclassified	root	N/A	22.79 %
cellular organisms	root	All Organisms → cellular organisms	8.84 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	8.84 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	6.98 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.47 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.47 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.47 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.47 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.47 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.47 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.47 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.47 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	0.47 %
Desulfurellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales	0.47 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.47 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
unclassified Desulfurellales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales	0.47 %
Pirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae	0.47 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.47 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
Rhodopirellula	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula	0.47 %
Desulfurellales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium	0.47 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.47 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
unclassified Rhodopirellula	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula	0.47 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	0.47 %
Desulfurellales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium	0.47 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	29.77 %
Unclassified	root	N/A	22.79 %
Flavobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	0.47 %
Rhodopirellula sp.	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp.	0.47 %
Desulfurellales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium	0.47 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003277\|JGI25908J49247_10004454	All Organisms → Viruses → Predicted Viral	4482	Open in IMG/M
3300003277\|JGI25908J49247_10004465	All Organisms → Viruses → Predicted Viral	4477	Open in IMG/M
3300003277\|JGI25908J49247_10017515	All Organisms → Viruses → Predicted Viral	2162	Open in IMG/M
3300003277\|JGI25908J49247_10033028	All Organisms → Viruses → Predicted Viral	1449	Open in IMG/M
3300003277\|JGI25908J49247_10039397	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1286	Open in IMG/M
3300003277\|JGI25908J49247_10068883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	888	Open in IMG/M
3300003277\|JGI25908J49247_10101617	All Organisms → cellular organisms → Bacteria → Proteobacteria	692	Open in IMG/M
3300003388\|JGI25910J50241_10013110	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2958	Open in IMG/M
3300003393\|JGI25909J50240_1014950	All Organisms → cellular organisms → Bacteria → Proteobacteria	1844	Open in IMG/M
3300003394\|JGI25907J50239_1044310	All Organisms → cellular organisms → Bacteria → Proteobacteria	918	Open in IMG/M
3300003986\|Ga0063233_10056566	All Organisms → Viruses → Predicted Viral	1100	Open in IMG/M
3300004096\|Ga0066177_10360026	Not Available	626	Open in IMG/M
3300004124\|Ga0066178_10012237	All Organisms → Viruses → Predicted Viral	1840	Open in IMG/M
3300004128\|Ga0066180_10022560	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2003	Open in IMG/M
3300004448\|Ga0065861_1098491	All Organisms → Viruses → Predicted Viral	1910	Open in IMG/M
3300004448\|Ga0065861_1105194	All Organisms → Viruses → Predicted Viral	1220	Open in IMG/M
3300004460\|Ga0066222_1059404	All Organisms → cellular organisms → Bacteria	2031	Open in IMG/M
3300004481\|Ga0069718_14831161	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	828	Open in IMG/M
3300005581\|Ga0049081_10025422	All Organisms → Viruses → Predicted Viral	2247	Open in IMG/M
3300005581\|Ga0049081_10072709	All Organisms → Viruses → Predicted Viral	1293	Open in IMG/M
3300005582\|Ga0049080_10000304	Not Available	15976	Open in IMG/M
3300005582\|Ga0049080_10116901	Not Available	903	Open in IMG/M
3300005582\|Ga0049080_10132917	Not Available	838	Open in IMG/M
3300005583\|Ga0049085_10315623	Not Available	507	Open in IMG/M
3300005662\|Ga0078894_10361269	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1315	Open in IMG/M
3300006014\|Ga0073919_1031214	Not Available	509	Open in IMG/M
3300006805\|Ga0075464_10541244	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	714	Open in IMG/M
3300007559\|Ga0102828_1078496	Not Available	789	Open in IMG/M
3300007708\|Ga0102859_1198759	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	596	Open in IMG/M
3300007735\|Ga0104988_10518	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16789	Open in IMG/M
3300007972\|Ga0105745_1264733	Not Available	555	Open in IMG/M
3300007973\|Ga0105746_1009471	Not Available	2755	Open in IMG/M
3300007973\|Ga0105746_1107763	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	919	Open in IMG/M
3300008266\|Ga0114363_1024292	All Organisms → Viruses → Predicted Viral	2630	Open in IMG/M
3300008448\|Ga0114876_1181250	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	733	Open in IMG/M
3300008450\|Ga0114880_1095328	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1161	Open in IMG/M
3300008450\|Ga0114880_1159799	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	801	Open in IMG/M
3300009026\|Ga0102829_1154538	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	734	Open in IMG/M
3300009056\|Ga0102860_1090225	Not Available	847	Open in IMG/M
3300009068\|Ga0114973_10005410	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8684	Open in IMG/M
3300009068\|Ga0114973_10061817	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2184	Open in IMG/M
3300009068\|Ga0114973_10091360	All Organisms → Viruses → Predicted Viral	1738	Open in IMG/M
3300009068\|Ga0114973_10325715	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	815	Open in IMG/M
3300009068\|Ga0114973_10497343	Not Available	632	Open in IMG/M
3300009151\|Ga0114962_10001433	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	20598	Open in IMG/M
3300009151\|Ga0114962_10001717	Not Available	18724	Open in IMG/M
3300009151\|Ga0114962_10004355	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11273	Open in IMG/M
3300009151\|Ga0114962_10026029	All Organisms → Viruses → Predicted Viral	4067	Open in IMG/M
3300009151\|Ga0114962_10036257	Not Available	3344	Open in IMG/M
3300009151\|Ga0114962_10144731	All Organisms → Viruses → Predicted Viral	1434	Open in IMG/M
3300009152\|Ga0114980_10013007	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5297	Open in IMG/M
3300009152\|Ga0114980_10056432	All Organisms → Viruses → Predicted Viral	2374	Open in IMG/M
3300009152\|Ga0114980_10128548	All Organisms → Viruses → Predicted Viral	1507	Open in IMG/M
3300009152\|Ga0114980_10441368	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	744	Open in IMG/M
3300009154\|Ga0114963_10169657	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1281	Open in IMG/M
3300009155\|Ga0114968_10024929	All Organisms → Viruses → Predicted Viral	4072	Open in IMG/M
3300009155\|Ga0114968_10027314	All Organisms → Viruses → Predicted Viral	3860	Open in IMG/M
3300009155\|Ga0114968_10049580	All Organisms → Viruses → Predicted Viral	2708	Open in IMG/M
3300009155\|Ga0114968_10136973	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1464	Open in IMG/M
3300009155\|Ga0114968_10330042	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	846	Open in IMG/M
3300009159\|Ga0114978_10062579	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	2526	Open in IMG/M
3300009159\|Ga0114978_10111343	Not Available	1797	Open in IMG/M
3300009159\|Ga0114978_10404044	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	817	Open in IMG/M
3300009159\|Ga0114978_10593671	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	641	Open in IMG/M
3300009163\|Ga0114970_10050556	All Organisms → Viruses → Predicted Viral	2687	Open in IMG/M
3300009163\|Ga0114970_10069809	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2225	Open in IMG/M
3300009163\|Ga0114970_10178345	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1262	Open in IMG/M
3300009164\|Ga0114975_10212322	All Organisms → Viruses → Predicted Viral	1091	Open in IMG/M
3300009164\|Ga0114975_10284336	Not Available	919	Open in IMG/M
3300009180\|Ga0114979_10260970	All Organisms → Viruses → Predicted Viral	1036	Open in IMG/M
3300009181\|Ga0114969_10492046	Not Available	687	Open in IMG/M
3300009183\|Ga0114974_10087057	All Organisms → Viruses → Predicted Viral	2027	Open in IMG/M
3300009183\|Ga0114974_10448276	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	731	Open in IMG/M
3300009183\|Ga0114974_10467212	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	712	Open in IMG/M
3300009184\|Ga0114976_10550232	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	590	Open in IMG/M
3300009419\|Ga0114982_1006962	All Organisms → Viruses → Predicted Viral	4192	Open in IMG/M
3300010160\|Ga0114967_10596189	Not Available	531	Open in IMG/M
3300010334\|Ga0136644_10025604	All Organisms → cellular organisms → Bacteria → Proteobacteria	3950	Open in IMG/M
3300010885\|Ga0133913_10274601	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4471	Open in IMG/M
3300010885\|Ga0133913_10979900	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2188	Open in IMG/M
3300010885\|Ga0133913_11691386	All Organisms → Viruses → Predicted Viral	1591	Open in IMG/M
3300010885\|Ga0133913_11805474	All Organisms → cellular organisms → Bacteria → Proteobacteria	1530	Open in IMG/M
3300010885\|Ga0133913_11886119	All Organisms → Viruses → Predicted Viral	1491	Open in IMG/M
3300012012\|Ga0153799_1003236	All Organisms → Viruses → Predicted Viral	4254	Open in IMG/M
3300012017\|Ga0153801_1084149	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	560	Open in IMG/M
3300012663\|Ga0157203_1006179	All Organisms → Viruses → Predicted Viral	2217	Open in IMG/M
3300012665\|Ga0157210_1005495	All Organisms → Viruses → Predicted Viral	2573	Open in IMG/M
3300013004\|Ga0164293_10136519	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1839	Open in IMG/M
3300013005\|Ga0164292_10072102	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2658	Open in IMG/M
3300013005\|Ga0164292_10175591	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1544	Open in IMG/M
3300013006\|Ga0164294_10141940	All Organisms → Viruses → Predicted Viral	1743	Open in IMG/M
3300013285\|Ga0136642_1021662	Not Available	1875	Open in IMG/M
3300013286\|Ga0136641_1035752	All Organisms → cellular organisms → Bacteria	1480	Open in IMG/M
3300013286\|Ga0136641_1049364	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1227	Open in IMG/M
3300013295\|Ga0170791_14404481	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666	Open in IMG/M
3300013295\|Ga0170791_14789003	Not Available	909	Open in IMG/M
3300013372\|Ga0177922_10093328	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1470	Open in IMG/M
3300013372\|Ga0177922_11194877	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	780	Open in IMG/M
3300014050\|Ga0119952_1028305	All Organisms → Viruses → Predicted Viral	1750	Open in IMG/M
3300014050\|Ga0119952_1104377	Not Available	659	Open in IMG/M
3300015050\|Ga0181338_1002717	All Organisms → cellular organisms → Bacteria → Proteobacteria	3098	Open in IMG/M
3300017701\|Ga0181364_1009868	All Organisms → cellular organisms → Bacteria → Proteobacteria	1612	Open in IMG/M
3300017701\|Ga0181364_1026513	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	943	Open in IMG/M
3300017716\|Ga0181350_1006807	All Organisms → Viruses → Predicted Viral	3285	Open in IMG/M
