NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022077

Metagenome / Metatranscriptome Family F022077

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022077
Family Type Metagenome / Metatranscriptome
Number of Sequences 216
Average Sequence Length 55 residues
Representative Sequence MLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Number of Associated Samples 160
Number of Associated Scaffolds 216

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 22.22 %
% of genes near scaffold ends (potentially truncated) 44.44 %
% of genes from short scaffolds (< 2000 bps) 97.22 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.537 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(20.833 % of family members)
Environment Ontology (ENVO) Unclassified
(49.537 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(70.833 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.45%    β-sheet: 33.33%    Coil/Unstructured: 39.22%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 216 Family Scaffolds
PF00069Pkinase 37.04
PF00566RabGAP-TBC 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 216 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 148.15

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10228576All Organisms → cellular organisms → Eukaryota516Open in IMG/M
3300002408|B570J29032_109855402All Organisms → cellular organisms → Eukaryota1685Open in IMG/M
3300002835|B570J40625_100403024All Organisms → cellular organisms → Eukaryota1328Open in IMG/M
3300003216|JGI26079J46598_1092305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300003860|Ga0031658_1015720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1276Open in IMG/M
3300003909|JGI26087J52781_1023606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae658Open in IMG/M
3300003910|JGI26437J51864_10151398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300004126|Ga0066179_10126158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea676Open in IMG/M
3300004795|Ga0007756_11359564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300005043|Ga0071100_1120124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae593Open in IMG/M
3300005516|Ga0066831_10034681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1370Open in IMG/M
3300005516|Ga0066831_10038565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1297Open in IMG/M
3300005516|Ga0066831_10051802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1111Open in IMG/M
3300005516|Ga0066831_10055235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1074Open in IMG/M
3300005516|Ga0066831_10155783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea621Open in IMG/M
3300005580|Ga0049083_10308529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea529Open in IMG/M
3300005599|Ga0066841_10084164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae535Open in IMG/M
3300005838|Ga0008649_10094363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1243Open in IMG/M
3300005942|Ga0070742_10126310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae709Open in IMG/M
3300005988|Ga0075160_10170843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia1199Open in IMG/M
3300005988|Ga0075160_10193533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1119Open in IMG/M
3300006037|Ga0075465_10083733All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae → Rattus → Rattus norvegicus697Open in IMG/M
3300006165|Ga0075443_10049434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1412Open in IMG/M
3300006383|Ga0075504_1308669All Organisms → cellular organisms → Eukaryota815Open in IMG/M
3300006401|Ga0075506_1795444All Organisms → cellular organisms → Eukaryota893Open in IMG/M
3300006415|Ga0099654_10539670All Organisms → cellular organisms → Eukaryota1694Open in IMG/M
3300006641|Ga0075471_10136394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1303Open in IMG/M
3300006803|Ga0075467_10079014All Organisms → cellular organisms → Eukaryota1991Open in IMG/M
3300006803|Ga0075467_10604836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea560Open in IMG/M
3300006875|Ga0075473_10327646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea620Open in IMG/M
3300006917|Ga0075472_10204314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea971Open in IMG/M
3300006917|Ga0075472_10258701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea857Open in IMG/M
3300007513|Ga0105019_1123618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1376Open in IMG/M
3300007513|Ga0105019_1124076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1373Open in IMG/M
3300007513|Ga0105019_1173709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1095Open in IMG/M
3300007523|Ga0105052_10252384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1180Open in IMG/M
3300007552|Ga0102818_1093608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae595Open in IMG/M
3300007558|Ga0102822_1137563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae577Open in IMG/M
3300007561|Ga0102914_1056071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1237Open in IMG/M
3300007561|Ga0102914_1225656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300007600|Ga0102920_1280724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300007653|Ga0102868_1052738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae894Open in IMG/M
3300007760|Ga0105018_1098420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1068Open in IMG/M
3300007760|Ga0105018_1119381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea910Open in IMG/M
3300007760|Ga0105018_1121906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea893Open in IMG/M
3300008119|Ga0114354_1166243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae804Open in IMG/M
3300008938|Ga0103741_1124048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae525Open in IMG/M
3300008952|Ga0115651_1192040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1380Open in IMG/M
3300008952|Ga0115651_1277385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1058Open in IMG/M
3300009055|Ga0102905_1001571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3970Open in IMG/M
3300009057|Ga0102892_1048249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae802Open in IMG/M
3300009172|Ga0114995_10754528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae532Open in IMG/M
3300009172|Ga0114995_10792125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300009263|Ga0103872_1010697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea943Open in IMG/M
3300009420|Ga0114994_11013150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300009432|Ga0115005_10910495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae710Open in IMG/M
3300009434|Ga0115562_1269119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea590Open in IMG/M
3300009436|Ga0115008_10121148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1925Open in IMG/M
3300009436|Ga0115008_10266593All Organisms → cellular organisms → Eukaryota1217Open in IMG/M
3300009436|Ga0115008_10469377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae897Open in IMG/M
3300009436|Ga0115008_11135726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea589Open in IMG/M
3300009436|Ga0115008_11339253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae548Open in IMG/M
3300009436|Ga0115008_11484002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae524Open in IMG/M
3300009441|Ga0115007_10160920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1443Open in IMG/M
3300009441|Ga0115007_10194779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1307Open in IMG/M
3300009441|Ga0115007_10293773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1054Open in IMG/M
3300009441|Ga0115007_10372957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae931Open in IMG/M
3300009441|Ga0115007_10948776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea589Open in IMG/M
3300009443|Ga0115557_1231273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae713Open in IMG/M
3300009476|Ga0115555_1128842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1072Open in IMG/M
3300009495|Ga0115571_1131907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1059Open in IMG/M
3300009496|Ga0115570_10115997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1288Open in IMG/M
3300009497|Ga0115569_10130229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1228Open in IMG/M
3300009497|Ga0115569_10293186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300009498|Ga0115568_10196838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea932Open in IMG/M
3300009498|Ga0115568_10249119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae800Open in IMG/M
3300009507|Ga0115572_10570746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae624Open in IMG/M
3300009526|Ga0115004_10275203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1000Open in IMG/M
3300009537|Ga0129283_10021170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2625Open in IMG/M
3300009599|Ga0115103_1431841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae983Open in IMG/M
3300009599|Ga0115103_1608456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea672Open in IMG/M
3300009599|Ga0115103_1708122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1627Open in IMG/M
3300009599|Ga0115103_1731917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae536Open in IMG/M
3300009606|Ga0115102_10666453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae696Open in IMG/M
3300009785|Ga0115001_10950326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea515Open in IMG/M
3300010883|Ga0133547_11101954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1526Open in IMG/M
3300010883|Ga0133547_11952393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1077Open in IMG/M
3300010885|Ga0133913_10877129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2332Open in IMG/M
3300010885|Ga0133913_11913319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1478Open in IMG/M
3300010885|Ga0133913_13545747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1016Open in IMG/M
3300012408|Ga0138265_1327216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1641Open in IMG/M
3300012708|Ga0157595_1056280All Organisms → cellular organisms → Eukaryota584Open in IMG/M
3300012782|Ga0138268_1010974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea740Open in IMG/M
3300013010|Ga0129327_10605700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300013014|Ga0164295_10975873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea657Open in IMG/M
3300017783|Ga0181379_1208910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300017788|Ga0169931_10049803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae4528Open in IMG/M
3300017958|Ga0181582_10527180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea732Open in IMG/M
3300017962|Ga0181581_10761128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300018418|Ga0181567_10658156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea672Open in IMG/M
3300018692|Ga0192944_1010249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1196Open in IMG/M
3300018692|Ga0192944_1049884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae598Open in IMG/M
3300018874|Ga0192977_1105236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea558Open in IMG/M
3300018964|Ga0193087_10244404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae567Open in IMG/M
3300018968|Ga0192894_10299841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae539Open in IMG/M
3300018974|Ga0192873_10021754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2020Open in IMG/M
3300018974|Ga0192873_10234410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae799Open in IMG/M
3300018980|Ga0192961_10103734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae862Open in IMG/M
3300018982|Ga0192947_10108537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae922Open in IMG/M
3300018989|Ga0193030_10263250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae564Open in IMG/M
3300019011|Ga0192926_10416238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae566Open in IMG/M
3300019036|Ga0192945_10059909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1123Open in IMG/M
3300019036|Ga0192945_10065731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1084Open in IMG/M
3300019037|Ga0192886_10043846All Organisms → cellular organisms → Eukaryota1129Open in IMG/M
3300019045|Ga0193336_10088346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae992Open in IMG/M
3300019048|Ga0192981_10095361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1158Open in IMG/M
3300019048|Ga0192981_10099513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1135Open in IMG/M
3300019048|Ga0192981_10267286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae649Open in IMG/M
3300019050|Ga0192966_10087827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1051Open in IMG/M
3300019050|Ga0192966_10185034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea745Open in IMG/M
3300019085|Ga0188830_1005360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae939Open in IMG/M
3300019117|Ga0193054_1043117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea680Open in IMG/M
3300019117|Ga0193054_1051579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae621Open in IMG/M
3300019123|Ga0192980_1024562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1137Open in IMG/M
3300019123|Ga0192980_1037189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae933Open in IMG/M
3300019129|Ga0193436_1057404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae600Open in IMG/M
3300019150|Ga0194244_10016927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea922Open in IMG/M
3300019150|Ga0194244_10088893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae569Open in IMG/M
3300019153|Ga0192975_10121442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae951Open in IMG/M
3300020048|Ga0207193_1171399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1773Open in IMG/M
3300020083|Ga0194111_10485069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae798Open in IMG/M
3300020162|Ga0211735_11540572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea671Open in IMG/M
3300020179|Ga0194134_10059019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2064Open in IMG/M
3300020511|Ga0208593_1042621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae508Open in IMG/M
3300020513|Ga0208090_1049311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300020595|Ga0206126_10123179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1257Open in IMG/M
3300021085|Ga0206677_10208880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300021336|Ga0210307_1247745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae917Open in IMG/M
3300021350|Ga0206692_1088210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae967Open in IMG/M
3300021376|Ga0194130_10462003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300021887|Ga0063105_1030146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae541Open in IMG/M
3300021887|Ga0063105_1059246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1015Open in IMG/M
3300021910|Ga0063100_1100892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300021913|Ga0063104_1092322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae682Open in IMG/M
3300021925|Ga0063096_1065002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1083Open in IMG/M
3300021950|Ga0063101_1232071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae583Open in IMG/M
3300022937|Ga0255770_10424173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea571Open in IMG/M
3300023176|Ga0255772_10291677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae870Open in IMG/M
3300024343|Ga0244777_10267356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1085Open in IMG/M
3300024343|Ga0244777_10338975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae944Open in IMG/M
3300024346|Ga0244775_10896900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea704Open in IMG/M
3300025451|Ga0208426_1018674All Organisms → Viruses → Predicted Viral1031Open in IMG/M
3300025451|Ga0208426_1069879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300025620|Ga0209405_1159542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea572Open in IMG/M
3300025626|Ga0209716_1080074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae976Open in IMG/M
3300025694|Ga0209406_1140957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae773Open in IMG/M
3300025699|Ga0209715_1079986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1269Open in IMG/M
3300025732|Ga0208784_1040906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1447Open in IMG/M
3300025874|Ga0209533_1190600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae874Open in IMG/M
3300025890|Ga0209631_10151624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1249Open in IMG/M
3300025896|Ga0208916_10121025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1116Open in IMG/M
3300025896|Ga0208916_10251635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae768Open in IMG/M
3300026182|Ga0208275_1023140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1311Open in IMG/M
3300026182|Ga0208275_1023206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1309Open in IMG/M
3300026448|Ga0247594_1044137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae762Open in IMG/M
3300026461|Ga0247600_1024339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1145Open in IMG/M
3300026462|Ga0247568_1122032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae515Open in IMG/M
3300026500|Ga0247592_1109876All Organisms → cellular organisms → Eukaryota663Open in IMG/M
3300027192|Ga0208673_1042707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae737Open in IMG/M
3300027226|Ga0208309_1032192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae663Open in IMG/M
3300027320|Ga0208923_1034753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae899Open in IMG/M
3300027714|Ga0209815_1066596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1259Open in IMG/M
3300027719|Ga0209467_1078722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1268Open in IMG/M
3300027720|Ga0209617_10184982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea808Open in IMG/M
3300027720|Ga0209617_10391098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae509Open in IMG/M
3300027751|Ga0208304_10261595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae612Open in IMG/M
3300027782|Ga0209500_10412258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300027810|Ga0209302_10091398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1547Open in IMG/M
3300027810|Ga0209302_10110989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1371Open in IMG/M
3300028008|Ga0228674_1237039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea573Open in IMG/M
3300028137|Ga0256412_1143709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae879Open in IMG/M
3300028282|Ga0256413_1339730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae526Open in IMG/M
3300030671|Ga0307403_10714128All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300030699|Ga0307398_10148664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1207Open in IMG/M
3300030702|Ga0307399_10474213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae612Open in IMG/M
3300030709|Ga0307400_10328736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae971Open in IMG/M
3300030840|Ga0074020_11208020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1416Open in IMG/M
3300030948|Ga0073977_1607118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1016Open in IMG/M
3300031036|Ga0073978_1613993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae986Open in IMG/M
3300031231|Ga0170824_127342675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea956Open in IMG/M
3300031569|Ga0307489_10386555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea928Open in IMG/M
3300031579|Ga0308134_1107174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae639Open in IMG/M
3300031579|Ga0308134_1154715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae525Open in IMG/M
3300031602|Ga0307993_1098837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae735Open in IMG/M
3300031602|Ga0307993_1118328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea667Open in IMG/M
3300031622|Ga0302126_10335443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300031743|Ga0307382_10450858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M
3300031758|Ga0315907_10640832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea818Open in IMG/M
3300031758|Ga0315907_11204602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae530Open in IMG/M
3300031784|Ga0315899_10464252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1219Open in IMG/M
3300031784|Ga0315899_11180315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea665Open in IMG/M
3300032092|Ga0315905_10371026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1352Open in IMG/M
3300032092|Ga0315905_10859973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae781Open in IMG/M
3300032092|Ga0315905_11159499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae635Open in IMG/M
3300032517|Ga0314688_10219245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea982Open in IMG/M
3300032522|Ga0314677_10646741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae555Open in IMG/M
3300032707|Ga0314687_10615543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300032745|Ga0314704_10354027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea813Open in IMG/M
3300032755|Ga0314709_10360996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea895Open in IMG/M
3300034019|Ga0334998_0486782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae691Open in IMG/M
3300034022|Ga0335005_0180322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1322Open in IMG/M
3300034022|Ga0335005_0578175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300034022|Ga0335005_0729765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300034068|Ga0334990_0130820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1366Open in IMG/M
3300034068|Ga0334990_0679868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300034107|Ga0335037_0460387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.83%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine16.20%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.94%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.63%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine3.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.24%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.24%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.31%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.39%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.39%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.39%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.39%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.39%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.93%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.93%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.93%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.93%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.46%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.46%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.46%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.46%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.46%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.46%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.46%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.46%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.46%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.46%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.46%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.46%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.46%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.46%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.46%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004126Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007653Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3EnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020511Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027226Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027719Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1022857623300001355Pelagic MarineMLFWESKLIHKLRGKTAVPNLHYVGDEKTESGKLYHVMVMDMLGKSLEDLF*
B570J29032_10985540213300002408FreshwaterMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF*
B570J40625_10040302433300002835FreshwaterMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF*
JGI26079J46598_109230513300003216MarineLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKNYHVMVMDILGKSLEDLF*
Ga0031658_101572033300003860Freshwater Lake SedimentMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
JGI26087J52781_102360613300003909MarineFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKNYHVMVMDILGKSLEDLF*
JGI26437J51864_1015139813300003910Freshwater Lake SedimentMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMXHVMVMDLLGKSLEDLF*
Ga0066179_1012615813300004126Freshwater LakeIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0007756_1135956423300004795Freshwater LakeLAAKVEKAVKMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF*
Ga0071100_112012413300005043Marine Subseafloor AquiferEKAVKHQKHVMLFWESKLIHKLRGKTNVPNLHYVGDEKTDEGKHFHVMVMDLLGASLEDLF*
Ga0066831_1003468133300005516MarineMLFWESKLIHKLRGKTLVPNLHFVGDEKAEDGKMYHVMVMDLLGKSLEDLF*
Ga0066831_1003856523300005516MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLED*
Ga0066831_1005180223300005516MarineMLFWESKLIHKLRGKTYVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDQF*
Ga0066831_1005523533300005516MarineMLFWESKLIHKLRGKTYVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLED*
Ga0066831_1015578313300005516MarineMLFWESKLIHKMRGKTFVPNLHFVGDEKNEEGVMFHVMVMDLLGKSLEDLF*
Ga0049083_1030852923300005580Freshwater LenticMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGMMYHVMVMDLLGKS
Ga0066841_1008416413300005599MarineKKTGDFLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTDDGKMYHVMVMDMLGKSLEDLF*
Ga0008649_1009436323300005838MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF*
Ga0070742_1012631023300005942EstuarineLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF*
Ga0075160_1017084333300005988Wastewater EffluentMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF*
Ga0075160_1019353313300005988Wastewater EffluentMLFWESKLIHKLRGKTFVPFLHFVGDEKANDGKVYHVMVMDLLGKSLEDLF*
Ga0075465_1008373313300006037AqueousMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF*
Ga0075443_1004943443300006165MarineMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF*
Ga0075504_130866913300006383AqueousHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDMLGKSLEDLF*
Ga0075506_179544433300006401AqueousMLFWESKLIHKLRGKTNVPFLHYVGDEKTEDGKMYHVMVMDMLGKSLEDLF*
Ga0099654_1053967043300006415LakeLAAKVEKAVKMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF*
Ga0075471_1013639423300006641AqueousVKMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF*
Ga0075467_1007901453300006803AqueousMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0075467_1060483613300006803AqueousMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKS
Ga0075473_1032764623300006875AqueousMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLFQE
Ga0075472_1020431423300006917AqueousVKMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0075472_1025870113300006917AqueousMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDL
Ga0105019_112361823300007513MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLM*
Ga0105019_112407633300007513MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTDDGKMYHVMVMDMLGKSLEDLM*
Ga0105019_117370913300007513MarineIYRVEKKKNGDHLAAKVEKGVKNQKHIMLFWESKLMHKLKGKTAVPNLHFVGDEKTENGKIFHIMVMDQLGKSLEDLF*
Ga0105052_1025238433300007523FreshwaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTESGKMFHVMVMD*
Ga0102818_109360823300007552EstuarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTENGKMYHVMVMD*
Ga0102822_113756323300007558EstuarineMLFWESKLIHKLRGKTAVPNLHYVGDEKTEDGKLYHVMVMDMLGKSLEDLF*
Ga0102914_105607143300007561EstuarineMLFWESKLIHQLRGKTYVPALHYVGDEKCADGSVFHVMVMDLLGKSLEDLF*
Ga0102914_122565613300007561EstuarineMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKSEDGKAYHVMVMDLLGKSLEDLF*
Ga0102920_128072413300007600EstuarineMRFSNDSRFKEKAVPMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKSEDGKAYHVMVMDLLGKSLEDLF*
Ga0102868_105273823300007653EstuarineIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF*
Ga0105018_109842013300007760MarineAVKNQKHIMLYWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLM*
Ga0105018_111938123300007760MarineGEIYRVEKKKTGDYLAAKVEKAVKNQKHIMLFWESKLMHKLRGKTAVPNLHFVGDEKTENGKMFHVMVMELLGKSLEDLF*
Ga0105018_112190623300007760MarineMHKLRGKTAVPNLHFVGDEKTENGKMFHVMVMDQLGKSLEDLF*
Ga0114354_116624313300008119Freshwater, PlanktonRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF*
Ga0103741_112404823300008938Ice Edge, Mcmurdo Sound, AntarcticaIHKLRGKTLVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0115651_119204023300008952MarineMLYWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLM*
Ga0115651_127738523300008952MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDFM*
Ga0102905_100157143300009055EstuarineMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0102892_104824933300009057EstuarineLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTESGKMYHVMVMD*
Ga0114995_1075452813300009172MarineIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDMF*
Ga0114995_1079212513300009172MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDMFQECRRK
Ga0103872_101069713300009263Surface Ocean WaterWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF*
Ga0114994_1101315013300009420MarineMLFWESKLIHKMRGKTHVPNLHYVGDEKTEDGKIYHVMVMDMLGKNLEDLF*
Ga0115005_1091049513300009432MarineSKLIHKLRGKTAVPNLHYVGDEKTEDGKLYHVMVMDMLGKSLEDLF*
Ga0115562_126911923300009434Pelagic MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLF*
Ga0115008_1012114823300009436MarineMQKHIMLFWESKLIHKLRGKTHVPLLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF*
Ga0115008_1026659333300009436MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF*
Ga0115008_1046937723300009436MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDCF*
Ga0115008_1113572613300009436MarineEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF*
Ga0115008_1133925313300009436MarineIYKVEKRKTGDFLAAKVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTDDGKMYHVMVMDLLGKSLED*
Ga0115008_1148400213300009436MarineKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLED*
Ga0115007_1016092013300009441MarineMQKHIMLFWESKLIHKLRGKTHVPLLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF*
Ga0115007_1019477913300009441MarineMLFWESKLIHKLKGKTAVPNLYFVGDEKTEGGKVFHIMIMDLLGKSLEDLKAECKKFDL*
Ga0115007_1029377333300009441MarineMLFWEYKLIHKLRGKTAVPNLHYVGDEKTEDGKLYHVMVMDMLGKSLEDLF*
Ga0115007_1037295713300009441MarineMLFWESKLIHKLRGKTYVPDLHFVGDEKTEDGKLFHVMVMDLLGKSLEDLF*
Ga0115007_1094877613300009441MarineMLFWESKLIHKLRGKTNVPLLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLFQECRRK
Ga0115557_123127313300009443Pelagic MarineNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHIMVMDMLGKSLEDLF*
Ga0115555_112884213300009476Pelagic MarineVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDQF*
Ga0115571_113190713300009495Pelagic MarineKAVKNAKHIMLFWESKLMHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDQF
Ga0115570_1011599723300009496Pelagic MarineGDHLAAKVEKAVKNAKHLMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLED*
Ga0115569_1013022923300009497Pelagic MarineMLFWESKLIHKLRGKTFVPNLHFVGDEKTEDGKTYHVMVMDKLGKSLEDLF*
Ga0115569_1029318623300009497Pelagic MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTDDGKMYHVMVMDMLGKSLEDLF*
Ga0115568_1019683813300009498Pelagic MarineIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLF*
Ga0115568_1024911913300009498Pelagic MarineKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDQF*
Ga0115572_1057074623300009507Pelagic MarineSKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF*
Ga0115004_1027520313300009526MarineGDMLAAKVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHIMVMDLLGKSLED*
Ga0129283_1002117023300009537Beach Aquifer PorewaterMLFWESKLMHKLRGKSKFVYL*TLACVPYLHFVGDEKTDENKLFHVMVMDLLGPSLEDLF
Ga0115103_143184123300009599MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTENGKMYHVMVMDQLGKSLEDLF*
Ga0115103_160845613300009599MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTDDGKIYHVMVMDLLGKSMEDLF*
Ga0115103_170812223300009599MarineMQKHIMLFWESKLIHKLRGKTHVPLLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0115103_173191723300009599MarineLYKVEKKKTGDYLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVCDEKTEDGKMYHVMVMDLLGKSMEDLF*
Ga0115102_1066645313300009606MarineEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLF*
Ga0115001_1095032613300009785MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLY*
Ga0133547_1110195423300010883MarineVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLED
Ga0133547_1195239323300010883MarineTGDMLAAKVEKAVKNAKHIMLFWESKLMHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLED*
Ga0133913_1087712913300010885Freshwater LakeMLFWESKLIHKLRGKTFVPLLHFVGDEKTEDGKLYHVMIMDMLGKSLEDLFQ*
Ga0133913_1191331923300010885Freshwater LakeMQKHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF*
Ga0133913_1354574713300010885Freshwater LakeKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0138265_132721623300012408Polar MarineMLFWESKLIHKLRGKTHVPLLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF*
Ga0157595_105628013300012708FreshwaterGEHLAAKVEKAVKMQKHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF*
Ga0138268_101097423300012782Polar MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKSEYGKMYHVMVMDMLGKSLEDLF*
Ga0129327_1060570013300013010Freshwater To Marine Saline GradientMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLG
Ga0164295_1097587313300013014FreshwaterMLFWESKLIHKLRGKTHVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF*
Ga0181379_120891023300017783SeawaterAAKIEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTADGKTFHVMVMDLLGKSLEDQF
Ga0169931_1004980353300017788FreshwaterMQEKAVKMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTDDGQMYHVMVMDLLGKSLEDLF
Ga0181582_1052718023300017958Salt MarshVSESLISLQEKAVKMQRHIMLFWESKLIHKMRGKTSVPFLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0181581_1076112813300017962Salt MarshMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGK
Ga0181567_1065815623300018418Salt MarshMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKTYHVMVMDKLGKSLEDLF
Ga0192944_101024913300018692MarineMLFWESKLIHKLREKTMVPKLHFVGDEKTEDGKMFHVMVMDLLGKSLEDRF
Ga0192944_104988423300018692MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLF
Ga0192977_110523623300018874MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKSEDGKMYHVMVMDMLGKSLEDLF
Ga0193087_1024440413300018964MarineESKLIHKLRGKTYVPDLHFVGDEKTEDGKLFHVMVMDLLGKSLEDLF
Ga0192894_1029984113300018968MarineAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMED
Ga0192873_1002175423300018974MarineVKMQRHIMLFWESKLIHKLRGKTYVPDLHFVGDEKTEDGKLFHVMVMDLLGKSLEDLF
Ga0192873_1023441033300018974MarineVKMQRHIMLFWESKLIHKLRGETFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0192961_1010373423300018980MarineKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSIEDLF
Ga0192947_1010853733300018982MarineVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSIEDLF
Ga0193030_1026325013300018989MarineYKVEKKKTGQILAAKVEKAVKMQRHIMLFWESKLIHKLRGKTYVPDLHFVGDEKTEDGKLFHVMVMDLLGKSLEDLF
Ga0192926_1041623823300019011MarineMQRHIMLFWESKLIHKLRGKTYVPDLHFVGDEKTEDGKLFHVMVMDLLGKSLEDLF
Ga0192945_1005990913300019036MarineAFGDIYKVEKRKTGDFLAAKVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDQF
Ga0192945_1006573133300019036MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSIEDLF
Ga0192886_1004384613300019037MarineRHIMLFWESKLIHKMRGKTHVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0193336_1008834623300019045MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLED
Ga0192981_1009536123300019048MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTDDGKIYHVMVMDLLGKSMEDLF
Ga0192981_1009951313300019048MarineKVEKAVKMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0192981_1026728623300019048MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0192966_1008782723300019050MarineVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDQF
Ga0192966_1018503413300019050MarineMLFWESKLIHKLRGKTCVPLLHFVGDEKTEDGKMFHVMVMDLLGKSLENLIPRRACTS
Ga0188830_100536013300019085Freshwater LakeFGEIYRVEKKKTGDLLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTESGKMYHVMVMD
Ga0193054_104311713300019117MarineIMLFWESKLIHKLRGKTCVPYLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0193054_105157913300019117MarineLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLED
Ga0192980_102456233300019123MarineYKVEKKKTGEYLAAKVEKAVKMQRHIMLFWESKLIHKMRGKTHVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0192980_103718913300019123MarineVEKAVKMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0193436_105740423300019129MarineMQRHIMLFWESKLIHKLRGKTCVPYLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0194244_1001692713300019150MarineKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0194244_1008889323300019150MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSIEDLF
Ga0192975_1012144233300019153MarineDFLAAKVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEE
Ga0207193_117139943300020048Freshwater Lake SedimentMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF
Ga0194111_1048506923300020083Freshwater LakeMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0211735_1154057213300020162FreshwaterMLFWESKLIHKLRGKTCVPCLHYVGDEKTDEGKQYHVMVMDLLGKSLEDLF
Ga0194134_1005901913300020179Freshwater LakeMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0208593_104262113300020511FreshwaterLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0208090_104931113300020513FreshwaterMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF
Ga0206126_1012317923300020595SeawaterMLFWESKLIHKLRGKTAVPNLHYVGDEKTEDGKLYHVMVMDMLGKSLEDLF
Ga0206677_1020888023300021085SeawaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTPEGKPFHIMVMDQLGKSLEDLF
Ga0210307_124774523300021336EstuarineGDFLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKNYHVMVMDILGKSLEDLF
Ga0206692_108821013300021350SeawaterKLIHKLRGKTEVPLLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0194130_1046200313300021376Freshwater LakeEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDL
Ga0063105_103014613300021887MarineKVEKRKTGESLAAKVEKAQRMQKHIMLFWESKLIHKLRGKTHVPLLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0063105_105924623300021887MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF
Ga0063100_110089223300021910MarineMLFWESKLIHKLRNKTSVPNLHFVGDEKTEDGKVYHVMVMDMLGKSLEDLF
Ga0063104_109232213300021913MarineLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF
Ga0063096_106500223300021925MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDCF
Ga0063101_123207113300021950MarineLAAKVEKAQRMQKHIMLFWESKLIHKLRGKTHVPLLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0255770_1042417323300022937Salt MarshMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDL
Ga0255772_1029167723300023176Salt MarshMLFWESKLIHKMRGKTSVPFLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0244777_1026735613300024343EstuarineLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKNYHVMVMDILGKSLEDLF
Ga0244777_1033897523300024343EstuarineGDFLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0244775_1089690013300024346EstuarineLAAKVEKSVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKNYHVMVMDILGKSLEDLF
Ga0208426_101867423300025451AqueousESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0208426_106987913300025451AqueousMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMD
Ga0209405_115954213300025620Pelagic MarineVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF
Ga0209716_108007423300025626Pelagic MarineFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMEDLF
Ga0209406_114095713300025694Pelagic MarineIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDQF
Ga0209715_107998623300025699Pelagic MarineMLFWESKLIHKLRGKTFVPNLHFVGDEKTEDGKTYHVMVMDKLGKSLEDLF
Ga0208784_104090633300025732AqueousMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0209533_119060023300025874Pelagic MarineMLFWESKLIHKLRGKTAVPNLHYVGDEKAEDGKLYHVMVMDMLGKSLEDLF
Ga0209631_1015162423300025890Pelagic MarineMLFWESKLIHKLRGKTAVPNLHYVGDEKTESGKLYHVMVMDMLGKSLEDLF
Ga0208916_1012102513300025896AqueousMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0208916_1025163523300025896AqueousMLFWESKLIHKLRGKTFVPFLHFVGDEKANDGKVYHVMVMDLLGKSLEDLF
Ga0208275_102314023300026182MarineMLFWESKLIHKLRGKTYVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLED
Ga0208275_102320623300026182MarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLED
Ga0247594_104413713300026448SeawaterKKTGDFLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSIEDLF
Ga0247600_102433933300026461SeawaterMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0247568_112203223300026462SeawaterVKMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0247592_110987613300026500SeawaterEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDQ
Ga0208673_104270713300027192EstuarineQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0208309_103219213300027226EstuarineMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0208923_103475323300027320EstuarineMLFWESKLIHKLRGKTAVPNLHFVGDEKTENGKMYHVMVMD
Ga0209815_106659633300027714MarineMQRHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0209467_107872223300027719FreshwaterMLAAKVEKADKNQKHIMLYWESKLIHRLRGKTCVPNLHFVGDEKQEGGKTFHVMVMDLLGKSLEDLF
Ga0209617_1018498223300027720Freshwater And SedimentMLFWESKLIHQLRGKTYVPALHYVGDEKCADGSVFHVMVMDLLGKSLEDLF
Ga0209617_1039109813300027720Freshwater And SedimentWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0208304_1026159513300027751EstuarineKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0209500_1041225813300027782Freshwater LakeMLFWESKLIHKLRGKTCVPCLHYVGDEKTDEGKQYHVMVMDLL
Ga0209302_1009139833300027810MarineMQKHIMLFWESKLIHKLRGKTHVPLLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0209302_1011098943300027810MarineMLFWESKLIHKLKGKTAVPNLYFVGDEKTEGGKVFHIMIMDLLGKSLEDLKAECKKFDL
Ga0228674_123703913300028008SeawaterVEKRKTGDYLAAKVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSMED
Ga0256412_114370913300028137SeawaterLIHKLRGKTAVPNLHYVGDEKTEDGKLYHVMVMDMLGKSLEDLF
Ga0256413_133973013300028282SeawaterKTGDFLAAKVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSIEDLF
Ga0307403_1071412823300030671MarineMLFWESKLLHKLRGKTAVPNLHFVGDEKTEDGKMFHVMIMDMLGKSLEDLF
Ga0307398_1014866423300030699MarineIHKLRGKTHVPLLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0307399_1047421323300030702MarineEKKKTGEYLAAKVEKAVKMQRHIMLFWESKLIHKMRGKTHVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0307400_1032873613300030709MarineEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHIMVMDLLGKSLED
Ga0074020_1120802023300030840SoilMLFWESKLIHKLRGKTCVPNLHFVGDEKTDDGKTYHVMVMDLLGKSLEDLF
Ga0073977_160711813300030948MarineIMLFWESKLIHKMRGKTHVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0073978_161399323300031036MarineMQRHIMLFWESKLIHKLRGKTHVPFLHFVGDEKTSDGRLFHVMVMDLLGKSLEDLF
Ga0170824_12734267523300031231Forest SoilMLFWESKLIHKLRGKTSVPNLHFVGDEKTEDGKCFHVMVMDLLGKSLEDLF
Ga0307489_1038655533300031569Sackhole BrineAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLF
Ga0308134_110717413300031579MarineAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0308134_115471523300031579MarineDFLAAKVEKAVKNAKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLY
Ga0307993_109883723300031602MarineMQKHIMLFWESKLIHKLRGKTHVPLLHFVGDEKTEDGKMYHVMVMDLLGKSLEDLF
Ga0307993_111832813300031602MarineESKLIHKLRGKTHVPLLHFVGDEKTEDGKIYHVMVMDLLGKSLEDLF
Ga0302126_1033544313300031622MarineVEKAVKNQKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMFHVMVMDLLGKSLEDLF
Ga0307382_1045085813300031743MarineMLFWESKLIHKLREKTMVPKLHFVGDEKPEDGKMFHVMVMDLLGKSLEDRF
Ga0315907_1064083213300031758FreshwaterMQKHIMLFWESKLIHKMRGKTFVPFLHFVGDEKTDDGKMFHVMVMDLLGKSLEDLF
Ga0315907_1120460213300031758FreshwaterMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKSEDGKAYHVMVMDLLGKSLEDLF
Ga0315899_1046425233300031784FreshwaterMQRHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0315899_1118031513300031784FreshwaterPMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKSEDGKAYHVMVMDLLGKSLEDLF
Ga0315905_1037102623300032092FreshwaterMLFWESKLIHKLRGKTFVPFLHFVGDEKSEDGKAYHVMVMDLLGKSLEDLF
Ga0315905_1085997323300032092FreshwaterMRFSNDXGIKEKAVPMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKSEDGKAYHVMVMDLLGKSLEDLF
Ga0315905_1115949923300032092FreshwaterVQEKAVAGQKHIMLFWESKLIHKLRGKTHVPFLHFVGDEKAEDGKVYHVMVMDLLGKSLEDLF
Ga0314688_1021924523300032517SeawaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHIMVMDLLGKSLED
Ga0314677_1064674123300032522SeawaterWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLF
Ga0314687_1061554323300032707SeawaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDQF
Ga0314704_1035402733300032745SeawaterLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDMLGKSLEDLF
Ga0314709_1036099613300032755SeawaterESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHIMVMDLLGKSLED
Ga0334998_0486782_3_2033300034019FreshwaterFAAKVEKAVQNEKHIMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKMYHVMVMDLLGKSLEDIF
Ga0335005_0180322_905_10603300034022FreshwaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTQDGKMYHVMVMDMLGKSLEDLF
Ga0335005_0578175_289_4443300034022FreshwaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTADGKMYHVMVMDMLGKSLEDLF
Ga0335005_0729765_81_2363300034022FreshwaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTADGKMYHIMVMDMLGKSLEDLF
Ga0334990_0130820_963_11183300034068FreshwaterMLFWESKLIHKLRGKTAVPNLHFVGDEKTEDGKLYHIMVMDMLGKSLEELF
Ga0334990_0679868_335_5353300034068FreshwaterMLASMQEKAVKMQKHIMLFWESKLIHKLRGKTFVPFLHFVGDEKTDDGKMYHVMVMDLLGKSLEDLF
Ga0335037_0460387_496_6513300034107FreshwaterMLFWESKLIHKLRGKTFVPFLHFVGDEKTEDGKMYHVMVMDFLGKSMEDLF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.