Metagenome Family F022121

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F022121
Family Type	Metagenome
Number of Sequences	216
Average Sequence Length	39 residues
Representative Sequence	MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI
Number of Associated Samples	146
Number of Associated Scaffolds	216

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	89.81 %
% of genes near scaffold ends (potentially truncated)	9.72 %
% of genes from short scaffolds (< 2000 bps)	77.78 %
Associated GOLD sequencing projects	128
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (98.611 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.074 % of family members)
Environment Ontology (ENVO)	Unclassified (48.148 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (59.722 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 216 Family Scaffolds
PF02754	CCG	40.74
PF01012	ETF	39.81
PF13183	Fer4_8	6.48
PF02771	Acyl-CoA_dh_N	3.70
PF02803	Thiolase_C	0.93
PF13411	MerR_1	0.93
PF00005	ABC_tran	0.46
PF07859	Abhydrolase_3	0.46
PF12867	DinB_2	0.46
PF02826	2-Hacid_dh_C	0.46
PF00171	Aldedh	0.46
PF00285	Citrate_synt	0.46
PF00441	Acyl-CoA_dh_1	0.46
PF11716	MDMPI_N	0.46
PF00202	Aminotran_3	0.46
PF01642	MM_CoA_mutase	0.46
PF13400	Tad	0.46

COG ID	Name	Functional Category	% Frequency in 216 Family Scaffolds
COG0247	Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF	Energy production and conversion [C]	40.74
COG2048	Heterodisulfide reductase, subunit B	Energy production and conversion [C]	40.74
COG2025	Electron transfer flavoprotein, alpha subunit FixB	Energy production and conversion [C]	39.81
COG2086	Electron transfer flavoprotein, alpha and beta subunits	Energy production and conversion [C]	39.81
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	4.17
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	0.93
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.46
COG0372	Citrate synthase	Energy production and conversion [C]	0.46
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.46
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.46
COG1884	Methylmalonyl-CoA mutase, N-terminal domain/subunit	Lipid transport and metabolism [I]	0.46
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.46

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.61 %
Unclassified	root	N/A	1.39 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.61 %
Unclassified	root	N/A	1.39 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.61 %
Unclassified	root	N/A	1.39 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	37.96 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.87 %
Unclassified	root	N/A	1.39 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	37.04 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	3.24 %
Unclassified	root	N/A	1.39 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	31.02 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3.24 %
Unclassified	root	N/A	1.39 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	24.07 %
Chloroflexi bacterium 13_1_40CM_2_70_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	6.94 %
Unclassified	root	N/A	1.39 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.46 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	24.07 %
Chloroflexi bacterium 13_1_40CM_2_70_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	6.94 %
Unclassified	root	N/A	1.39 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.46 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000887\|AL16A1W_10000612	All Organisms → cellular organisms → Bacteria	5000	Open in IMG/M
3300000956\|JGI10216J12902_117057031	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300001359\|A3035W6_1122069	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1376	Open in IMG/M
3300002558\|JGI25385J37094_10043149	All Organisms → cellular organisms → Bacteria	1543	Open in IMG/M
3300002561\|JGI25384J37096_10226699	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300002562\|JGI25382J37095_10003064	All Organisms → cellular organisms → Bacteria	5585	Open in IMG/M
3300002908\|JGI25382J43887_10026350	All Organisms → cellular organisms → Bacteria	3126	Open in IMG/M
3300002908\|JGI25382J43887_10053679	All Organisms → cellular organisms → Bacteria	2190	Open in IMG/M
3300002908\|JGI25382J43887_10055088	All Organisms → cellular organisms → Bacteria	2160	Open in IMG/M
3300002911\|JGI25390J43892_10082918	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300002911\|JGI25390J43892_10146138	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	550	Open in IMG/M
3300004156\|Ga0062589_100995323	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300005166\|Ga0066674_10269002	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
3300005166\|Ga0066674_10278061	All Organisms → cellular organisms → Bacteria	789	Open in IMG/M
3300005166\|Ga0066674_10451576	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300005167\|Ga0066672_10011963	All Organisms → cellular organisms → Bacteria → Proteobacteria	4230	Open in IMG/M
3300005167\|Ga0066672_10056350	All Organisms → cellular organisms → Bacteria	2275	Open in IMG/M
3300005171\|Ga0066677_10020382	All Organisms → cellular organisms → Bacteria	3057	Open in IMG/M
3300005171\|Ga0066677_10368735	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300005171\|Ga0066677_10424598	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	760	Open in IMG/M
3300005171\|Ga0066677_10628565	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	607	Open in IMG/M
3300005172\|Ga0066683_10131441	All Organisms → cellular organisms → Bacteria	1531	Open in IMG/M
3300005172\|Ga0066683_10180357	All Organisms → cellular organisms → Bacteria	1302	Open in IMG/M
3300005175\|Ga0066673_10379540	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300005176\|Ga0066679_10076998	All Organisms → cellular organisms → Bacteria	1984	Open in IMG/M
3300005177\|Ga0066690_10390254	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	945	Open in IMG/M