3300017716\|Ga0181350_1079758	Not Available	829	Open in IMG/M
3300017716\|Ga0181350_1081570	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	817	Open in IMG/M
3300017716\|Ga0181350_1102607	Not Available	702	Open in IMG/M
3300017716\|Ga0181350_1151790	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	540	Open in IMG/M
3300017722\|Ga0181347_1193359	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300017722\|Ga0181347_1214185	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	502	Open in IMG/M
3300017723\|Ga0181362_1047568	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	896	Open in IMG/M
3300017736\|Ga0181365_1028739	All Organisms → cellular organisms → Bacteria → Proteobacteria	1403	Open in IMG/M
3300017736\|Ga0181365_1159647	Not Available	532	Open in IMG/M
3300017754\|Ga0181344_1009720	All Organisms → Viruses → Predicted Viral	3112	Open in IMG/M
3300017754\|Ga0181344_1063174	All Organisms → Viruses → Predicted Viral	1095	Open in IMG/M
3300017754\|Ga0181344_1167403	Not Available	624	Open in IMG/M
3300017761\|Ga0181356_1013547	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3070	Open in IMG/M
3300017761\|Ga0181356_1063083	All Organisms → Viruses → Predicted Viral	1257	Open in IMG/M
3300017761\|Ga0181356_1069879	All Organisms → Viruses → Predicted Viral	1180	Open in IMG/M
3300017761\|Ga0181356_1125353	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	816	Open in IMG/M
3300017766\|Ga0181343_1064929	All Organisms → Viruses → Predicted Viral	1060	Open in IMG/M
3300017774\|Ga0181358_1150063	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	797	Open in IMG/M
3300017774\|Ga0181358_1276676	Not Available	519	Open in IMG/M
3300017774\|Ga0181358_1276807	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	519	Open in IMG/M
3300017777\|Ga0181357_1086078	All Organisms → Viruses → Predicted Viral	1200	Open in IMG/M
3300017777\|Ga0181357_1276213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	577	Open in IMG/M
3300017778\|Ga0181349_1064831	Not Available	1409	Open in IMG/M
3300017778\|Ga0181349_1110499	All Organisms → Viruses → Predicted Viral	1021	Open in IMG/M
3300017780\|Ga0181346_1222313	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	671	Open in IMG/M
3300017784\|Ga0181348_1097169	All Organisms → Viruses → Predicted Viral	1152	Open in IMG/M
3300019781\|Ga0181360_102083	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1651	Open in IMG/M
3300019783\|Ga0181361_100279	All Organisms → Viruses → Predicted Viral	2732	Open in IMG/M
3300019784\|Ga0181359_1000006	Not Available	49804	Open in IMG/M
3300019784\|Ga0181359_1010854	All Organisms → Viruses → Predicted Viral	3251	Open in IMG/M
3300019784\|Ga0181359_1019316	All Organisms → Viruses → Predicted Viral	2566	Open in IMG/M
3300019784\|Ga0181359_1019952	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2530	Open in IMG/M
3300019784\|Ga0181359_1028894	All Organisms → cellular organisms → Bacteria → Proteobacteria	2134	Open in IMG/M
3300019784\|Ga0181359_1038863	All Organisms → Viruses → Predicted Viral	1843	Open in IMG/M
3300019784\|Ga0181359_1038872	All Organisms → Viruses → Predicted Viral	1843	Open in IMG/M
3300019784\|Ga0181359_1048335	All Organisms → Viruses → Predicted Viral	1642	Open in IMG/M
3300019784\|Ga0181359_1064666	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1394	Open in IMG/M
3300019784\|Ga0181359_1107930	All Organisms → Viruses → Predicted Viral	1012	Open in IMG/M
3300019784\|Ga0181359_1162017	Not Available	757	Open in IMG/M
3300019784\|Ga0181359_1223318	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	590	Open in IMG/M
3300020141\|Ga0211732_1468394	Not Available	679	Open in IMG/M
3300020151\|Ga0211736_10510482	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11695	Open in IMG/M
3300021354\|Ga0194047_10255825	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	679	Open in IMG/M
3300021952\|Ga0213921_1001169	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7154	Open in IMG/M
3300022190\|Ga0181354_1005435	All Organisms → Viruses → Predicted Viral	3400	Open in IMG/M
3300022190\|Ga0181354_1025613	All Organisms → Viruses → Predicted Viral	1902	Open in IMG/M
3300022190\|Ga0181354_1048265	All Organisms → Viruses → Predicted Viral	1416	Open in IMG/M
3300022190\|Ga0181354_1055172	All Organisms → cellular organisms → Bacteria → Proteobacteria	1321	Open in IMG/M
3300022190\|Ga0181354_1056406	All Organisms → Viruses → Predicted Viral	1306	Open in IMG/M
3300022190\|Ga0181354_1188127	Not Available	623	Open in IMG/M
3300022407\|Ga0181351_1045421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1846	Open in IMG/M
3300022407\|Ga0181351_1194036	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	686	Open in IMG/M
3300022407\|Ga0181351_1221980	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	612	Open in IMG/M
3300022752\|Ga0214917_10002429	Not Available	22599	Open in IMG/M
3300022752\|Ga0214917_10039444	All Organisms → Viruses → Predicted Viral	3377	Open in IMG/M
3300022752\|Ga0214917_10112250	All Organisms → Viruses → Predicted Viral	1549	Open in IMG/M
3300022752\|Ga0214917_10457097	Not Available	507	Open in IMG/M
3300023174\|Ga0214921_10001970	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	34346	Open in IMG/M
3300023174\|Ga0214921_10020412	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7095	Open in IMG/M
3300023174\|Ga0214921_10089330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2379	Open in IMG/M
3300023174\|Ga0214921_10358219	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	771	Open in IMG/M
3300023174\|Ga0214921_10546472	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp.	534	Open in IMG/M
3300024346\|Ga0244775_10717071	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	805	Open in IMG/M
3300025606\|Ga0207954_1089979	Not Available	771	Open in IMG/M
3300027393\|Ga0209867_1058431	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	582	Open in IMG/M
3300027608\|Ga0208974_1044017	All Organisms → Viruses → Predicted Viral	1302	Open in IMG/M
3300027708\|Ga0209188_1025461	All Organisms → Viruses → Predicted Viral	2926	Open in IMG/M
3300027733\|Ga0209297_1002502	Not Available	10131	Open in IMG/M
3300027733\|Ga0209297_1005942	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6220	Open in IMG/M
3300027734\|Ga0209087_1005924	Not Available	6530	Open in IMG/M
3300027734\|Ga0209087_1060082	All Organisms → Viruses → Predicted Viral	1706	Open in IMG/M
3300027736\|Ga0209190_1015109	Not Available	4455	Open in IMG/M
3300027736\|Ga0209190_1369318	Not Available	525	Open in IMG/M
3300027741\|Ga0209085_1009068	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5041	Open in IMG/M
3300027741\|Ga0209085_1020475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3186	Open in IMG/M
3300027747\|Ga0209189_1110857	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1215	Open in IMG/M
3300027747\|Ga0209189_1201807	Not Available	819	Open in IMG/M
3300027749\|Ga0209084_1297289	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	610	Open in IMG/M
3300027754\|Ga0209596_1087699	Not Available	1499	Open in IMG/M
3300027754\|Ga0209596_1217253	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	805	Open in IMG/M
3300027754\|Ga0209596_1254365	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	719	Open in IMG/M
3300027754\|Ga0209596_1330038	Not Available	596	Open in IMG/M
3300027759\|Ga0209296_1014804	All Organisms → Viruses → Predicted Viral	4567	Open in IMG/M
3300027759\|Ga0209296_1027546	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3164	Open in IMG/M
3300027763\|Ga0209088_10091071	All Organisms → Viruses → Predicted Viral	1411	Open in IMG/M
3300027770\|Ga0209086_10130400	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1243	Open in IMG/M
3300027782\|Ga0209500_10111985	All Organisms → Viruses → Predicted Viral	1335	Open in IMG/M
3300027785\|Ga0209246_10105259	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1106	Open in IMG/M
3300027963\|Ga0209400_1112767	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium	1243	Open in IMG/M
3300027969\|Ga0209191_1123341	All Organisms → Viruses → Predicted Viral	1081	Open in IMG/M
3300027973\|Ga0209298_10204559	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	805	Open in IMG/M
3300027973\|Ga0209298_10271750	Not Available	669	Open in IMG/M
3300028025\|Ga0247723_1154336	Not Available	535	Open in IMG/M
3300028392\|Ga0304729_1081509	Not Available	1135	Open in IMG/M
3300031707\|Ga0315291_10681074	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	917	Open in IMG/M
3300031746\|Ga0315293_11289889	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	502	Open in IMG/M
3300031772\|Ga0315288_11156732	Not Available	671	Open in IMG/M
3300031786\|Ga0315908_11526533	Not Available	520	Open in IMG/M
3300031873\|Ga0315297_10409182	All Organisms → Viruses → Predicted Viral	1138	Open in IMG/M
3300031952\|Ga0315294_10126531	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2619	Open in IMG/M
3300031952\|Ga0315294_11460451	Not Available	537	Open in IMG/M
3300031999\|Ga0315274_11635876	Not Available	602	Open in IMG/M
3300032092\|Ga0315905_10246705	All Organisms → Viruses → Predicted Viral	1735	Open in IMG/M
3300032092\|Ga0315905_10522866	All Organisms → Viruses → Predicted Viral	1088	Open in IMG/M
3300032092\|Ga0315905_10717531	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	884	Open in IMG/M
3300032401\|Ga0315275_11426704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	746	Open in IMG/M
3300033233\|Ga0334722_10095515	All Organisms → Viruses → Predicted Viral	2263	Open in IMG/M
3300033993\|Ga0334994_0286954	Not Available	843	Open in IMG/M
3300033996\|Ga0334979_0112967	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1678	Open in IMG/M
3300034106\|Ga0335036_0000633	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32190	Open in IMG/M
3300034119\|Ga0335054_0782848	Not Available	505	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.14%
Terrestrial	Environmental → Terrestrial	1.86%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	92.56%
Marine	Environmental → Aquatic → Marine	5.58%
Soil	Environmental → Terrestrial → Soil	0.93%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.93%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	53.02%
Lentic	Environmental → Aquatic → Freshwater → Lentic	35.81%
Coastal	Environmental → Aquatic → Marine → Coastal	3.26%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.86%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.86%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.93%
Sand	Environmental → Terrestrial → Soil → Sand	0.93%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.93%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.47%
Creek	Environmental → Aquatic → Freshwater → Creek	0.47%
Unclassified	Environmental → Aquatic → Marine → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	48.84%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	35.81%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.19%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	3.26%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.86%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.86%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.93%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.93%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.47%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.47%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	32.09%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	32.09%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	7.91%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.51%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.19%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.26%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.86%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.86%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.40%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	1.40%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	1.40%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.93%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.93%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.47%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.47%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.47%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.47%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.47%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.47%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	0.47%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.47%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.47%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003388	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN	Environmental	Open in IMG/M
3300003393	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD	Environmental	Open in IMG/M
3300003394	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN	Environmental	Open in IMG/M
3300003986	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)	Environmental	Open in IMG/M
3300004096	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)	Environmental	Open in IMG/M
3300004124	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)	Environmental	Open in IMG/M
3300004128	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)	Environmental	Open in IMG/M
3300004448	Marine viral communities from Newfoundland, Canada BC-1	Environmental	Open in IMG/M
3300004460	Marine viral communities from Newfoundland, Canada BC-1	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300006014	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300007735	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct	Environmental	Open in IMG/M
3300007972	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009026	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575	Environmental	Open in IMG/M
3300009056	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013285	Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y	Environmental	Open in IMG/M
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014050	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300019781	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D	Environmental	Open in IMG/M
3300019783	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300021354	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m	Environmental	Open in IMG/M
3300021952	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300025606	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)	Environmental	Open in IMG/M
3300027393	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027973	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028392	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034119	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25908J49247_100044549	3300003277	Freshwater Lake	MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEADND*
JGI25908J49247_100044656	3300003277	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGGHDDC*
JGI25908J49247_100175152	3300003277	Freshwater Lake	MWDVAVTFMFMMFGGLTMIFFGLMLIFILYFLQNEVDND*
JGI25908J49247_100330286	3300003277	Freshwater Lake	MWDVLVTFMLMLFGAFAVIAFGVILIGALYFLQNEADND*
JGI25908J49247_100393974	3300003277	Freshwater Lake	MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND*
JGI25908J49247_100688832	3300003277	Freshwater Lake	MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND*
JGI25908J49247_101016172	3300003277	Freshwater Lake	MWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR*
JGI25910J50241_100131108	3300003388	Freshwater Lake	MWDVVVTVTLMLFGAFVVIAFGAILICALYLIQNGDRDD*
JGI25909J50240_10149505	3300003393	Freshwater Lake	MWDVLVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND*
JGI25907J50239_10443101	3300003394	Freshwater Lake	MESSLMWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND
Ga0063233_100565664	3300003986	Freshwater Lake	MWDVAVTFMLMMFGAFIVVAFGAILIWTLYLIQNGDRDD*
Ga0066177_103600263	3300004096	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKGVDDE*
Ga0066178_100122372	3300004124	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGDRDDC*
Ga0066180_100225606	3300004128	Freshwater Lake	GLAMWDVVVTMTLMLFGAFTVIVFGAIFIWALYLIQNGNRNDK*
Ga0065861_10984912	3300004448	Marine	MWDVTVTFMLMFFGAFTMIFWGALLIWVLWLLQNGDYDD*
Ga0065861_11051942	3300004448	Marine	MWDVAVTFMLMMFGAFVIVAFGAILIWSLYFIQKGVDDE*
Ga0066222_10594041	3300004460	Marine	MWDVLVTFMLMLFGAFIVIAFGAVLIGALYFLQNEADND*
Ga0069718_148311613	3300004481	Sediment	MWDVVVTVTLMLFGAFTVIVFGAILIWALYLLQNRNDNDK*
Ga0049081_100254222	3300005581	Freshwater Lentic	MWDVLVTFMLMAFGAFIVIAFGVILIWVLYLLQNEVDHE*
Ga0049081_100727092	3300005581	Freshwater Lentic	MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQNEADND*
Ga0049080_1000030427	3300005582	Freshwater Lentic	MWDVLVTFMLMAFGAFIVIAFGVILIWTLYLLQNEADND*
Ga0049080_101169013	3300005582	Freshwater Lentic	MWDVAVTFMLMMFGAFIVVAFGAILIWTLYIIQNGDRDD*
Ga0049080_101329172	3300005582	Freshwater Lentic	MWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDE*
Ga0049085_103156232	3300005583	Freshwater Lentic	MESSLMWDVAVTFMFMMFGGLTMIFFGLMLIFILYFLQNEVDND*
Ga0078894_103612694	3300005662	Freshwater Lake	MWDVLVTFLLMAFGGFVVIAFGIILIWVLYLLQNEADHE*
Ga0073919_10312141	3300006014	Sand	MEGSLMWDVLVTFMLMLFGAFFVIAFGAILIGALYFLQNE
Ga0075464_105412442	3300006805	Aqueous	MWDVLVTFMLMLFGAFVVIAFGAILIGTLYFLQKEADND*
Ga0102828_10784962	3300007559	Estuarine	MWDVAVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND*
Ga0102859_11987592	3300007708	Estuarine	MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEVDHE*
Ga0104988_1051818	3300007735	Freshwater	MWDVFVTFILMAFGAFIVIAFGAILIWVLYLLQNEVDND*
Ga0105745_12647332	3300007972	Estuary Water	MWDVAVTFMLMGFGAFVIVAFGVILIGALYFLQNEADND*
Ga0105746_10094714	3300007973	Estuary Water	MWDVVVTFMLMAFGAFVVIAFGVILIWTLYLLQNEADND*
Ga0105746_11077631	3300007973	Estuary Water	MWDVLLTFMLMMFGGFVVVAFGAILIGALYFLQNEADNE*
Ga0114363_10242924	3300008266	Freshwater, Plankton	MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND*
Ga0114876_11812502	3300008448	Freshwater Lake	MWDVVVTVTLMAFGAFIVIAFGVILIWTLYLLQNEADND*
Ga0114880_10953285	3300008450	Freshwater Lake	MWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDND
Ga0114880_11597993	3300008450	Freshwater Lake	MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDL*
Ga0102829_11545381	3300009026	Estuarine	MEGSLMWDVAVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND*
Ga0102860_10902252	3300009056	Estuarine	MWDVLVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND*
Ga0114973_100054102	3300009068	Freshwater Lake	MWDVAVTFMLMLFGAFTLIAFGAILIWTLYIIQNGDRDE*
Ga0114973_100618171	3300009068	Freshwater Lake	MEGSLMWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE*
Ga0114973_100913602	3300009068	Freshwater Lake	MWDVVVTFMLMMFGAFIVVAFGVILIWTLYLIQNGDRDD*
Ga0114973_103257152	3300009068	Freshwater Lake	MWDVVVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND*
Ga0114973_104973431	3300009068	Freshwater Lake	VTFMLMMFGAFVVVAFGAVLIWSLYVFQKGVDDE*
Ga0114962_1000143312	3300009151	Freshwater Lake	MWDVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD*
Ga0114962_1000171710	3300009151	Freshwater Lake	MWDVAVTFMLMMFGAFIVVAFGAILIWVLYIVQNVD*
Ga0114962_100043554	3300009151	Freshwater Lake	MWDVSVTFMLMFFGAFTMIFWGALLIWVLYLLQNEADND*
Ga0114962_100260298	3300009151	Freshwater Lake	MWDVAVTFMLMMFGAFVVVAFGAVLIWTLYVFQKGVDDE*
Ga0114962_100362572	3300009151	Freshwater Lake	MWDVLVTFMLMFFGAFVVIAFGAILIWALYIIQNEVDHD*
Ga0114962_101447312	3300009151	Freshwater Lake	MWDVAVTFMLMMFGAFVVVAFGAILIWALYVFQKGVDDE*
Ga0114980_100130075	3300009152	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDNE*
Ga0114980_100564326	3300009152	Freshwater Lake	MWDILVTFMLMMFGAFVVVVFGAILIWTIYLLQNEADND*
Ga0114980_101285485	3300009152	Freshwater Lake	MWDVLVTFILMMFGGLTMIFFGAMLICILYFLQNEVDND*
Ga0114980_104413681	3300009152	Freshwater Lake	SLMWDVLVTFMLMMFGAFFVIAFGVILIWVLYLLQNEVDHD*
Ga0114963_101696575	3300009154	Freshwater Lake	MWDVSVTFMLMLFGAFTMIFWGALLIWVLYLLQNEADND*
Ga0114968_100249297	3300009155	Freshwater Lake	MWDVAVTFMLMMFGAFVVVAFGAVLIWSLYVFQKGVDDE*
Ga0114968_100273147	3300009155	Freshwater Lake	MWDVTVTFILMFFGAFTMIFWGALLIWVLYLLQNEADND*
Ga0114968_100495803	3300009155	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGIILVWVLYFLQNEVDNE*
Ga0114968_101369732	3300009155	Freshwater Lake	MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADND*
Ga0114968_103300422	3300009155	Freshwater Lake	MWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND*
Ga0114978_100625795	3300009159	Freshwater Lake	MWDVAVTFMFMFFGAFIVIAFGALLIWMLYLIQNGVDDE*
Ga0114978_101113434	3300009159	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGVILIWVLYFLQNEVDNE*
Ga0114978_104040442	3300009159	Freshwater Lake	MWDILVTFMLMMFGAFVVVVFGAILIWTLYLLQNEADND*
Ga0114978_105936711	3300009159	Freshwater Lake	MWDVLVTFMLMMFGAFFVIAFGVILIWVLYLLQNEVDHD*
Ga0114970_100505567	3300009163	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQNGVDDE*
Ga0114970_100698094	3300009163	Freshwater Lake	MWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE*
Ga0114970_101783453	3300009163	Freshwater Lake	MWDVLVTFILMAFGGFAVIAFGVILVWVLYFLQNEVDNE*
Ga0114975_102123226	3300009164	Freshwater Lake	MEGSLMWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE*
Ga0114975_102843361	3300009164	Freshwater Lake	MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQKEADND*
Ga0114979_102609702	3300009180	Freshwater Lake	MWDVLVTFMLMLFGAFVVIAFGAVLIGALYFLQSEADHD*
Ga0114969_104920463	3300009181	Freshwater Lake	MWDVAVTFILMGFGAFTVITFGVILILVLHVLQNGGDDE*
Ga0114974_100870576	3300009183	Freshwater Lake	MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQKEVDND*
Ga0114974_104482764	3300009183	Freshwater Lake	VLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADND*
Ga0114974_104672121	3300009183	Freshwater Lake	MWDVLVTFTLMLFGGFVVIAFGAILIGALYFLQNEADHD*
Ga0114976_105502323	3300009184	Freshwater Lake	MEGRLMWDVTVTFTLMLFGAFTMIFWGALLIWVLYLLQNEADND*
Ga0114982_10069624	3300009419	Deep Subsurface	MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQKEADND*
Ga0114967_105961891	3300010160	Freshwater Lake	MWDVAVTFMLMLFGAFIVITFGAVLIGALYFLQNEADND*
Ga0136644_100256041	3300010334	Freshwater Lake	DVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD*
Ga0133913_102746019	3300010885	Freshwater Lake	MWDVAVTFMLMMFGAFVVIAFGAILIWVLYLLQNED*
Ga0133913_109799005	3300010885	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE*
Ga0133913_116913866	3300010885	Freshwater Lake	MWDVAVTFMFMFFGAFVVIAFGALLIWALYLIQNGVDDE*
Ga0133913_118054741	3300010885	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDHE*
Ga0133913_118861193	3300010885	Freshwater Lake	MWDVLVTFMLMLFGAFVVVVFGAILIWTLYLLQNEADND*
Ga0153799_10032366	3300012012	Freshwater	MWDVLVTFMLMAFGAFIVIAFGVILIWVLYLLQNEVDHD*
Ga0153801_10841492	3300012017	Freshwater	MWDVAVTFMLMMFGAFIVIAFGVILIWMLYLLQNEADND*
Ga0157203_10061793	3300012663	Freshwater	MWDVAITFMFMMFGGLTMIFFGAMLIFILYFLQNEVDND*
Ga0157210_10054956	3300012665	Freshwater	MWDVLVTFMLMLFGMFTVIAFGAILIWALYVFQNGVDDE*
Ga0164293_101365196	3300013004	Freshwater	MWDVLVTVTLMAFGAFVVIAFGIILIWVLYLLQNEVDHE*
Ga0164292_100721024	3300013005	Freshwater	MWDVLVTVTLMAFGAFVVIAFGIILIWVLYLLQNEADHE*
Ga0164292_101755917	3300013005	Freshwater	MEGSLMWDVAVTFMLMMFGAFVVIAFGAILIGALYFLQNEADND*
Ga0164294_101419406	3300013006	Freshwater	MWDVVVTVTLMLFGAFVVIAFGAVLICTLYLIQNGDRDD*
Ga0136642_10216623	3300013285	Freshwater	MWDVAVTFMLMFFGAFVVIAFGAILIWTLYLLQNEADND*
Ga0136641_10357524	3300013286	Freshwater	MWDVTVTFMLMMFGAFTMIFFGALLIWVLYLLQNEVDHD*
Ga0136641_10493643	3300013286	Freshwater	MWDVAVTFMLMMFGAFVVIAFGAILIWTLYLLQNEVDND*
Ga0170791_144044811	3300013295	Freshwater	MWDVSVTFMLMLFGAFTMIFWGALLIWVLYLLQNE
Ga0170791_147890034	3300013295	Freshwater	VEGSLMWDVLVTFILMAFGGFAVIAFGVILVWVLYFLQNEVDNE*
Ga0177922_100933281	3300013372	Freshwater	MWDVLVTVTLMAFGAFVVIAFGVILLWTLYLLQNEADND*
Ga0177922_111948772	3300013372	Freshwater	MWDVLVTFMLMLFGAFVVIAFGVILIWVLYLLQNEVDHE*
Ga0119952_10283055	3300014050	Freshwater	MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQKEVDND*
Ga0119952_11043772	3300014050	Freshwater	MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKGVDDD*
Ga0181338_10027177	3300015050	Freshwater Lake	MWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD*
Ga0181364_10098685	3300017701	Freshwater Lake	MWDVLVTFMLMMFGAFVVIAFGAILIGALYLLQNEADND
Ga0181364_10265134	3300017701	Freshwater Lake	GQIKETLMWDVLVTFMLMLFGAFAVIAFGVILIGALYFLQNEADND
Ga0181350_100680710	3300017716	Freshwater Lake	MWDVLVTFMLMLFGAFAVIAFGVILIWMLYLLQNEADND
Ga0181350_10797583	3300017716	Freshwater Lake	MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNKVDND
Ga0181350_10815702	3300017716	Freshwater Lake	MWDVGVTFMLMGFGAFVIVAFGVILIGALYFLQNEADND
Ga0181350_11026074	3300017716	Freshwater Lake	AMWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD
Ga0181350_11517903	3300017716	Freshwater Lake	DVLVTVMLIMFGGLTMIFFSAMLIFILYFLQNEVDND
Ga0181347_11933592	3300017722	Freshwater Lake	MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNGDDN
Ga0181347_12141853	3300017722	Freshwater Lake	SLMWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR
Ga0181362_10475682	3300017723	Freshwater Lake	MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNEAYND
Ga0181365_10287394	3300017736	Freshwater Lake	LVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND
Ga0181365_11596471	3300017736	Freshwater Lake	MEGSLMWDVAVTFMLMMFGGLTMIFFGAMLIFILYF
Ga0181344_10097207	3300017754	Freshwater Lake	MWDVLVTFLLMAFGGFVVIAFGIILIWVLYLLQNEVDHE
Ga0181344_10631745	3300017754	Freshwater Lake	MWDVVVTVTLMLFGAFVVIAFGAILICALYLIQNGDRDE
Ga0181344_11674033	3300017754	Freshwater Lake	MWDVAVTFILMGFGAFTVITFGVILILVLHVLQNGDRDD
Ga0181356_10135478	3300017761	Freshwater Lake	MWDVVVTVTLMLFGAFVVIAFGVILICALYLIQNGDRDD
Ga0181356_10630832	3300017761	Freshwater Lake	MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADHE
Ga0181356_10698791	3300017761	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGGHDD
Ga0181356_11253531	3300017761	Freshwater Lake	TLMWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDR
Ga0181343_10649292	3300017766	Freshwater Lake	MWDVAVTFMLMMFGAFAVLFFGAMLIWVLYIIQNGENDDQI
Ga0181358_11500634	3300017774	Freshwater Lake	LMWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR
Ga0181358_12766762	3300017774	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWTLYIIQNGDRDD
Ga0181358_12768071	3300017774	Freshwater Lake	GSLMWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND
Ga0181357_10860782	3300017777	Freshwater Lake	MWDVAVTFMLMMFGGLTMIFFGVMLIFILYFLQNEVDNDR
Ga0181357_12762133	3300017777	Freshwater Lake	LMWDVLVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND
Ga0181349_10648311	3300017778	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKG
Ga0181349_11104994	3300017778	Freshwater Lake	MWDVLVTVTLMAFGAFVVISFGVILIWTLYLLQNEADND
Ga0181346_12223134	3300017780	Freshwater Lake	ADMWDVAVTFMLMMFGAFIVVAFGVILIWTLYLIQNGDRDD
Ga0181348_10971694	3300017784	Freshwater Lake	MWDVLVTFMLMLFGGLTMIFFGVMLIFILYFLQNEVDNDR
Ga0181360_1020832	3300019781	Freshwater Lake	MWDVVVTVTLMLFGAFVVIAFGAILICALYLIQNGDRDD
Ga0181361_1002795	3300019783	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGGHDDC
Ga0181359_100000633	3300019784	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKGVDDE
Ga0181359_10108546	3300019784	Freshwater Lake	MWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD
Ga0181359_10193163	3300019784	Freshwater Lake	MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEADND
Ga0181359_10199527	3300019784	Freshwater Lake	MWDVVVTMTLMLFGAFTVIVFGAIFIWALYLIQNGNRNDK
Ga0181359_10288943	3300019784	Freshwater Lake	MWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR
Ga0181359_10388632	3300019784	Freshwater Lake	MWDVLVTFMLMLFGAFAVIAFGVILIGALYFLQNEADND
Ga0181359_10388722	3300019784	Freshwater Lake	MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQNEADND
Ga0181359_10483355	3300019784	Freshwater Lake	MWDVAVTFMLMFFGAFIVIAFGAILIWTLYIIQNGDRDE
Ga0181359_10646666	3300019784	Freshwater Lake	MWDVLVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND
Ga0181359_11079301	3300019784	Freshwater Lake	MWDVTVTFMLMLFGAFVVIAFGAILIGALYFLQNEADND
Ga0181359_11620172	3300019784	Freshwater Lake	MWDVAVTFMLMGFGAFVIVAFGVILIGALYFLQNEADND
Ga0181359_12233182	3300019784	Freshwater Lake	MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND
Ga0211732_14683942	3300020141	Freshwater	MWDVLVTFMLMSFGAFFVIAFGAILIWVLYLLQNEVDHE
Ga0211736_1051048213	3300020151	Freshwater	MWDVLVTFMLMAFGAFVVIAFGAILIWVLYLLQNEVDHE
Ga0194047_102558253	3300021354	Anoxic Zone Freshwater	MWDVAVTFMLMLFGAFIVVAFGAILIWVLYIVQNVD
Ga0213921_100116917	3300021952	Freshwater	MWDVLVTFILMMFGAFMVIAIGVIFISALWYLQNEVDND
Ga0181354_10054352	3300022190	Freshwater Lake	MWDVAVTFMLMMFGAFIVVAFGAILIWTLYLIQNGDRDD
Ga0181354_10256135	3300022190	Freshwater Lake	MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGDRDDC
Ga0181354_10482656	3300022190	Freshwater Lake	MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFVQNEVDND
Ga0181354_10551722	3300022190	Freshwater Lake	MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND
Ga0181354_10564062	3300022190	Freshwater Lake	MWDVAVTFMFMMFGGLTMIFFGLMLIFILYFLQNEVDND
Ga0181354_11881272	3300022190	Freshwater Lake	MWDVLVTFMLMAFGAFAVIAFGVILIWVLYLLQNEVDHE
Ga0181351_10454215	3300022407	Freshwater Lake	MWDVLVTFMLMAFGAFIVIAFGVILIWTLYLLQNEADND
Ga0181351_11940364	3300022407	Freshwater Lake	EAMWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD
Ga0181351_12219802	3300022407	Freshwater Lake	MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVNND
Ga0214917_1000242923	3300022752	Freshwater	MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQNGVDDE
Ga0214917_100394447	3300022752	Freshwater	MWDVLVTFMLMLFGAFVIIAFGAILIGALYFIQKEVDHD
Ga0214917_101122503	3300022752	Freshwater	MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQKEVDND
Ga0214917_104570972	3300022752	Freshwater	MWDVLVTFMLMLFGAFIVIAFGAVLIGALYFLQNEADND
Ga0214921_1000197027	3300023174	Freshwater	MWDVLVTFMLMLFGAFVVIAFGAILIWTLYLLQNEADND
Ga0214921_1002041212	3300023174	Freshwater	MWDVAVTFMLMMFGAFVVVAFGAILIWALYVFQKGVDDE
Ga0214921_100893307	3300023174	Freshwater	MWDVLVTFMLMMFGAFVVVVFGAILIWTLYLLQNEADND
Ga0214921_103582192	3300023174	Freshwater	MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQKEVDND
Ga0214921_105464722	3300023174	Freshwater	MWDVVVTFMLMMFGAFVVIAFGAILIWVLYFLQNED
Ga0244775_107170713	3300024346	Estuarine	MWDVAVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND
Ga0207954_10899791	3300025606	Freshwater	WDVAVTFMLMFFGAFVVIAFGAILIWTLYLLQNEADND
Ga0209867_10584313	3300027393	Sand	MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND
Ga0208974_10440174	3300027608	Freshwater Lentic	MWDVLVTFMLMAFGAFIVIAFGVILIWVLYLLQNEVDHE
Ga0209188_10254617	3300027708	Freshwater Lake	MWDVSVTFMLMLFGAFTMIFWGALLIWVLYLLQNEADND
Ga0209297_100250223	3300027733	Freshwater Lake	MWDVLVTFMLMLFGAFVVVVFGAILIWTLYLLQNEADND
Ga0209297_100594213	3300027733	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDNE
Ga0209087_10059244	3300027734	Freshwater Lake	MWDVVVTVTLMGFGAFTVITFGVILILVLHVLQNGGDDD
Ga0209087_10600821	3300027734	Freshwater Lake	MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADND
Ga0209190_10151098	3300027736	Freshwater Lake	MEGSLMWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE
Ga0209190_13693183	3300027736	Freshwater Lake	VGDFKMWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDNE
Ga0209085_100906813	3300027741	Freshwater Lake	MWDVSVTFILMFFGAFTMIFWGALLIWVLYLLQNEADND
Ga0209085_10204752	3300027741	Freshwater Lake	MWDVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD
Ga0209189_11108573	3300027747	Freshwater Lake	MWDVAVTFMLMMFGAFIVVAFGAILIWVLYIVQNVD
Ga0209189_12018074	3300027747	Freshwater Lake	LMWDVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD
Ga0209084_12972894	3300027749	Freshwater Lake	MWDVAVTFMLMMFGAFVVVAFGAVLIWTLYVFQKGVDDE
Ga0209596_10876994	3300027754	Freshwater Lake	MWDVAVTFMLMLFGAFTLIAFGAILIWTLYIIQNGDRDE
Ga0209596_12172532	3300027754	Freshwater Lake	MEGSLMWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND
Ga0209596_12543653	3300027754	Freshwater Lake	VLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND
Ga0209596_13300383	3300027754	Freshwater Lake	MWDVAVTFILMGFGAFTVITFGVILILVLHVLQNGGDDE
Ga0209296_10148043	3300027759	Freshwater Lake	MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQKEADND
Ga0209296_10275462	3300027759	Freshwater Lake	MWDILVTFMLMMFGAFVVVVFGAILIWTLYLLQNEADND
Ga0209088_100910711	3300027763	Freshwater Lake	EMWDVAVTFMFMFFGAFIVIAFGALLIWMLYLIQNGVDDE
Ga0209086_101304003	3300027770	Freshwater Lake	MWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND
Ga0209500_101119851	3300027782	Freshwater Lake	MWDVAVTFMFMFFGAFIVIAFGALLIWMLYLIQNGVDDE
Ga0209246_101052595	3300027785	Freshwater Lake	MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDN
Ga0209400_11127674	3300027963	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGIILVWVLYFLQNEVDNE
Ga0209191_11233412	3300027969	Freshwater Lake	MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE
Ga0209298_102045592	3300027973	Freshwater Lake	MWDVLVTFMLMMFGAFAVIAFGVILIGALYFLQSEADHD
Ga0209298_102717501	3300027973	Freshwater Lake	MWDILVTFMLMMFGAFVVVVFGAILIWTLYLLQNE
Ga0247723_11543362	3300028025	Deep Subsurface Sediment	MWDVLVTFMLMLFGAFVVIAFGAILIGTLYFLQKEADND
Ga0304729_10815092	3300028392	Freshwater Lake	MWDVAVTFMLMMFGAFVVVAFGAVLIWMLYVFQKGVDDE
Ga0315291_106810743	3300031707	Sediment	MWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE
Ga0315293_112898893	3300031746	Sediment	EGSLMWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND
Ga0315288_111567322	3300031772	Sediment	MWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEIDHE
Ga0315908_115265332	3300031786	Freshwater	MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDR
Ga0315297_104091824	3300031873	Sediment	MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVD
Ga0315294_101265317	3300031952	Sediment	MWDVLVTFLLMAFGGFAVIAFGAILIGALYFLQNEADND
Ga0315294_114604513	3300031952	Sediment	MWDVVVTVTLMLFGAFIVIAFGAILIWALYLIQNGDRNDK
Ga0315274_116358762	3300031999	Sediment	MWDVLVTFMLMIFGAFAVIAFGAILIGALYFLQNEADHD
Ga0315905_102467054	3300032092	Freshwater	MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDL
Ga0315905_105228663	3300032092	Freshwater	MWDVLVTVTLMLFGAFVVIAFGAILICTLYLIQNGDRDE
Ga0315905_107175313	3300032092	Freshwater	MWDVAVTFMLMGFGAFVIVAFGVILIGALYFLQKEADND
Ga0315275_114267041	3300032401	Sediment	WDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE
Ga0334722_100955158	3300033233	Sediment	MWDVAVTFMLMLFGAFIVVAFGAILIWTLYLIQNGDRDE
Ga0334994_0286954_527_646	3300033993	Freshwater	MWDVLVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND
Ga0334979_0112967_744_863	3300033996	Freshwater	MWDVLVTVTLMAFGAFVVIAFGIILIWVLYLLQNEADHE
Ga0335036_0000633_22792_22911	3300034106	Freshwater	MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEADNE
Ga0335054_0782848_108_227	3300034119	Freshwater	MWDVLVTFLLMAFGAFFVVAFGLILIWVLYLLQNEADHE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F022157

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences