| Basic Information | |
|---|---|
| Family ID | F022068 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 216 |
| Average Sequence Length | 41 residues |
| Representative Sequence | DKPKVEVQPVEIQVDLDTEKFYKMFVDLLTAPTPKKE |
| Number of Associated Samples | 188 |
| Number of Associated Scaffolds | 216 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 87.96 % |
| Associated GOLD sequencing projects | 175 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.352 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.222 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.46% β-sheet: 0.00% Coil/Unstructured: 81.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 216 Family Scaffolds |
|---|---|---|
| PF14559 | TPR_19 | 37.50 |
| PF13432 | TPR_16 | 25.46 |
| PF00294 | PfkB | 2.78 |
| PF13414 | TPR_11 | 2.78 |
| PF07168 | Ureide_permease | 2.31 |
| PF10343 | Q_salvage | 2.31 |
| PF13517 | FG-GAP_3 | 1.85 |
| PF13424 | TPR_12 | 1.85 |
| PF01425 | Amidase | 1.39 |
| PF00483 | NTP_transferase | 0.93 |
| PF13732 | DUF4162 | 0.93 |
| PF01797 | Y1_Tnp | 0.93 |
| PF13428 | TPR_14 | 0.93 |
| PF07831 | PYNP_C | 0.46 |
| PF12867 | DinB_2 | 0.46 |
| PF13193 | AMP-binding_C | 0.46 |
| PF13649 | Methyltransf_25 | 0.46 |
| PF07719 | TPR_2 | 0.46 |
| PF00374 | NiFeSe_Hases | 0.46 |
| PF02517 | Rce1-like | 0.46 |
| PF13181 | TPR_8 | 0.46 |
| PF00285 | Citrate_synt | 0.46 |
| PF11453 | DUF2950 | 0.46 |
| PF03235 | DUF262 | 0.46 |
| PF03544 | TonB_C | 0.46 |
| PF00196 | GerE | 0.46 |
| PF00072 | Response_reg | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.39 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.93 |
| COG0213 | Thymidine phosphorylase | Nucleotide transport and metabolism [F] | 0.46 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.46 |
| COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 0.46 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.46 |
| COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 0.46 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_13013033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300001867|JGI12627J18819_10370867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 580 | Open in IMG/M |
| 3300002906|JGI25614J43888_10222159 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300004152|Ga0062386_101138033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300004631|Ga0058899_11414418 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005174|Ga0066680_10339978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300005293|Ga0065715_10108875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2691 | Open in IMG/M |
| 3300005332|Ga0066388_100257156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2386 | Open in IMG/M |
| 3300005334|Ga0068869_102155380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
| 3300005436|Ga0070713_101169746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300005439|Ga0070711_101684387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
| 3300005445|Ga0070708_100027219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4904 | Open in IMG/M |
| 3300005454|Ga0066687_10183054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1132 | Open in IMG/M |
| 3300005468|Ga0070707_100752179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 938 | Open in IMG/M |
| 3300005518|Ga0070699_100240264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1616 | Open in IMG/M |
| 3300005534|Ga0070735_10860582 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005535|Ga0070684_100611100 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005540|Ga0066697_10787971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 517 | Open in IMG/M |
| 3300005541|Ga0070733_10477296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300005544|Ga0070686_101048051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
| 3300005555|Ga0066692_10030919 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300005561|Ga0066699_10604892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 787 | Open in IMG/M |
| 3300005575|Ga0066702_10350286 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005602|Ga0070762_10911288 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005614|Ga0068856_101053473 | Not Available | 831 | Open in IMG/M |
| 3300005618|Ga0068864_102057317 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005712|Ga0070764_10277249 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005764|Ga0066903_100087138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4121 | Open in IMG/M |
| 3300005764|Ga0066903_107826996 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005843|Ga0068860_100187161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2002 | Open in IMG/M |
| 3300006047|Ga0075024_100466967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 655 | Open in IMG/M |
| 3300006057|Ga0075026_100087139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1531 | Open in IMG/M |
| 3300006059|Ga0075017_100829272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 716 | Open in IMG/M |
| 3300006102|Ga0075015_100589071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 650 | Open in IMG/M |
| 3300006102|Ga0075015_100723407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 592 | Open in IMG/M |
| 3300006172|Ga0075018_10284647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300006173|Ga0070716_100366722 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300006173|Ga0070716_100513091 | Not Available | 887 | Open in IMG/M |
| 3300006176|Ga0070765_101234296 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006176|Ga0070765_101292934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 688 | Open in IMG/M |
| 3300006354|Ga0075021_10752193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300006804|Ga0079221_10918170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300006871|Ga0075434_102443110 | Not Available | 524 | Open in IMG/M |
| 3300006881|Ga0068865_100147891 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300006893|Ga0073928_10185836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1641 | Open in IMG/M |
| 3300007788|Ga0099795_10174324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300009088|Ga0099830_10440622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300009089|Ga0099828_10578472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300009090|Ga0099827_10910780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300009093|Ga0105240_12313311 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009638|Ga0116113_1096991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300009698|Ga0116216_10700556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300009700|Ga0116217_10415866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300009709|Ga0116227_11184176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300010048|Ga0126373_11795879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300010326|Ga0134065_10282619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300010359|Ga0126376_11293939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300010360|Ga0126372_12197712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300010366|Ga0126379_13342254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300010375|Ga0105239_11666920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300010376|Ga0126381_103661299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300010379|Ga0136449_103479662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300010379|Ga0136449_104444142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010397|Ga0134124_10165313 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300010866|Ga0126344_1119163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300011003|Ga0138514_100114973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300011269|Ga0137392_10754933 | Not Available | 804 | Open in IMG/M |
| 3300011269|Ga0137392_10811258 | Not Available | 773 | Open in IMG/M |
| 3300011271|Ga0137393_11130548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300012199|Ga0137383_10801648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300012199|Ga0137383_11131604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012209|Ga0137379_10057023 | All Organisms → cellular organisms → Bacteria | 3759 | Open in IMG/M |
| 3300012211|Ga0137377_10348479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1418 | Open in IMG/M |
| 3300012351|Ga0137386_10792624 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012359|Ga0137385_10694562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300012361|Ga0137360_10640268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300012362|Ga0137361_11569689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012363|Ga0137390_10835367 | Not Available | 878 | Open in IMG/M |
| 3300012363|Ga0137390_11051396 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira santarosai | 764 | Open in IMG/M |
| 3300012363|Ga0137390_11794792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300012683|Ga0137398_10097315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1845 | Open in IMG/M |
| 3300012685|Ga0137397_10136075 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300012927|Ga0137416_10357057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1227 | Open in IMG/M |
| 3300012930|Ga0137407_10063169 | All Organisms → cellular organisms → Bacteria | 3054 | Open in IMG/M |
| 3300012944|Ga0137410_11794183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300012960|Ga0164301_11106638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300012989|Ga0164305_10688368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300013102|Ga0157371_10623232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300013306|Ga0163162_10404264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1498 | Open in IMG/M |
| 3300013306|Ga0163162_11360808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300013307|Ga0157372_12310061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300014169|Ga0181531_10037220 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300014201|Ga0181537_11182256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300014499|Ga0182012_10128850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1855 | Open in IMG/M |
| 3300014501|Ga0182024_11847671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300015195|Ga0167658_1039030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1212 | Open in IMG/M |
| 3300015241|Ga0137418_10089866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2776 | Open in IMG/M |
| 3300015357|Ga0134072_10337764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300015371|Ga0132258_11096758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2012 | Open in IMG/M |
| 3300015374|Ga0132255_100230332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2638 | Open in IMG/M |
| 3300016371|Ga0182034_10292437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300017932|Ga0187814_10212144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300017933|Ga0187801_10123028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300017933|Ga0187801_10172564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300017933|Ga0187801_10268830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300017943|Ga0187819_10303096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300017995|Ga0187816_10069579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1490 | Open in IMG/M |
| 3300018006|Ga0187804_10143555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300018006|Ga0187804_10223220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300018009|Ga0187884_10109425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1194 | Open in IMG/M |
| 3300018021|Ga0187882_1295402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 621 | Open in IMG/M |
| 3300018042|Ga0187871_10287806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300018043|Ga0187887_10061016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2302 | Open in IMG/M |
| 3300018057|Ga0187858_10013515 | All Organisms → cellular organisms → Bacteria | 6652 | Open in IMG/M |
| 3300018062|Ga0187784_10247891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1450 | Open in IMG/M |
| 3300018085|Ga0187772_11184410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300018086|Ga0187769_10349793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300018088|Ga0187771_10802101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300019786|Ga0182025_1295158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1318 | Open in IMG/M |
| 3300019789|Ga0137408_1158159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300020579|Ga0210407_10822961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300020579|Ga0210407_11067282 | Not Available | 613 | Open in IMG/M |
| 3300020580|Ga0210403_10660908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300020582|Ga0210395_11339319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300021088|Ga0210404_10190966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
| 3300021180|Ga0210396_10627739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300021180|Ga0210396_11513643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300021401|Ga0210393_11078206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300021403|Ga0210397_10086740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2086 | Open in IMG/M |
| 3300021404|Ga0210389_11257196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300021406|Ga0210386_10902604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300021407|Ga0210383_10255650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
| 3300021420|Ga0210394_10371828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1257 | Open in IMG/M |
| 3300021420|Ga0210394_10937172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300021420|Ga0210394_11818687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300021474|Ga0210390_11104711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300021479|Ga0210410_10456811 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300021559|Ga0210409_10049474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3957 | Open in IMG/M |
| 3300022726|Ga0242654_10085436 | Not Available | 966 | Open in IMG/M |
| 3300024227|Ga0228598_1011346 | Not Available | 1773 | Open in IMG/M |
| 3300024271|Ga0224564_1099198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300024288|Ga0179589_10363299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300024290|Ga0247667_1092738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300025321|Ga0207656_10126731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
| 3300025404|Ga0208936_1018925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300025414|Ga0208935_1050969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300025899|Ga0207642_10124485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300025899|Ga0207642_10690578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300025927|Ga0207687_10282960 | Not Available | 1330 | Open in IMG/M |
| 3300025928|Ga0207700_11010955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300025939|Ga0207665_10258700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300026095|Ga0207676_12007586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300026309|Ga0209055_1196637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300026315|Ga0209686_1111648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300026327|Ga0209266_1218756 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300026538|Ga0209056_10203515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1447 | Open in IMG/M |
| 3300026538|Ga0209056_10253491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300026538|Ga0209056_10366888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300026542|Ga0209805_1276179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300026548|Ga0209161_10337584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300026557|Ga0179587_10363813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300026557|Ga0179587_11117128 | Not Available | 519 | Open in IMG/M |
| 3300027064|Ga0208724_1010876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300027080|Ga0208237_1060077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300027497|Ga0208199_1104325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 584 | Open in IMG/M |
| 3300027591|Ga0209733_1087649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300027633|Ga0208988_1088104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300027655|Ga0209388_1164064 | Not Available | 625 | Open in IMG/M |
| 3300027676|Ga0209333_1087677 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 851 | Open in IMG/M |
| 3300027824|Ga0209040_10132007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1371 | Open in IMG/M |
| 3300027824|Ga0209040_10511849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300027829|Ga0209773_10207571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300027853|Ga0209274_10075476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1634 | Open in IMG/M |
| 3300027853|Ga0209274_10283089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300027875|Ga0209283_10257767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300027875|Ga0209283_10324967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300027879|Ga0209169_10085091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300027889|Ga0209380_10002646 | All Organisms → cellular organisms → Bacteria | 11374 | Open in IMG/M |
| 3300027895|Ga0209624_10768042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300027898|Ga0209067_10854679 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300027905|Ga0209415_10267881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1514 | Open in IMG/M |
| 3300027911|Ga0209698_11330939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300028795|Ga0302227_10241402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300028863|Ga0302218_10070868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
| 3300028906|Ga0308309_10253501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1473 | Open in IMG/M |
| 3300029636|Ga0222749_10147861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300029882|Ga0311368_10506398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300029916|Ga0302148_1004205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4346 | Open in IMG/M |
| 3300029989|Ga0311365_10326236 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300030047|Ga0302286_10228158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300030693|Ga0302313_10075361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300030862|Ga0265753_1046701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300031525|Ga0302326_11477725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300031708|Ga0310686_108665173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300031712|Ga0265342_10463152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300031715|Ga0307476_11161691 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031720|Ga0307469_11167199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300031754|Ga0307475_10976339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300031823|Ga0307478_10461500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300031879|Ga0306919_10476226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300031908|Ga0310900_11507743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031947|Ga0310909_10232397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1538 | Open in IMG/M |
| 3300032001|Ga0306922_10095936 | All Organisms → cellular organisms → Bacteria | 3131 | Open in IMG/M |
| 3300032895|Ga0335074_10002869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 23479 | Open in IMG/M |
| 3300032898|Ga0335072_11223859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300032898|Ga0335072_11381084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300033158|Ga0335077_12180399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300033412|Ga0310810_10868034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300034195|Ga0370501_0063500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300034282|Ga0370492_0229447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.46% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.46% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.46% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.46% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.46% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_130130332 | 3300000891 | Soil | PKVAAQPVEVQVDLDTEKFYRMFVGLMSAPPPAR* |
| JGI12713J13577_10079421 | 3300001151 | Forest Soil | KDKPQGEVQPVEVQVDLDTEKFYQLFVELLSAPTPVPSKVAKP* |
| JGI12627J18819_103708671 | 3300001867 | Forest Soil | NTLSWTEQDRPKIAGSPGEIQADLDTERFYKMFVDLLTAPTPKP* |
| JGI25614J43888_102221592 | 3300002906 | Grasslands Soil | AAYGNILTWTDNDKPKVEVQPVEIQVDLDTEKFYKLFVDLLGGPTPPKN* |
| Ga0062386_1011380331 | 3300004152 | Bog Forest Soil | YGSTLSWTEQDKPQIVGPPVEVQVDLDTAKFYKMFVDLLTAPTPKP* |
| Ga0058899_114144182 | 3300004631 | Forest Soil | TETDKPKFAEQLVEVQIDLDTQRFYKMFVDLLTAPTPKP* |
| Ga0066680_103399781 | 3300005174 | Soil | KPKLVPQAVEIQVDLDAEKFYKMFVELMTAPTPGTTGQH* |
| Ga0065715_101088751 | 3300005293 | Miscanthus Rhizosphere | WVESDRPKVEVQPVEIQVDLDTERFYKTFVDLLAAPTPKPH* |
| Ga0066388_1002571561 | 3300005332 | Tropical Forest Soil | DHDKPNRELQPVEIQVDLDTDRFYKMFVDLLTAETPKPH* |
| Ga0068869_1021553801 | 3300005334 | Miscanthus Rhizosphere | AGYGSILSWNDKDKPKIDLQPVEIQVDLNTEKFYKTFVELLTAPTPPKR* |
| Ga0070713_1011697462 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KPAVEVQPVEVQVDLDVERLYTMIVELLTAPTPHPIAAH* |
| Ga0070711_1016843872 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ADHDKPGVDVQPVEIQDDLDAEKFYKMFVDLLTAPTPTKN* |
| Ga0070708_1000272191 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EKDKPKLARQPVEIQVDLDTQKFYQMFVSLMTAPTPSAH* |
| Ga0066687_101830542 | 3300005454 | Soil | ILTWVESDKPKIQVQPVEIQVDLDTDKFYNMFVDLLKAPTPRPH* |
| Ga0070707_1007521791 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SLTWTDRDKPKRDVQTVEVQFDLDTDKFYKMFVELLTAPTPQPGKPSIP* |
| Ga0070699_1002402643 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LTWTDHDKPKLELQPVEIQVDLDTEKFYKMLVDLLTAPTLQH* |
| Ga0070735_108605822 | 3300005534 | Surface Soil | YGNTLSWTEQDKPKLVGPLVEVQADLDTEKFYNMFVDLLTAPTPKP* |
| Ga0070684_1006111003 | 3300005535 | Corn Rhizosphere | NYGNILTWSENDKPKLEVRPVEIQADLDLERFYKMLVDLFQAPTPEKR* |
| Ga0066697_107879712 | 3300005540 | Soil | DTLTWTERDKPKLEVRQIEIQDDLDVEKFYKMFVDLLTAPTPKKN* |
| Ga0070733_104772961 | 3300005541 | Surface Soil | PKIEARTVEIQVDLDTEKFYKMFVSLMKAPTPSAH* |
| Ga0070686_1010480512 | 3300005544 | Switchgrass Rhizosphere | SWNDKDKPKIDLQPVEIQVDLNTEKFYKMFVDLLTAPTPPKH* |
| Ga0066692_100309192 | 3300005555 | Soil | WSEQDKPKIVGPPVEIQVDLDTEKFYKEFVELLAAPTPKP* |
| Ga0066699_106048922 | 3300005561 | Soil | LTWTDRDKPKLELQAVEIQDDLDTDKFYKMFVDLLSAPTPKP* |
| Ga0066702_103502862 | 3300005575 | Soil | RDKPKITGPAIEIQIDLDTQRFYKEFVDLLSAPTPHP* |
| Ga0070762_109112882 | 3300005602 | Soil | SWHQADKPKLAGPPIEVQTDLNTEKFYRMFVDLLSAPTPKP* |
| Ga0068856_1010534731 | 3300005614 | Corn Rhizosphere | ENDKPKLEVRPVEIQADLDLERFYKMLVDLFQAPTPEKR* |
| Ga0068864_1020573171 | 3300005618 | Switchgrass Rhizosphere | YGNILTWVESDRPKVAVQPAEIQVDLDTERFYRMYVDLLHAPTPKPH* |
| Ga0070764_102772491 | 3300005712 | Soil | WNEHDKPKLAGPPMEVQFDVDTEKFYKMFVDLLTAPTPRP* |
| Ga0066903_1000871381 | 3300005764 | Tropical Forest Soil | TWTEPDKPKVDLQPVEIQLDLETEKFYGMFVDLLSAPTPRK* |
| Ga0066903_1008788771 | 3300005764 | Tropical Forest Soil | TLSWTEEDKPKIIGPPVEIQVDLDLQKFYQEFVDLLTAPTPKP* |
| Ga0066903_1078269962 | 3300005764 | Tropical Forest Soil | DKPKIVGPAVEIQEDLDLQKFYKEFVELLRALTPKP* |
| Ga0068860_1001871611 | 3300005843 | Switchgrass Rhizosphere | RPKVEVQPVEIQVDLDTERFYKTFVDLLAAPTPKPH* |
| Ga0075024_1004669671 | 3300006047 | Watersheds | ESDKPKVDVRPVEIQVDLDTEKFYKMFVDLMKAPTPLKP* |
| Ga0075026_1000871391 | 3300006057 | Watersheds | TWTDRDKPKVDVQPAEIQVDLDTERFYKMFVDLLTAPTPKP* |
| Ga0075017_1008292722 | 3300006059 | Watersheds | WSNQDKPKIGLQPVEIQVDVNTERFYKMFVDLLSAPTPPKP* |
| Ga0075015_1005890712 | 3300006102 | Watersheds | RGAGYGSILSWSDQDKPKLDLRPVEIQVDLNTEQFYKMFVDLLSAPTPKP* |
| Ga0075015_1007234071 | 3300006102 | Watersheds | LTWTDRDKPKRDVQSVEIQVDLDNDRFYKMFVDLLSASTPQPDKK* |
| Ga0075018_102846471 | 3300006172 | Watersheds | DKPKLEVQPVEIQVDLDTEKFYKMFVDLLMAPTPGKN* |
| Ga0070716_1003667222 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PKIAVQPVEIQVDLDNNKFNHMFVELLSARTPNGSH* |
| Ga0070716_1005130911 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DRDKPALELQPVEVQVDLDVEKLYKMMVDLLTAPTPHASPKTNP* |
| Ga0070765_1012342962 | 3300006176 | Soil | DKPKIVGPLVEIQVDLDAQKFYKEFVDLLAAPTPKP* |
| Ga0070765_1012929342 | 3300006176 | Soil | ILSWSDHDKPKIDLQPVEIQVDLNTEKFYKMFVDLLSAPTPPKP* |
| Ga0075021_107521932 | 3300006354 | Watersheds | PKLEVQPVEVQVDLDTAKFYMMFVDLLTAKTPQKH* |
| Ga0079221_109181701 | 3300006804 | Agricultural Soil | SWTQQDAPKIHGMPVEIQMDLDTQKFYKEFVDLLSASVPKP* |
| Ga0075434_1024431101 | 3300006871 | Populus Rhizosphere | DKPKVEVQPVEIQVDLDTEKFYKMFVDLLTAPTPKKE* |
| Ga0068865_1001478913 | 3300006881 | Miscanthus Rhizosphere | ILTWSENDKPKLEVRPVEIQADLDLERFYKMLVDLFQAPTPEKR* |
| Ga0073928_101858362 | 3300006893 | Iron-Sulfur Acid Spring | LSWTERDKPKHEVQPIEVQDDLDFENFYKMFVDLLTTKTPSKN* |
| Ga0099795_101743242 | 3300007788 | Vadose Zone Soil | VAHDKPKIEVQAVEIQDDLDLDRFYKLFVDLMTAPTPANN* |
| Ga0099830_104406222 | 3300009088 | Vadose Zone Soil | LTWTDRDRPKLEVQSVEIQMDLDTGKFYKMFVELLTGPAGQTHGSTP* |
| Ga0099828_105784721 | 3300009089 | Vadose Zone Soil | WAEGDKPKAEVRPVEIQVDLDEQKFYKMIVDLLGAATPQKINH* |
| Ga0099827_109107802 | 3300009090 | Vadose Zone Soil | NQDKPKIDLQPVEIQVDLNTEKFYKMFVDLLTAPTPPKP* |
| Ga0105240_123133111 | 3300009093 | Corn Rhizosphere | GYGNTLTWTENDKPSIVLRQVQIQDDLDHEKFYKMFVDLLTAPTPKK* |
| Ga0116113_10969911 | 3300009638 | Peatland | PKQDVRQVEIQVDLDTERFYKMFVDLLTAETPRP* |
| Ga0116216_107005562 | 3300009698 | Peatlands Soil | EHDKPTIAGRPIEVQTDLDTERFYKMFVDLLTAPTPRP* |
| Ga0116217_104158662 | 3300009700 | Peatlands Soil | SWTERDKPKTVGPLVEVQVDLDTERFYKMFVDLLTAPTPKP* |
| Ga0116227_111841761 | 3300009709 | Host-Associated | KREVQSVEVQFDVDTDRFYKMFVDLLTAPTPPPTKP* |
| Ga0126373_117958791 | 3300010048 | Tropical Forest Soil | LTWTERDKPKLEVRPVEIQVDLDVARFYTMFVELLTAPAAKKN* |
| Ga0134065_102826191 | 3300010326 | Grasslands Soil | ILTWVESDKPKIQVQPVEIQVDLDTEKFYNMFVDLLKAPTPKPH* |
| Ga0126376_112939392 | 3300010359 | Tropical Forest Soil | TWADSERPKVEVQPVEIQIDLDAEKFYDMFVDLLSAPPTPKN* |
| Ga0126372_121977121 | 3300010360 | Tropical Forest Soil | TWTDPVKPKLDVQSVEIQVDLDKDKFYKEYVELLTAPTPKKSDSRK* |
| Ga0126379_133422541 | 3300010366 | Tropical Forest Soil | PRNVGQPVEIQLDLDAEKFYRLFRDLLMAPTPGGP* |
| Ga0105239_116669202 | 3300010375 | Corn Rhizosphere | PKIDVQPVEVQVDLDTERFYKMFVDLLTAPTPKP* |
| Ga0126381_1036612991 | 3300010376 | Tropical Forest Soil | KPQIVGPPIEIQVDLDLEKFYKEFVDLLSAPTPKP* |
| Ga0136449_1034796621 | 3300010379 | Peatlands Soil | ERDKPKREVQPIEVQDDLDLEKFYKLFVDLLTAPKPSKN* |
| Ga0136449_1044441421 | 3300010379 | Peatlands Soil | LTWMENDKSKLSKRQVEIQVDLNTERFYRMFVSLMRAATPAAH* |
| Ga0134124_101653131 | 3300010397 | Terrestrial Soil | KPKVEVQPVEIQVDLDTEKFYKMFVDLLTAPTPKKE* |
| Ga0126344_11191632 | 3300010866 | Boreal Forest Soil | AGYGNTLAWTEHDKPKIDVQPVEVQDDLDLDRFYGIFVNLLTAETPKR* |
| Ga0126361_109404481 | 3300010876 | Boreal Forest Soil | PKREVQPVEVQFDLDTEKFYKMFVDLLTAPTPQPAKTAAP* |
| Ga0138514_1001149732 | 3300011003 | Soil | YGNILTWTDQDKPKIAVQPVEIQVDLDTEKFYKEFVELLMAPTPRQK* |
| Ga0137392_107549331 | 3300011269 | Vadose Zone Soil | EDRPKVDVKPVEIQVDLDAPKFYKTIVDLLSAATPRKVVP* |
| Ga0137392_108112581 | 3300011269 | Vadose Zone Soil | EDKPKVDLKPVEIQVDLDTQKFYRMIVDLLSAPTPGGIAQ* |
| Ga0137393_111305482 | 3300011271 | Vadose Zone Soil | DRDRPKLEVQSVEIQDDLDTEKFYKMFVELLTAPTPRKN* |
| Ga0137383_108016481 | 3300012199 | Vadose Zone Soil | SDKPKIQVQPVEIQVDLDTEKFYNMFVDLLKAPTPRPH* |
| Ga0137383_111316041 | 3300012199 | Vadose Zone Soil | EQDKPKIVGPLTEVQVDLDRNRFYKMFIDLLTAPTPKP* |
| Ga0137379_100570232 | 3300012209 | Vadose Zone Soil | LSWTEQDKPKIVGPLAEVQVDLDRNRFYKMFIDLLTAPTPKP* |
| Ga0137377_103484792 | 3300012211 | Vadose Zone Soil | DKPKRDVQSVEVEFDLDTERFYKLFVDLLTGSTPHPAKPLTP* |
| Ga0137386_107926241 | 3300012351 | Vadose Zone Soil | LTWTDRDKPKRDVQSVEVEFDLDTDKFYKMFVDLLTAPTPQQGKPPRP* |
| Ga0137385_106945621 | 3300012359 | Vadose Zone Soil | YGNILTWVESDKPKIQVQAVEIQVDLDTEKFYNMFVDLLKAPTPKAH* |
| Ga0137360_106402681 | 3300012361 | Vadose Zone Soil | TLTWTDRDKPKRDVQSVEVECDLDTDKFYKMFVDLLTAPTPQQGKPPRP* |
| Ga0137361_115696892 | 3300012362 | Vadose Zone Soil | WTDRDKPKRDVQSVEVEFDLDTERFYKLFVDLLTAPTPQRGKLSTP* |
| Ga0137390_108353671 | 3300012363 | Vadose Zone Soil | PKVDVKPVEIQVDLDAPKFYKTIVDLLSAATPRKVVP* |
| Ga0137390_110513962 | 3300012363 | Vadose Zone Soil | TWNDKDRPKVALQPVEIQVDLDSERFYGMFVELLSGSAPHR* |
| Ga0137390_117947921 | 3300012363 | Vadose Zone Soil | TLTWTDRDKPKRDVQSVEVQLDLDTERFYRLFVDLLTAPTPRPGKAPTP* |
| Ga0137398_100973153 | 3300012683 | Vadose Zone Soil | LTWTAQDKPKIEVQPVVIQVDLDKEKFYQMFVELLKAPTPKKE* |
| Ga0137397_101360751 | 3300012685 | Vadose Zone Soil | KPKIDLQPVEIQVDFNTEKFYKMFVDLLTAPTPPKP* |
| Ga0137416_103570571 | 3300012927 | Vadose Zone Soil | YGNILTWNDKDKPKLELQPVEIQVDLDTDRFYKMFVDLLKADTPPKN* |
| Ga0137407_100631692 | 3300012930 | Vadose Zone Soil | GAGYGTILSWSNQDKPKIDLQPVEIQVDLNTEKFYKMFVDLLTAPTPPKP* |
| Ga0137410_117941831 | 3300012944 | Vadose Zone Soil | KPKITLQPVEIQMDLDTEKFYQLFVRLMTAPTPPSH* |
| Ga0164301_111066381 | 3300012960 | Soil | ANYGNVLTWTEDDKPNIAVRPVEIQVDVDTERFYKMFLDLLMAPTPKAH* |
| Ga0164305_106883682 | 3300012989 | Soil | WTQQDAPKIHGLPVEIQVDLDTQKFYTEFVDLLSASVPKP* |
| Ga0157371_106232322 | 3300013102 | Corn Rhizosphere | LTWTDHDKPKVDVQPEEVQVDLDTERFYKMFVDLLTAPTPKP* |
| Ga0163162_104042641 | 3300013306 | Switchgrass Rhizosphere | KIDLQPVEIQVDLNTEKFYKTFVELLTAPTPPKR* |
| Ga0163162_113608081 | 3300013306 | Switchgrass Rhizosphere | DRPKVEVQPVEIQVDLDTERFYKTFVDLLAAPTPKPH* |
| Ga0157372_123100611 | 3300013307 | Corn Rhizosphere | GNMLTWTDHDKPKVDVQPEEVQVDLDTERFYKMFVDLLTAPTPKP* |
| Ga0181531_100372201 | 3300014169 | Bog | RDKPTNPMQPIEVQDDVNLEKFYKMFVDLLSAPTPRQN* |
| Ga0181537_111822561 | 3300014201 | Bog | TWSENDKPKQDVRQVEIQVDLDTERFYKMFVDLLTAETPRP* |
| Ga0182012_101288501 | 3300014499 | Bog | TDKPTRDVQSVEVQFEVDTDRFYKMFVDLLTATTPAPPRP* |
| Ga0182024_118476711 | 3300014501 | Permafrost | NTLTWTETDKPKFAEQLVQVQIDLDTQRFYKMFVDLLTAPTPKP* |
| Ga0167658_10390301 | 3300015195 | Glacier Forefield Soil | WTERDKPQIAGPPAEVQVDLDTEKFYKMIVDLLTAPTPKR* |
| Ga0137418_100898661 | 3300015241 | Vadose Zone Soil | PKTEVQPVEVQDDLDLEKFYKMFVDLLTAPTPRRN* |
| Ga0134072_103377641 | 3300015357 | Grasslands Soil | KLEVRQIEIQDDLDVEKFYKMFVDLLTAPTPKKN* |
| Ga0132258_110967581 | 3300015371 | Arabidopsis Rhizosphere | VESDRPKVEVQPVEIQVDLDTERFYKTFVDLLAAPTPKPH* |
| Ga0132255_1002303321 | 3300015374 | Arabidopsis Rhizosphere | NILTWVESDRPKVEVQPVEIQVDLDTERFYKMFVDLVAAPTPKPQ* |
| Ga0182034_102924372 | 3300016371 | Soil | KPKLALQSIEIQLDVDTAKFYKLLVDLLTAPTPQPQ |
| Ga0187814_102121441 | 3300017932 | Freshwater Sediment | WTDADKPKRQLQPAEIQVDLDTDRFYKMFVDLLTAETPRP |
| Ga0187801_101230282 | 3300017933 | Freshwater Sediment | WTDRDKPTIEIRPVEIQVDLDLGKFYKMFVDLFTAATPQKN |
| Ga0187801_101725642 | 3300017933 | Freshwater Sediment | YGETLTWNDHDQPKRDVRPVEIQVDLDTERFYKMFVDLLTAPTPKKP |
| Ga0187801_102688301 | 3300017933 | Freshwater Sediment | WTEQDKPKIVGPPVEIQVDLDTQRFYKEFIDLLTAQTPKP |
| Ga0187819_103030962 | 3300017943 | Freshwater Sediment | KREVQPIEIQVDLDNAKFYKMFVDLLSAPTPRKTSP |
| Ga0187816_100695792 | 3300017995 | Freshwater Sediment | LTWAEQDKPKIEVRPVEIQVDLDLEKFYKMFVDLLTAPTPKKN |
| Ga0187804_101435551 | 3300018006 | Freshwater Sediment | DKPKIVGPPVEIQVDLDLQKFYKEFVDLLSAATPKP |
| Ga0187804_102232202 | 3300018006 | Freshwater Sediment | TLTWADRDKPAIEIRPVEVQVDLDLGKFYKMFVDLLTTPTPQKN |
| Ga0187884_101094252 | 3300018009 | Peatland | LSWTERDKPAIVGPPAEVQVDLDAEKFYQMFVGLLTAPTPKP |
| Ga0187882_12954022 | 3300018021 | Peatland | ANYGNTLNWTEQNKPRVDLQPVEVQVDLDLDRFYKTFVDLLTAPTPRN |
| Ga0187871_102878061 | 3300018042 | Peatland | ERDKPKLEVRAAEVQDDLDLDRFYRMFVTLLSASTPKN |
| Ga0187887_100610161 | 3300018043 | Peatland | NKPKIELQPVEVQDDLDAERFYKMFVDLLTATTPPK |
| Ga0187858_100135151 | 3300018057 | Peatland | DKPKHGVQAVEVQVDLDTEKFYKLFVDLLTAPTPLPAKP |
| Ga0187784_102478912 | 3300018062 | Tropical Peatland | AEQDKPPFAGQPVEVQLDLDTARFYRTFVDLLTAPTPKPMR |
| Ga0187772_111844102 | 3300018085 | Tropical Peatland | TEQDKPQIVGQPVEVQLDLDTTKFYRMFVDLLTAPTPKP |
| Ga0187769_103497931 | 3300018086 | Tropical Peatland | PKVDVQPVEIQVDLDTEKFYKMFVELLSAATPIKH |
| Ga0187771_108021011 | 3300018088 | Tropical Peatland | QDKPQLVGPPVEVQFDLDTAKFYKMFVDLLAAPTPKP |
| Ga0182025_12951584 | 3300019786 | Permafrost | HDKPKIDVQPVEVQDDLDLDRFYKLFVSLLSAQTPRN |
| Ga0137408_11581591 | 3300019789 | Vadose Zone Soil | TLTWTDRDKPKLALQPVEIQMGLDVEKFYKMFVDLLTAATPKKN |
| Ga0210407_108229612 | 3300020579 | Soil | EEAKPKIVGRAAEVQVDLDTERFYKMFVDLLTAPTPKP |
| Ga0210407_110672821 | 3300020579 | Soil | TWAAEDRPKVEVRPVEIQVDLDTQKFYKMIVDLLSAHTPRGITP |
| Ga0210403_103217601 | 3300020580 | Soil | SSRPDTQPVEIQVDLDTEKFYRTFVGLMTTPTPAPAPPAAQ |
| Ga0210403_106609082 | 3300020580 | Soil | STLSWVDQDRPKNSGPPVEVQVDLDKERFYKMFVDLLTAPTPKP |
| Ga0210395_113393191 | 3300020582 | Soil | TLSWTNRDKPKIELQPVEVQDDVDLERFYKLFADLLTAPTPRKD |
| Ga0210404_101909661 | 3300021088 | Soil | KPKIELQPVEIQIDLDTEKFYKMFVDLLTAPTPPAAPTAK |
| Ga0210396_106277392 | 3300021180 | Soil | TLTWTEQNKPKVGVRALEVQDDLNLDKFYKLFVDLLSAPTPGAK |
| Ga0210396_115136432 | 3300021180 | Soil | LRWTEQNKPKIEMQAVEVQDDLDLEKFYKMFVDLLSMQTPPKN |
| Ga0210393_110782061 | 3300021401 | Soil | WSDRDKPTLEVRPVEIQVDLDLQKFYKLFVDLLTAPTPQK |
| Ga0210397_100867402 | 3300021403 | Soil | KVDVQSVEIQDDLDLPRFYKMFVDLLKAPTPPAPRSAQ |
| Ga0210389_112571961 | 3300021404 | Soil | NDGDKPKIVGPMAEIQVDLDTKKFYDMFVDLLTAPTPKP |
| Ga0210386_109026041 | 3300021406 | Soil | DQDRPKNSGPPVEVQVDLDKERFYKMFVDLLTAPTPKP |
| Ga0210383_102556502 | 3300021407 | Soil | WTDRDKPKIEVQPVEVQDDLDLERFNKMFVDLLTAPTPRKN |
| Ga0210394_103718282 | 3300021420 | Soil | NGDTLTWTDQEQSTPGLQPAEVQVDLDTERFYKLFVDLLTAPTPKKN |
| Ga0210394_109371721 | 3300021420 | Soil | SDRDKPKVEVQPVEIHVDLDLEKFYKMFLDLLTAPTPKKD |
| Ga0210394_118186872 | 3300021420 | Soil | KPKVAVQPVEIQVDLDTEKFYKMFVDLLTAATPKKN |
| Ga0210390_111047112 | 3300021474 | Soil | LENDKTKFAKRQVEIQVDLDKEKFYRMFVELLRAPTPATP |
| Ga0210410_104568111 | 3300021479 | Soil | DKPKIELQPVEVQDDLNTEKFYKMFVDLLTAPTPQK |
| Ga0210409_100494746 | 3300021559 | Soil | WTDRDKPRIEIQPVEIQVDLDTEKFYKMFVDLLTAPTPGKN |
| Ga0242654_100854361 | 3300022726 | Soil | TDRDKPKGDVRSVEVQFDLDTDRFYKLFVDLLTAPTPQPGSPPVP |
| Ga0228598_10113461 | 3300024227 | Rhizosphere | RDKPKTTEVQPVEVQVDLDLEKFYRLFVDLLTAPTPQKN |
| Ga0224564_10991982 | 3300024271 | Soil | WTEDDRPKMTGRAGPPAEVQVDLDTEKFYKMFVDLLTAPTPKP |
| Ga0179589_103632992 | 3300024288 | Vadose Zone Soil | GNMLTWSDRDKPSFTLQSVEIQVDLDTDRFYGMVVDLLKAPTPGK |
| Ga0247667_10927381 | 3300024290 | Soil | GNMLTWTDHDKPKVDVQPEEVQVDLDTERFYKMFVDLLTAPTPKP |
| Ga0207656_101267312 | 3300025321 | Corn Rhizosphere | DRPKVEVQPVEIQVDLDTERFYKTFVDLLAAPTPKPH |
| Ga0208936_10189252 | 3300025404 | Peatland | TLNWTEQNKPRVDLQPVEVQVDLDLDRFYKTFVDLLTAAPTPRK |
| Ga0208935_10509692 | 3300025414 | Peatland | ERPKGELQPIEVQDDLDLDRFYKMFVDLLTAPTPKN |
| Ga0207642_101244853 | 3300025899 | Miscanthus Rhizosphere | SDRPKVEVQPVEIQVDLDTERFYKTFVDLLAAPTPKPH |
| Ga0207642_106905782 | 3300025899 | Miscanthus Rhizosphere | MLTWTDHDKPKIDVQPEEVQVDLDTERFYKMFVDLLTAPTPKP |
| Ga0207687_102829602 | 3300025927 | Miscanthus Rhizosphere | ANYGNILTWSENDKPKLEVRSVEIQADLDLERFYKMLVDLFQAPTPEKR |
| Ga0207700_110109552 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KPAVEVQPVEVQVDLDVERLYTMIVELLTAPTPHPIAAH |
| Ga0207665_102587002 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | WTDRDKPKVDVQPAEIQVDLDAERFYKMFVDLLTAPTPKP |
| Ga0207676_120075862 | 3300026095 | Switchgrass Rhizosphere | YGNILTWVESDRPKVAVQPAEIQVDLDTERFYRMYVDLLHAPTPKPH |
| Ga0209055_11966372 | 3300026309 | Soil | RDKPALELQPVEVQVDLDVEKLYNMMVDLLNAPTPHASPKTNP |
| Ga0209686_11116481 | 3300026315 | Soil | EQDKPKVGVPQVEVQVDLDTKKFYDLLVSLLTAPTPRAR |
| Ga0209266_12187561 | 3300026327 | Soil | WSDHDKPKIDVKPVEIQVDLNTDKFYKMFVDLLKADTPNQH |
| Ga0209056_102035151 | 3300026538 | Soil | SDKPKIQVQPVEIQVDLDAEKFYNMFVDLLKASTPKPH |
| Ga0209056_102534912 | 3300026538 | Soil | TWVDTNKPKLVPQAVEIQVDLDAEKFYKMFVELMTAPTPGTTGQH |
| Ga0209056_103668881 | 3300026538 | Soil | DKPKVRVPQVEVQVDLDTQKFYDLFVSLLTAPTPKAR |
| Ga0209805_12761791 | 3300026542 | Soil | EQDKPKVRVPQVEVQVDLDTQKFYDLFVSLLTAPTPKAR |
| Ga0209161_103375842 | 3300026548 | Soil | DKPKIQVQPVEIQVDLDTEKFYNMFVDLLKAPTPKPH |
| Ga0179587_103638132 | 3300026557 | Vadose Zone Soil | RDKPKRDVQSVEVQFDLDTERFYRLFVDLLTAPTPRPGKPPAP |
| Ga0179587_111171281 | 3300026557 | Vadose Zone Soil | VDLKPVEIQVDLDTQKFYKMIVDLLSAPTPGGIAQ |
| Ga0208724_10108762 | 3300027064 | Forest Soil | DWDKPKIELQPVDVQDDLNIEKFYKMFVDLLAAPTPQRQ |
| Ga0208237_10600772 | 3300027080 | Forest Soil | KPKIEMPPVEVQDDLDLEKFYTMFVNLLTAPTRRKN |
| Ga0208199_11043251 | 3300027497 | Peatlands Soil | EHDKPKFAQPVEVQDDLDLDKFYKMFVELLSAATPSKN |
| Ga0209733_10876492 | 3300027591 | Forest Soil | TLTWTDRDKPKRDVQSVEVQFDLDTERFYKLFVNLLTAPTPRPGKAPTP |
| Ga0208988_10881041 | 3300027633 | Forest Soil | TWTDVDRPKLEVQLVEIQDDLDTEKFYKMFVELLSAPTPRKN |
| Ga0209388_11640641 | 3300027655 | Vadose Zone Soil | KPKVDLKPVEIQVDLDTQKFYRMIVDLLSAPTPGGIAQ |
| Ga0209333_10876772 | 3300027676 | Forest Soil | DKPHRDMQPVEVQFDLDKERFYKMFVELLSAPTPPAEKQTP |
| Ga0209040_101320071 | 3300027824 | Bog Forest Soil | WDKPKHDMRPVEVQVDLDTNKFYKLFVELMTAPTPQPGKRSNP |
| Ga0209040_105118492 | 3300027824 | Bog Forest Soil | KPKLDARPVEIQVDLDTEKFYKMFVGLMTAPTPAPR |
| Ga0209773_102075711 | 3300027829 | Bog Forest Soil | SWTDRNKPKIEMPRVEVQDDLDLEKFYTLFVNLLTTPTHPKN |
| Ga0209274_100754762 | 3300027853 | Soil | EADKPKLAGPPIEVQTDLNTEKFYKMFVDLLTAPTPKP |
| Ga0209274_102830892 | 3300027853 | Soil | KPRIEVQSVEVQDDLDLERFYKMFVDLLTAQTPPKN |
| Ga0209283_102577672 | 3300027875 | Vadose Zone Soil | DRDRPKLEVQSVEIQDDLDTEKFYKMFVELLTAPTPRKN |
| Ga0209283_103249671 | 3300027875 | Vadose Zone Soil | PKLELQPVEIQVDLDTERFYKMFVDLLSAPTLQKH |
| Ga0209169_100850912 | 3300027879 | Soil | WNEHDKPKLAGPPMEVQFDVDTEKFYKMFVDLLTAPTPRP |
| Ga0209380_100026461 | 3300027889 | Soil | DRNKPKIEMPPVEVQDDLDLEKFYTMFVNLLTAPTRRKN |
| Ga0209624_107680422 | 3300027895 | Forest Soil | LAWTEHDKPKIDVQPVEVQDDLDLDRFYTIFVNLLTAETPKS |
| Ga0209067_108546793 | 3300027898 | Watersheds | VLTWYERDKPKVEVQPVEIQVDLDTEKFYNLFVKLLSGPTPPKN |
| Ga0209415_102678812 | 3300027905 | Peatlands Soil | KPTIVGPPAEVQVDLDSEKFYKMFVDLLTAPTPKP |
| Ga0209698_113309392 | 3300027911 | Watersheds | TLTWTDLDKPKHDIKSVEVQFDLDTDRFYKLFVELLTAPTPKPGKRPTP |
| Ga0302227_102414021 | 3300028795 | Palsa | TLSWTDHDKPKIEVPPVEVQDDLDLEKFYKMFVDLLIAPTPNKN |
| Ga0302218_100708681 | 3300028863 | Palsa | KPKLEVQPVEVQDDLDTAKLYKMFVDLLTAPTPHSPI |
| Ga0308309_102535013 | 3300028906 | Soil | PKLDAQPVEIQVDLNAEKFYRMFVSLMTAPTPAAH |
| Ga0222749_101478611 | 3300029636 | Soil | GNTLSWTDSDKPKIVGSPAELQMDLDTKRFYKMFVDLLTSPTPKP |
| Ga0311368_105063981 | 3300029882 | Palsa | DKDKPKLDARPVEIQVDLDTEKFYKMFVSLMTSPTPAAH |
| Ga0302148_10042051 | 3300029916 | Bog | KPKRDVQSVEVQFEVDTDRFYKMFVHLLTAATPAPPRP |
| Ga0302148_10113481 | 3300029916 | Bog | DQDKPHREVQPVEVQFDLDTEKFYKLFVELLTAPTPQAGKVATP |
| Ga0311365_103262362 | 3300029989 | Fen | NILTWTDEVKPKVEVQPVEVQVDLDTEKFYKMFVDLLTSPTPKP |
| Ga0302286_102281582 | 3300030047 | Fen | DEVKPKVEVQPVEVQVDLDTEKFYKMFVDLLTSPTPKP |
| Ga0302313_100753612 | 3300030693 | Palsa | NDKPKLSVQPLEVQDDLDLDRFYKMFVNLLSAPTPKL |
| Ga0265753_10467011 | 3300030862 | Soil | WADWDKPKIELQPVEVQDDLNTEKFYKMFVDLLTAPTPQK |
| Ga0302325_108044812 | 3300031234 | Palsa | PVQSVEIQADLDTEKFYKLFVNLLTAPTPGPAQTVPSASQ |
| Ga0302326_114777252 | 3300031525 | Palsa | WTSRDKPPNPMQPVEVQDDVDLEKFYKMFVDLLSAPTPPRN |
| Ga0310686_1086651731 | 3300031708 | Soil | GNTLSWTEDDRPKMTGRAGPPAEVQVDLDTEKFYKMFVDLLTAPTPKP |
| Ga0265342_104631521 | 3300031712 | Rhizosphere | TPNTTGPAVEVQSDLDTAKFYKMFVDLLTAPTPKP |
| Ga0307476_111616912 | 3300031715 | Hardwood Forest Soil | TWAEQDKPKVDVRPVEIQVDLDLQRFYKMFVDLLTAPTPKH |
| Ga0307469_111671991 | 3300031720 | Hardwood Forest Soil | NTLTWTDHDKPKIDVQPVEVQVDLDKEKFYKMFVGLLTAPTPQSQLRK |
| Ga0307475_109763391 | 3300031754 | Hardwood Forest Soil | KPKNVGPPAEIQVDLDTEKFYKMFVDLLTAPTPRP |
| Ga0307478_104615001 | 3300031823 | Hardwood Forest Soil | RDKPKIELQPVEVQDDVDLEKFYKMFVDLLTAPTPRKN |
| Ga0306919_104762262 | 3300031879 | Soil | DRPMVAVQPVEIQVDMDREKFYRMFETLMTAPTPPRTKDLP |
| Ga0310900_115077431 | 3300031908 | Soil | ESDRPKVEVQPVEIQVDLDTERFYKMFVDLVAAPTPKPQ |
| Ga0310909_102323972 | 3300031947 | Soil | DKDKPKLALQSIEIQLDVDTAKFYKLLVDLLTAPTPQPQ |
| Ga0306922_100959361 | 3300032001 | Soil | PKVDVRSVEIQDDVDLPRFYKMLVDLMKAPTPPAAQQAR |
| Ga0335074_1000286920 | 3300032895 | Soil | SKNDKPTIVGPPVEIQVDLDTQKFYKMFVDLLKAPTPKR |
| Ga0335072_112238591 | 3300032898 | Soil | GYGNILTWSDRDKPKIELQPIEIQDDLDKEKFYNMFVDLLSAPTPRN |
| Ga0335072_113810842 | 3300032898 | Soil | SWSENDKPKMVGPPVEIQVDLDTQRFYNMFVDLLKAPTPKP |
| Ga0335077_121803992 | 3300033158 | Soil | SWTEQDKPKIVGPPVEVQVDLDTSKFYKEFVELLTAPTPKP |
| Ga0310810_108680341 | 3300033412 | Soil | ERGAGYGNMLTWTDHDKPKIDVQPEEVQVDLDTERFYKMFVNLLTAPTPKP |
| Ga0370501_0063500_1_141 | 3300034195 | Untreated Peat Soil | YGSILSWSDQDKPKLDVQPVEIQVDLNTHKFYKMFVDLLSAPTPKP |
| Ga0370492_0229447_638_754 | 3300034282 | Untreated Peat Soil | ADKPKLTGQPVEIQVDLDTEKFYRMFVALMSAPTPSGP |
| ⦗Top⦘ |