3300005180\|Ga0066685_10678494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	708	Open in IMG/M
3300005445\|Ga0070708_100023411	All Organisms → cellular organisms → Bacteria	5253	Open in IMG/M
3300005445\|Ga0070708_100396480	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1301	Open in IMG/M
3300005445\|Ga0070708_100667076	All Organisms → cellular organisms → Bacteria	979	Open in IMG/M
3300005445\|Ga0070708_101627622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	601	Open in IMG/M
3300005445\|Ga0070708_102040153	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	531	Open in IMG/M
3300005445\|Ga0070708_102136821	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	517	Open in IMG/M
3300005446\|Ga0066686_10582438	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300005446\|Ga0066686_10884105	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300005450\|Ga0066682_10624905	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	673	Open in IMG/M
3300005451\|Ga0066681_10665085	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	637	Open in IMG/M
3300005451\|Ga0066681_10671937	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	633	Open in IMG/M
3300005467\|Ga0070706_100606780	All Organisms → cellular organisms → Bacteria	1017	Open in IMG/M
3300005471\|Ga0070698_100256876	All Organisms → cellular organisms → Bacteria	1680	Open in IMG/M
3300005518\|Ga0070699_100448313	All Organisms → cellular organisms → Bacteria	1170	Open in IMG/M
3300005536\|Ga0070697_100885133	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300005540\|Ga0066697_10003292	All Organisms → cellular organisms → Bacteria	7448	Open in IMG/M
3300005552\|Ga0066701_10019584	All Organisms → cellular organisms → Bacteria	3334	Open in IMG/M
3300005555\|Ga0066692_10193949	All Organisms → cellular organisms → Bacteria	1268	Open in IMG/M
3300005556\|Ga0066707_10444551	All Organisms → cellular organisms → Bacteria → Proteobacteria	842	Open in IMG/M
3300005556\|Ga0066707_10904602	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	541	Open in IMG/M
3300005558\|Ga0066698_10104814	All Organisms → cellular organisms → Bacteria	1869	Open in IMG/M
3300005559\|Ga0066700_10925700	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300005561\|Ga0066699_11231185	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	513	Open in IMG/M
3300005568\|Ga0066703_10039070	All Organisms → cellular organisms → Bacteria	2603	Open in IMG/M
3300005574\|Ga0066694_10544575	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300005575\|Ga0066702_10767801	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300006032\|Ga0066696_10017365	All Organisms → cellular organisms → Bacteria	3625	Open in IMG/M
3300006032\|Ga0066696_10536427	All Organisms → cellular organisms → Bacteria	765	Open in IMG/M
3300006032\|Ga0066696_10733860	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	633	Open in IMG/M
3300006034\|Ga0066656_10045050	All Organisms → cellular organisms → Bacteria	2524	Open in IMG/M
3300006034\|Ga0066656_10323841	All Organisms → cellular organisms → Bacteria	996	Open in IMG/M
3300006058\|Ga0075432_10171402	Not Available	844	Open in IMG/M
3300006852\|Ga0075433_10052401	All Organisms → cellular organisms → Bacteria	3555	Open in IMG/M
3300006854\|Ga0075425_100334619	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1743	Open in IMG/M
3300006854\|Ga0075425_103110377	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	506	Open in IMG/M
3300006914\|Ga0075436_101302160	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	550	Open in IMG/M
3300006914\|Ga0075436_101345653	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	541	Open in IMG/M
3300007258\|Ga0099793_10180605	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300007265\|Ga0099794_10248130	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	917	Open in IMG/M
3300009012\|Ga0066710_100200182	All Organisms → cellular organisms → Bacteria	2842	Open in IMG/M
3300009012\|Ga0066710_100308582	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2321	Open in IMG/M
3300009012\|Ga0066710_101603613	All Organisms → cellular organisms → Bacteria	997	Open in IMG/M
3300009012\|Ga0066710_102661516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	716	Open in IMG/M
3300009012\|Ga0066710_102803122	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	689	Open in IMG/M
3300009038\|Ga0099829_10042509	All Organisms → cellular organisms → Bacteria	3319	Open in IMG/M
3300009038\|Ga0099829_10316491	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	1281	Open in IMG/M
3300009038\|Ga0099829_10406371	All Organisms → cellular organisms → Bacteria	1126	Open in IMG/M
3300009088\|Ga0099830_11551198	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300009090\|Ga0099827_10043019	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3353	Open in IMG/M
3300009090\|Ga0099827_10723178	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	861	Open in IMG/M
3300009137\|Ga0066709_102429404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	711	Open in IMG/M
3300009137\|Ga0066709_103596575	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	562	Open in IMG/M
3300009147\|Ga0114129_11282929	All Organisms → cellular organisms → Bacteria	908	Open in IMG/M
3300009162\|Ga0075423_11283486	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	782	Open in IMG/M
3300010323\|Ga0134086_10464790	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	518	Open in IMG/M
3300010333\|Ga0134080_10247707	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	785	Open in IMG/M
3300010333\|Ga0134080_10264903	All Organisms → cellular organisms → Bacteria	762	Open in IMG/M
3300010335\|Ga0134063_10607310	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	557	Open in IMG/M
3300010336\|Ga0134071_10030972	All Organisms → cellular organisms → Bacteria	2333	Open in IMG/M
3300010336\|Ga0134071_10124428	All Organisms → cellular organisms → Bacteria	1241	Open in IMG/M
3300010336\|Ga0134071_10197942	All Organisms → cellular organisms → Bacteria	990	Open in IMG/M
3300010364\|Ga0134066_10249302	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300011270\|Ga0137391_10979541	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	689	Open in IMG/M
3300012003\|Ga0120163_1081699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	727	Open in IMG/M
3300012096\|Ga0137389_10125342	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2075	Open in IMG/M
3300012200\|Ga0137382_10373349	All Organisms → cellular organisms → Bacteria	1002	Open in IMG/M
3300012202\|Ga0137363_11129102	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300012203\|Ga0137399_10024002	All Organisms → cellular organisms → Bacteria	4061	Open in IMG/M
3300012203\|Ga0137399_10971283	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300012203\|Ga0137399_11595460	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	540	Open in IMG/M
3300012206\|Ga0137380_10302562	All Organisms → cellular organisms → Bacteria → Proteobacteria	1433	Open in IMG/M
3300012207\|Ga0137381_10370656	All Organisms → cellular organisms → Bacteria	1248	Open in IMG/M
3300012208\|Ga0137376_10007078	All Organisms → cellular organisms → Bacteria → Proteobacteria	7643	Open in IMG/M
3300012208\|Ga0137376_10217595	All Organisms → cellular organisms → Bacteria	1654	Open in IMG/M
3300012208\|Ga0137376_11603713	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300012209\|Ga0137379_10211923	All Organisms → cellular organisms → Bacteria	1851	Open in IMG/M
3300012210\|Ga0137378_11413185	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	609	Open in IMG/M
3300012211\|Ga0137377_11560091	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300012351\|Ga0137386_10103697	All Organisms → cellular organisms → Bacteria	2013	Open in IMG/M
3300012358\|Ga0137368_10448992	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300012361\|Ga0137360_11420916	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	597	Open in IMG/M
3300012362\|Ga0137361_11142638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	700	Open in IMG/M
3300012917\|Ga0137395_11178258	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	538	Open in IMG/M
3300012918\|Ga0137396_10072978	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2401	Open in IMG/M
3300012922\|Ga0137394_11192632	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	625	Open in IMG/M
3300012923\|Ga0137359_11645859	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	529	Open in IMG/M
3300012925\|Ga0137419_10403564	All Organisms → cellular organisms → Bacteria	1068	Open in IMG/M
3300012927\|Ga0137416_10194104	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1625	Open in IMG/M
3300012927\|Ga0137416_11934252	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	540	Open in IMG/M
3300012944\|Ga0137410_10084412	All Organisms → cellular organisms → Bacteria	2328	Open in IMG/M
3300012944\|Ga0137410_11195876	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300013758\|Ga0120147_1027123	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1077	Open in IMG/M
3300014056\|Ga0120125_1025175	All Organisms → cellular organisms → Bacteria	1263	Open in IMG/M
3300014154\|Ga0134075_10078054	All Organisms → cellular organisms → Bacteria	1388	Open in IMG/M
3300014154\|Ga0134075_10359422	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	639	Open in IMG/M
3300014154\|Ga0134075_10461431	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	566	Open in IMG/M
3300014154\|Ga0134075_10466080	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	563	Open in IMG/M
3300015241\|Ga0137418_10176584	All Organisms → cellular organisms → Bacteria	1863	Open in IMG/M
3300015245\|Ga0137409_10534909	All Organisms → cellular organisms → Bacteria	998	Open in IMG/M
3300017654\|Ga0134069_1158293	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	759	Open in IMG/M
3300017656\|Ga0134112_10172676	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300017656\|Ga0134112_10198258	All Organisms → cellular organisms → Bacteria	784	Open in IMG/M
3300017997\|Ga0184610_1063414	All Organisms → cellular organisms → Bacteria	1116	Open in IMG/M
3300018027\|Ga0184605_10001331	All Organisms → cellular organisms → Bacteria	7903	Open in IMG/M
3300018027\|Ga0184605_10098653	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	1288	Open in IMG/M
3300018027\|Ga0184605_10246899	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300018028\|Ga0184608_10420323	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	578	Open in IMG/M
3300018051\|Ga0184620_10350247	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	501	Open in IMG/M
3300018061\|Ga0184619_10067051	All Organisms → cellular organisms → Bacteria → Proteobacteria	1581	Open in IMG/M
3300018061\|Ga0184619_10515817	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	526	Open in IMG/M
3300018066\|Ga0184617_1197672	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	599	Open in IMG/M
3300018431\|Ga0066655_10029222	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2667	Open in IMG/M
3300018431\|Ga0066655_10312870	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1024	Open in IMG/M
3300018431\|Ga0066655_10518432	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300018433\|Ga0066667_10469377	All Organisms → cellular organisms → Bacteria	1031	Open in IMG/M
3300018433\|Ga0066667_11163390	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	670	Open in IMG/M
3300018433\|Ga0066667_11470828	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	601	Open in IMG/M
3300018468\|Ga0066662_10309238	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1333	Open in IMG/M
3300018468\|Ga0066662_10691062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	972	Open in IMG/M
3300018482\|Ga0066669_10118170	All Organisms → cellular organisms → Bacteria	1882	Open in IMG/M
3300018482\|Ga0066669_10704882	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	889	Open in IMG/M
3300018482\|Ga0066669_12341196	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300019879\|Ga0193723_1001989	All Organisms → cellular organisms → Bacteria	7627	Open in IMG/M
3300019885\|Ga0193747_1008483	All Organisms → cellular organisms → Bacteria	2480	Open in IMG/M
3300019885\|Ga0193747_1066140	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	892	Open in IMG/M
3300020022\|Ga0193733_1004718	All Organisms → cellular organisms → Bacteria	3915	Open in IMG/M
3300021344\|Ga0193719_10014968	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3288	Open in IMG/M
3300022694\|Ga0222623_10090775	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1186	Open in IMG/M
3300025885\|Ga0207653_10041960	All Organisms → cellular organisms → Bacteria	1504	Open in IMG/M
3300025910\|Ga0207684_10075191	All Organisms → cellular organisms → Bacteria	2871	Open in IMG/M
3300025910\|Ga0207684_10174883	All Organisms → cellular organisms → Bacteria	1851	Open in IMG/M
3300025922\|Ga0207646_10003615	All Organisms → cellular organisms → Bacteria	17309	Open in IMG/M
3300026285\|Ga0209438_1159632	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300026295\|Ga0209234_1115577	Not Available	997	Open in IMG/M
3300026296\|Ga0209235_1169989	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300026297\|Ga0209237_1002147	All Organisms → cellular organisms → Bacteria	11798	Open in IMG/M
3300026297\|Ga0209237_1016858	All Organisms → cellular organisms → Bacteria	4251	Open in IMG/M
3300026297\|Ga0209237_1237288	All Organisms → cellular organisms → Bacteria → Proteobacteria	562	Open in IMG/M
3300026300\|Ga0209027_1043273	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1695	Open in IMG/M
3300026305\|Ga0209688_1022422	All Organisms → cellular organisms → Bacteria	1222	Open in IMG/M
3300026307\|Ga0209469_1146487	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300026310\|Ga0209239_1037382	All Organisms → cellular organisms → Bacteria	2260	Open in IMG/M
3300026310\|Ga0209239_1099972	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1232	Open in IMG/M
3300026313\|Ga0209761_1093387	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1522	Open in IMG/M
3300026313\|Ga0209761_1144884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1126	Open in IMG/M
3300026313\|Ga0209761_1146037	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1120	Open in IMG/M
3300026318\|Ga0209471_1200906	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300026327\|Ga0209266_1183535	Not Available	787	Open in IMG/M
3300026328\|Ga0209802_1064192	All Organisms → cellular organisms → Bacteria	1757	Open in IMG/M
3300026328\|Ga0209802_1261123	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	587	Open in IMG/M
3300026330\|Ga0209473_1243800	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300026331\|Ga0209267_1007036	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6478	Open in IMG/M
3300026332\|Ga0209803_1006837	All Organisms → cellular organisms → Bacteria	6368	Open in IMG/M
3300026334\|Ga0209377_1104156	All Organisms → cellular organisms → Bacteria → Proteobacteria	1171	Open in IMG/M
3300026334\|Ga0209377_1223187	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300026335\|Ga0209804_1008225	All Organisms → cellular organisms → Bacteria	5751	Open in IMG/M
3300026527\|Ga0209059_1154682	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300026529\|Ga0209806_1019274	All Organisms → cellular organisms → Bacteria	3523	Open in IMG/M
3300026530\|Ga0209807_1000228	All Organisms → cellular organisms → Bacteria	25027	Open in IMG/M
3300026536\|Ga0209058_1014604	All Organisms → cellular organisms → Bacteria → Proteobacteria	5394	Open in IMG/M
3300026536\|Ga0209058_1208267	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	790	Open in IMG/M
3300026542\|Ga0209805_1002540	All Organisms → cellular organisms → Bacteria	10615	Open in IMG/M
3300026548\|Ga0209161_10019342	All Organisms → cellular organisms → Bacteria → Proteobacteria	4925	Open in IMG/M
3300026548\|Ga0209161_10024298	All Organisms → cellular organisms → Bacteria	4283	Open in IMG/M
3300027181\|Ga0208997_1056577	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	585	Open in IMG/M
3300027277\|Ga0209846_1065866	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300027388\|Ga0208995_1081204	All Organisms → cellular organisms → Bacteria	567	Open in IMG/M
3300027643\|Ga0209076_1085594	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	896	Open in IMG/M
3300027846\|Ga0209180_10275979	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	965	Open in IMG/M
3300027846\|Ga0209180_10635129	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6	587	Open in IMG/M
3300027875\|Ga0209283_10113075	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1784	Open in IMG/M
3300027882\|Ga0209590_10784119	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	606	Open in IMG/M
3300027903\|Ga0209488_10389911	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1032	Open in IMG/M
3300028719\|Ga0307301_10073321	All Organisms → cellular organisms → Bacteria	1069	Open in IMG/M
3300028722\|Ga0307319_10251355	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	582	Open in IMG/M
3300028784\|Ga0307282_10076386	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1529	Open in IMG/M
3300028792\|Ga0307504_10069147	All Organisms → cellular organisms → Bacteria	1056	Open in IMG/M
3300028807\|Ga0307305_10332602	All Organisms → cellular organisms → Bacteria	690	Open in IMG/M
3300028814\|Ga0307302_10169186	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1062	Open in IMG/M
3300028881\|Ga0307277_10011491	All Organisms → cellular organisms → Bacteria	3411	Open in IMG/M
3300028881\|Ga0307277_10102347	All Organisms → cellular organisms → Bacteria	1216	Open in IMG/M
3300028881\|Ga0307277_10336577	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	672	Open in IMG/M
3300028881\|Ga0307277_10543336	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	522	Open in IMG/M
3300028884\|Ga0307308_10127083	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300031199\|Ga0307495_10192023	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	556	Open in IMG/M
3300031720\|Ga0307469_10461996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1102	Open in IMG/M
3300031720\|Ga0307469_11365590	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	675	Open in IMG/M
3300032180\|Ga0307471_100762399	All Organisms → cellular organisms → Bacteria → Proteobacteria	1134	Open in IMG/M
3300032205\|Ga0307472_100048077	All Organisms → cellular organisms → Bacteria	2636	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	96.30%
Host-Associated	Host-Associated	3.70%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	91.67%
Aquatic	Environmental → Aquatic	4.63%
Plants	Host-Associated → Plants	3.70%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	91.67%
Sediment	Environmental → Aquatic → Sediment	4.63%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.70%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	81.48%
Loam	Environmental → Terrestrial → Soil → Loam	9.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.70%
Sand	Environmental → Terrestrial → Soil → Sand	0.46%

Habitat	Taxonomy	Distribution
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	41.67%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	35.19%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.48%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.70%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.31%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.31%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.93%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.46%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	24.07%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	20.37%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	17.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.87%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	6.94%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.48%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.17%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.70%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.31%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.31%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.93%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.46%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.46%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000887	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001359	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina	Environmental	Open in IMG/M
3300002558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm	Environmental	Open in IMG/M
3300002561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm	Environmental	Open in IMG/M
3300002562	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012003	Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013758	Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M	Environmental	Open in IMG/M
3300014056	Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300019885	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2	Environmental	Open in IMG/M
3300020022	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026305	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)	Environmental	Open in IMG/M
3300026307	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)	Environmental	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026330	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)	Environmental	Open in IMG/M
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026334	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental	Open in IMG/M
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027181	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027277	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027388	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental	Open in IMG/M
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AL16A1W_100006125	3300000887	Permafrost	MDLTDGQTIFAIAMTFVMLVVAFAVVAFALWYSGDQQEI*
JGI10216J12902_1170570312	3300000956	Soil	MDLTDGTTIFAIAITLVLLVVAFAVVAFALWYSGDQQSI*
A3035W6_11220692	3300001359	Permafrost	MDLTDGQTIFAIAFTLVMLVVAFAVVVFALWYTGDQQSI*
JGI25385J37094_100431492	3300002558	Grasslands Soil	VELFDAQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL*
JGI25384J37096_102266992	3300002561	Grasslands Soil	VDLFDGQMIFGVVFALVALAVAFGAVGFALWYSGDQTEI*
JGI25382J37095_100030645	3300002562	Grasslands Soil	VDLTDGTTIFAIAFAFIALAAAFGAVAFALWYGGDQTEL*
JGI25382J43887_100263502	3300002908	Grasslands Soil	MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQQI*
JGI25382J43887_100536792	3300002908	Grasslands Soil	VNLTDSTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL*
JGI25382J43887_100550882	3300002908	Grasslands Soil	VDLGGIPIDGQTIFAIVFVLVALVVAGGVVGFALWWSGDQTEL*
JGI25390J43892_100829182	3300002911	Grasslands Soil	VDLTDGTTIFAIVFAFIALAVAFGAVAFALWYAGDGADI*
JGI25390J43892_101461382	3300002911	Grasslands Soil	MDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET*
Ga0062589_1009953232	3300004156	Soil	MDLTDGQTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI*
Ga0066674_102690022	3300005166	Soil	VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL*
Ga0066674_102780612	3300005166	Soil	VDLTDGTTIFAIAFTLVLLVVAFAVVAFALWYTGGQQEI*
Ga0066674_104515762	3300005166	Soil	MDFTDGTTIFAIVFAFVMLAVAFGAVAFALWYSGDQQET*
Ga0066672_100119633	3300005167	Soil	MDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGDQQEI*
Ga0066672_100563502	3300005167	Soil	VDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI*
Ga0066677_100203823	3300005171	Soil	VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET*
Ga0066677_103687352	3300005171	Soil	VDLGGITIDGQTIFAIVFVLIALMIAGGVVGFALWWSGDQTEL*
Ga0066677_104245982	3300005171	Soil	VDLFDGQTIFAIAFTLVALAVAFAVVGFALWYAGDQQQL*
Ga0066677_106285651	3300005171	Soil	MDLFDGQTIFAIVFALVALAVAGGAVAFALWYQGDQQEL*
Ga0066683_101314411	3300005172	Soil	VDLTDGQTIFAIAFTVVMLMVAFAAVAFALWYSGDQQEI*
Ga0066683_101803572	3300005172	Soil	VDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI*
Ga0066673_103795402	3300005175	Soil	MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGEQQEI*
Ga0066679_100769982	3300005176	Soil	MVDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQQT*
Ga0066690_103902541	3300005177	Soil	VDLFDGQTVFAIAFTLVALAVAFAVVGFALWYAGDQQQL*
Ga0066685_106784942	3300005180	Soil	VDLTDGQTIFAIVFTVVMLMVAFAAVAFALWYSGDQQEI*
Ga0070708_1000234115	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	VDLTGGTAIFAIVFAFIALAVAFGAVAFALWYSGDQTEL*
Ga0070708_1003964802	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MDLTDGTTIFAIVFTFVMLAIAFAVVAFALWYSGDQQSL*
Ga0070708_1006670762	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0070708_1016276222	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MDLADGTTIFAIAFTLVMLGIAFAVVVFALWYTGDQQEI*
Ga0070708_1020401532	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MDLSDGETIFSVVFALVALAVAFGAVAFALWYSGDQTEI*
Ga0070708_1021368212	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQEI*
Ga0066686_105824382	3300005446	Soil	MDLFDGQTIFAVAFALVALAVAFGAVAFALWYSGDQTEL*
Ga0066686_108841052	3300005446	Soil	VDLTDGQTIFAIVFTVVMLMVAFAAVAFALWYSGDQQET*
Ga0066682_106249051	3300005450	Soil	ELMDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0066681_106650851	3300005451	Soil	GELMDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGEQQEI*
Ga0066681_106719372	3300005451	Soil	MDLTDGQTIFAITFTFVMLVVAFAVVAFALWYTGDQQSI*
Ga0070706_1006067802	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MDFTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0070698_1002568762	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MDLTDGTTIFAIAFTFVMLAIAFAVVAFALWYSGDQQSL*
Ga0070699_1004483132	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MDLTDGTTIFAIAFTLVMLGIAFAVVVFALWYTGDQQEI*
Ga0070697_1008851332	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	VDLTGGTAIFAIVFAFIALAVAFGAVAFALWYGGDQTEL*
Ga0066697_100032922	3300005540	Soil	MDSQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL*
Ga0066701_100195844	3300005552	Soil	MDGQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL*
Ga0066692_101939492	3300005555	Soil	VDLTGGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL*
Ga0066707_104445512	3300005556	Soil	VDFTDGTTIFAIAFTLVMLAIAFGVVVFALWYTGDQQEI*
Ga0066707_109046021	3300005556	Soil	MDLFDGQTIFAIVFALVALAVTGGAVAFALWYQGDQQEL*
Ga0066698_101048143	3300005558	Soil	MDFTDGQTIFAIVFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0066700_109257002	3300005559	Soil	MDLFDGQTIFAIVFALVALTVAGGAVTFALWYQGDQQEL*
Ga0066699_112311852	3300005561	Soil	VDFTDGSTIFAIAFTLMMLAIAFAVVVFALWYTGDQQEI*
Ga0066703_100390702	3300005568	Soil	MDLADGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0066694_105445752	3300005574	Soil	MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGNQQEI*
Ga0066702_107678012	3300005575	Soil	MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGEQQSI*
Ga0066696_100173655	3300006032	Soil	TDGTTIFAIVFAFVMLAVAFGAVAFALWYSGDQQET*
Ga0066696_105364272	3300006032	Soil	MDFTDGTTIFAIVFTFVMLAVASGAVAFALWYSGDQQET*
Ga0066696_107338602	3300006032	Soil	MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGEQQEI*
Ga0066656_100450502	3300006034	Soil	VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTQL*
Ga0066656_103238412	3300006034	Soil	VDLTDGQTIFAIALTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0075432_101714021	3300006058	Populus Rhizosphere	MEFDGQTTFAIGATIVLIVVAFATVVFALWYSGDQKEI*
Ga0075433_100524013	3300006852	Populus Rhizosphere	MDLTDGTTIFAIAFTLVMLVVAFAVVAFALWYSGEQQEI*
Ga0075425_1003346193	3300006854	Populus Rhizosphere	VDFTDGTTIFAIVFTLVMLAVAFGAVAFALWYSGEQQEI*
Ga0075425_1031103772	3300006854	Populus Rhizosphere	MEFDGQTTFAIGATIVLIVVALATVVFALWYSGDQKEI*
Ga0075436_1013021602	3300006914	Populus Rhizosphere	MDFTDGTTIFAILSTFVMLAVAFAVVAFALWYSGDQQE
Ga0075436_1013456532	3300006914	Populus Rhizosphere	VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGEQQEI*
Ga0099793_101806052	3300007258	Vadose Zone Soil	MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQQI*
Ga0099794_102481302	3300007265	Vadose Zone Soil	VDVTDGQTIFAIAFTFVMLAIAFAVVAFALWYSGDQQEI*
Ga0066710_1002001823	3300009012	Grasslands Soil	VAAQTIVAIVFAFVALAIAGGAVAFALRYQGDQAEL
Ga0066710_1003085823	3300009012	Grasslands Soil	VDLTDGQTIFAIALTFVMLVVAFAVVAFALWYSGDQQEI
Ga0066710_1016036132	3300009012	Grasslands Soil	VDLTDGTTIFAIAVTLVLLVVAFAVVVFALWYTGDQQEI
Ga0066710_1026615162	3300009012	Grasslands Soil	MDLFDGQTIFAVAFALVALAVAFGAVAFALWYSGDQTEL
Ga0066710_1028031222	3300009012	Grasslands Soil	KLMDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGDQQEI
Ga0099829_100425093	3300009038	Vadose Zone Soil	MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQQI*
Ga0099829_103164913	3300009038	Vadose Zone Soil	MDLSDGTTIFAIAFTLVMLVVAFAVVAFALWYTGDQQEI*
Ga0099829_104063712	3300009038	Vadose Zone Soil	MDLTDGTTIFAIVFTFVMLAIAFAVVAFALWYSGDQQEI*
Ga0099830_115511982	3300009088	Vadose Zone Soil	VAAQTIFAILFAFVALAVAGGAVAFALWYQGDQTEL*
Ga0099827_100430192	3300009090	Vadose Zone Soil	VNLTDSTTIFAIVFAFIALAVAFGAIAFALWYGGDQTEL*
Ga0099827_107231782	3300009090	Vadose Zone Soil	VDLLDGQTIFAVAFALVALAVAFGAVAFALWYSGDQSEL*
Ga0066709_1024294042	3300009137	Grasslands Soil	VDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0066709_1035965752	3300009137	Grasslands Soil	MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQKI*
Ga0114129_112829292	3300009147	Populus Rhizosphere	MDLTDGTTIFAIAFTIVMLVVAFAVVGFALWYSGDQQEI*
Ga0075423_112834862	3300009162	Populus Rhizosphere	MDLTDPQTLFAIAFAIVALAVAFGAVGFALWYAGEQTEL*
Ga0134086_104647901	3300010323	Grasslands Soil	VDLTDGQTIFAIAFTIVMLMVAFAAVAFALWYSGDQQEI*
Ga0134080_102477072	3300010333	Grasslands Soil	MDLTDGTTIFAIAFTFVILVIAFAVVVFALWYTGDQQEI*
Ga0134080_102649032	3300010333	Grasslands Soil	MDFTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL*
Ga0134063_106073102	3300010335	Grasslands Soil	VDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQ
Ga0134071_100309722	3300010336	Grasslands Soil	VNLTDSTTVFAIVFAFIALAVAFGAVAFALWYAGDQTEL*
Ga0134071_101244282	3300010336	Grasslands Soil	MDLTDGTTIFAIAFTLVMLVAAFAVVAFALWYTGDQQEI*
Ga0134071_101979422	3300010336	Grasslands Soil	VDFTDGTTIFAIAFTLVMLAIAFAVVGFALWYTGDQQEI*
Ga0134066_102493022	3300010364	Grasslands Soil	MVLFDGQTIFAIVFALVALAVTGGAVAFALWYQGDQQEL*
Ga0137391_109795412	3300011270	Vadose Zone Soil	MDLTDGTTIFAIAFTLVMLVVAFAVVAFALWYSGDQQQI*
Ga0120163_10816992	3300012003	Permafrost	VDLTDGQTIFANAFTFAMLVVAFAVVVFALWYTGDQQEI*
Ga0137389_101253422	3300012096	Vadose Zone Soil	MDLTDGTTIFAIAFTLVMLVVAFAVIAFALWYSGEQ*
Ga0137382_103733492	3300012200	Vadose Zone Soil	MDLTDGTTIFAIAFTLVLLAVAFAVVVFALWYTGDQQEI*
Ga0137363_111291022	3300012202	Vadose Zone Soil	MDLTDGTTIFAIAFTFLMLVIAFAVVVFALWYTGDQQEI*
Ga0137399_100240024	3300012203	Vadose Zone Soil	MVDFTDGTTIFAIVFTFVMLAVAFGAVTFALWYSGDQQET*
Ga0137399_109712832	3300012203	Vadose Zone Soil	MDLTDGTTIFAITFTFVLLAVAFAVVAFALWYSGDQQEI*
Ga0137399_115954602	3300012203	Vadose Zone Soil	VDLTDGTTIFAIVFAFIALAIAFSAVAFALWYAGDGADI*
Ga0137380_103025622	3300012206	Vadose Zone Soil	MDLTDGTTIFAIAFTLVMLVVAFAVVVFALWYSGDQQEI*
Ga0137381_103706562	3300012207	Vadose Zone Soil	MDLTDGTTIFAIAFTFVMLVITFAVIVFALWYTGDQQQI*
Ga0137376_100070786	3300012208	Vadose Zone Soil	VDLTDGTTISAIVFAFIALAVAFGAVAFALWYGGDQTEL*
Ga0137376_102175952	3300012208	Vadose Zone Soil	MDLTDGTTIFAIAFTLVLLVVAFAVVAFALWYSGDQQEI*
Ga0137376_116037132	3300012208	Vadose Zone Soil	VDLFDGQTIFAIAFTLVALAVAFAAVGFALWYSGDQQQL*
Ga0137379_102119232	3300012209	Vadose Zone Soil	MDLMDGTTIFAIVFALVMLAVAFGAVAFALWYSGDQQET*
Ga0137378_114131852	3300012210	Vadose Zone Soil	MDLTDGTTIFAIAFTFMMLVVAFAVVVFALWYTGDQQEI*
Ga0137377_115600912	3300012211	Vadose Zone Soil	MDLTDGQTIFAIAFTFVVLVVAFAVVAFALWYSGDQQQI*
Ga0137386_101036972	3300012351	Vadose Zone Soil	VDLTDGTTIFAIAFTLVLLVVAVAVVVFALWYTGDQQEI*
Ga0137368_104489922	3300012358	Vadose Zone Soil	VDLNDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0137360_114209162	3300012361	Vadose Zone Soil	MDLTDGTTIFAIAFTFVMLVIAFAVVAFALWYSGDLQEI*
Ga0137361_111426382	3300012362	Vadose Zone Soil	VDLTDGQTIFAIASTVVLLVIAFAVVAFALWYTGDQQEI*
Ga0137395_111782582	3300012917	Vadose Zone Soil	MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQEI*
Ga0137396_100729783	3300012918	Vadose Zone Soil	MDLTDGTTIFAIVSTFVMLALAFAVVAFALWYSGDQQEI*
Ga0137394_111926322	3300012922	Vadose Zone Soil	VDLTDGTTIFAIVFAFVALGVAFGAVAFALWYGGDQTEL*
Ga0137359_116458592	3300012923	Vadose Zone Soil	MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI*
Ga0137419_104035642	3300012925	Vadose Zone Soil	MDLNDGRTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0137416_101941042	3300012927	Vadose Zone Soil	MVDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET*
Ga0137416_119342522	3300012927	Vadose Zone Soil	MDLTDGTTIFAIVSTFVLLAVAFAVVAFALWYSGDQQEI*
Ga0137410_100844124	3300012944	Vadose Zone Soil	MDLTDGTTVFAIAFTFVLLAVAFAVVAFALWYSGDQQEI*
Ga0137410_111958762	3300012944	Vadose Zone Soil	VDLTDGQTIFAIAFTFVVLVVAFAVVAFALWYSGDQQEI*
Ga0120147_10271234	3300013758	Permafrost	MDLTDGQTIFAIAFTLVMLVVAFAVVVFALWYTGDQQEI*
Ga0120125_10251752	3300014056	Permafrost	MDLTDGQTIFAIAFTLGMLVVAFAVVVFALWYTGDQQSI*
Ga0134075_100780542	3300014154	Grasslands Soil	MDLFGGQTIFAVAFALVALAVAFGAVAFALWYSGDQTEL*
Ga0134075_103594222	3300014154	Grasslands Soil	VDLTDGTTIFAIVFAFIALAVAFGAVAFALWYAGDQTEL*
Ga0134075_104614312	3300014154	Grasslands Soil	MDLTDGQTIFAIAFTVVMLMVAFAAVAFALWYSGDQQEI*
Ga0134075_104660802	3300014154	Grasslands Soil	VDLTDGTTIFAIVFTLVLLVVAFAVVVFALWYTGDQQEI*
Ga0137418_101765842	3300015241	Vadose Zone Soil	MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI*
Ga0137409_105349091	3300015245	Vadose Zone Soil	GELVDLTDGTTIFAIAFAFIALAAAFGAVAFALWYGGDQTEL*
Ga0134069_11582932	3300017654	Grasslands Soil	VDLTDGTTIFAIAFTLVLLVVAFAVVAFALWYTGGQQEI
Ga0134112_101726762	3300017656	Grasslands Soil	VDLTDGETIFAIALTFVMLVVAFAVVAFALWYSGDQQEI
Ga0134112_101982582	3300017656	Grasslands Soil	MAAQTIFAILFAFVALAVAGGAVAFALWYQGDQTEL
Ga0184610_10634142	3300017997	Groundwater Sediment	VDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYSGDQQEI
Ga0184605_100013313	3300018027	Groundwater Sediment	VDLTDGTTISAIVFAFIALAVAFGAVAFALWYAGDQTEL
Ga0184605_100986533	3300018027	Groundwater Sediment	MDLTDGQTIFAIAFTFVMLVVAFAVVVFALWYTGDQQEI
Ga0184605_102468992	3300018027	Groundwater Sediment	MDLTDGTTIFAIAFTFVLLVVAFAVVVFALWYTGDQQEI
Ga0184608_104203232	3300018028	Groundwater Sediment	MDLTDGTTIFAIAFTFVMLVVAFAVVVFALWYTGDQQQI
Ga0184620_103502472	3300018051	Groundwater Sediment	MDLTDGQTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI
Ga0184619_100670512	3300018061	Groundwater Sediment	VDLTDGTTISAIVFAFIALAVAFGAVAFALWYGGDQTEL
Ga0184619_105158172	3300018061	Groundwater Sediment	MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYTGDQQQI
Ga0184617_11976721	3300018066	Groundwater Sediment	MDLTDGTTIFAIAFTFVMLVVAFAVVVFALWYTGDQQEI
Ga0066655_100292223	3300018431	Grasslands Soil	VDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI
Ga0066655_103128702	3300018431	Grasslands Soil	MDSQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL
Ga0066655_105184322	3300018431	Grasslands Soil	VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL
Ga0066667_104693772	3300018433	Grasslands Soil	VDLGGITIDGQTIFAIVFVLIALMIAGGVVGFALWWSGDQTEL
Ga0066667_111633902	3300018433	Grasslands Soil	MDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET
Ga0066667_114708282	3300018433	Grasslands Soil	VELFDAQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL
Ga0066662_103092383	3300018468	Grasslands Soil	CGEAAELVNQTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL
Ga0066662_106910622	3300018468	Grasslands Soil	MDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGDQQEI
Ga0066669_101181702	3300018482	Grasslands Soil	MDLFDGQTIFAIVFALVALAVTGGAVAFALWYQGDQQEL
Ga0066669_107048821	3300018482	Grasslands Soil	MDLTDGTIFAIAFTFVMLVVAFAVVAFALWYSGDQPEI
Ga0066669_123411962	3300018482	Grasslands Soil	MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI
Ga0193723_10019895	3300019879	Soil	MDLTDGQTIFAIAMTFVMLVIAFAVVVFALWYTGDQSEI
Ga0193747_10084833	3300019885	Soil	MDLTDGTTIFAIAITFVILVVAFAVVVFALWYTGDQQEI
Ga0193747_10661401	3300019885	Soil	MDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGD
Ga0193733_10047184	3300020022	Soil	MDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGDQQQI
Ga0193719_100149683	3300021344	Soil	MDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGDQQEI
Ga0222623_100907751	3300022694	Groundwater Sediment	TDGTTIFAIAFTFVLLVVAFAVVAFALWYSGDQQEI
Ga0207653_100419602	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MDLTDGTTIFAVAFTLVMLVVAFAVVAFALWYSGEQQEI
Ga0207684_100751912	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MEFDGQTMFALAFTIVAVAIAFGTVAFALWYGGDQTEL
Ga0207684_101748832	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQEI
Ga0207646_100036153	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI
Ga0209438_11596322	3300026285	Grasslands Soil	MDLTDGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI
Ga0209234_11155771	3300026295	Grasslands Soil	DLFDGQTIFAIVFALIALSVVGGVVAFALWYQGDQQEI
Ga0209235_11699892	3300026296	Grasslands Soil	VELFDAQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL
Ga0209237_10021476	3300026297	Grasslands Soil	VNLTDSTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL
Ga0209237_10168584	3300026297	Grasslands Soil	VDLGGIPIDGQTIFAIVFVLVALVVAGGVVGFALWWSGDQTEL
Ga0209237_12372882	3300026297	Grasslands Soil	MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQQI
Ga0209027_10432732	3300026300	Grasslands Soil	VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET
Ga0209688_10224222	3300026305	Soil	MDFTDGTTIFAIVFAFVMLAVAFGAVAFALWYSGDQQET
Ga0209469_11464872	3300026307	Soil	VDLTDGTTIFAIAFTLVLLVVAFAVIVFALWYTGDQQEI
Ga0209239_10373822	3300026310	Grasslands Soil	VDLTDGTTIFAIVFAFIALAVAFGAVAFALWYAGDGADI
Ga0209239_10999723	3300026310	Grasslands Soil	MDLFDGQTIFAIVFALVALAVAGGAVAFALWYQGDQQEL
Ga0209761_10933873	3300026313	Grasslands Soil	VDLTDGTTIFAIAFAFIALAAAFGAVAFALWYGGDQTEL
Ga0209761_11448843	3300026313	Grasslands Soil	VDLFDGQMIFGVVFALVALAVAFGAVGFALWYSGDQTEI
Ga0209761_11460371	3300026313	Grasslands Soil	ARELMDLTDGQTIFAIAFTFVMLVVAFAVVVFALWYTGDQQEI
Ga0209471_12009062	3300026318	Soil	VDLFDGQTIFAIAFTLVALAVAFAVVGFALWYGGDQQQL
Ga0209266_11835352	3300026327	Soil	VDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI
Ga0209802_10641923	3300026328	Soil	VDGQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL
Ga0209802_12611231	3300026328	Soil	MDGQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL
Ga0209473_12438002	3300026330	Soil	VDLFDGQTIFAIAFTLVALAVAFAVVGFALWYAGDQQQL
Ga0209267_10070366	3300026331	Soil	MDFTDGTTIFAIVFAFVMLAVAFGAVALALWYSGDQQET
Ga0209803_10068378	3300026332	Soil	VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTE
Ga0209377_11041562	3300026334	Soil	VDLTGGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL
Ga0209377_12231872	3300026334	Soil	VELFDAQTIFAIVFALAALGVAGGAVAFALWYQGDQTEL
Ga0209804_10082251	3300026335	Soil	MDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGD
Ga0209059_11546822	3300026527	Soil	MDGQTIFAIVFAIVSLAVAGGAVAFALWYQGDQTEL
Ga0209806_10192743	3300026529	Soil	MDLADGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI
Ga0209807_100022818	3300026530	Soil	VDFTDGTTIFAIAFTLVMLAIAFGVVVFALWYTGDQQEI
Ga0209058_10146046	3300026536	Soil	MDFTDGQTIFAIVFTFVMLVVAFAVVAFALWYSGDQQEI
Ga0209058_12082672	3300026536	Soil	LVDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI
Ga0209805_10025404	3300026542	Soil	VDFTDGTTIFAIVFTFVMLAVAFGAVAFWYSGDQQET
Ga0209161_100193424	3300026548	Soil	VDFTDGTTIFAIAFTLVMLSIAFGVVVFALWYTGDQQEI
Ga0209161_100242985	3300026548	Soil	VDFADGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI
Ga0208997_10565772	3300027181	Forest Soil	VDLTDGTTIFAIVFAFIALAIAFSAVAFALWYAGDQQEL
Ga0209846_10658662	3300027277	Groundwater Sand	VDLTDGQTIFAIAFTFVVLVVAFAVVAFALWYSGDQQEI
Ga0208995_10812042	3300027388	Forest Soil	MVDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET
Ga0209076_10855942	3300027643	Vadose Zone Soil	MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQQI
Ga0209180_102759792	3300027846	Vadose Zone Soil	MDLSDGTTIFAIAFTLVMLVVAFAVVAFALWYTGDQQEI
Ga0209180_106351291	3300027846	Vadose Zone Soil	MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQQI
Ga0209283_101130753	3300027875	Vadose Zone Soil	MDLTDGQTIFAIAMTFVMLVVAFAVVAFALWYSGDQQEI
Ga0209590_107841192	3300027882	Vadose Zone Soil	GEDRKLVDLTDGQTVFAIAFTLVMLAIAFAVVAFALWYSGDQQEI
Ga0209488_103899112	3300027903	Vadose Zone Soil	MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGEQQEI
Ga0307301_100733212	3300028719	Soil	MDLTDGTTIFAIAFTFLMLVVAFAVVAFALWYSGDQQQI
Ga0307319_102513551	3300028722	Soil	MELTDGQTIFAIAITFVMLVVAFAVVAFALWYSGDQQEI
Ga0307282_100763862	3300028784	Soil	MDLIDGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI
Ga0307504_100691472	3300028792	Soil	MDLTDGTTIFALAVTFEMLVIAFAVVVFALWYTGEQQEI
Ga0307305_103326022	3300028807	Soil	MDLSDGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI
Ga0307302_101691861	3300028814	Soil	MDLTDGQTIFAIAFTFVILVVAFAVVVFALWYTGDQQSI
Ga0307277_100114915	3300028881	Soil	MDFTDGTTIFAIAFTFVLLVVAFAVVGFALWYSGDQQEI
Ga0307277_101023472	3300028881	Soil	MDLTDGTTIFAIAFTLVLLAVAFGVVVFALWYTGDQQEI
Ga0307277_103365771	3300028881	Soil	DLTDGQTIFAIAITFVMVVVAFAVVVFALWYTGEQQEI
Ga0307277_105433362	3300028881	Soil	DGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI
Ga0307308_101270833	3300028884	Soil	RRGEAGELMDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGDQQEI
Ga0307495_101920231	3300031199	Soil	MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGEQQEI
Ga0307469_104619962	3300031720	Hardwood Forest Soil	MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQEI
Ga0307469_113655902	3300031720	Hardwood Forest Soil	MDLTDGQTIFAIAFTFVMLVIAFAVVVFALWYTGDQQEI
Ga0307471_1007623992	3300032180	Hardwood Forest Soil	VDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI
Ga0307472_1000480772	3300032205	Hardwood Forest Soil	VDLFDGQTIFAIAFTLVALAVAFAAVGFALWYSGDQQEL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F022121

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences