| Basic Information | |
|---|---|
| Family ID | F022067 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 216 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTANSSKETLERIHAALEAARVVLNRFTPGAIEAEYKVGHDPVTEA |
| Number of Associated Samples | 190 |
| Number of Associated Scaffolds | 216 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.50 % |
| % of genes near scaffold ends (potentially truncated) | 98.61 % |
| % of genes from short scaffolds (< 2000 bps) | 91.20 % |
| Associated GOLD sequencing projects | 180 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.056 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.759 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.241 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 0.00% Coil/Unstructured: 54.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 216 Family Scaffolds |
|---|---|---|
| PF01925 | TauE | 79.17 |
| PF01583 | APS_kinase | 8.33 |
| PF01747 | ATP-sulfurylase | 5.56 |
| PF14306 | PUA_2 | 1.39 |
| PF07995 | GSDH | 0.46 |
| PF00535 | Glycos_transf_2 | 0.46 |
| PF00975 | Thioesterase | 0.46 |
| PF00293 | NUDIX | 0.46 |
| PF00491 | Arginase | 0.46 |
| PF13185 | GAF_2 | 0.46 |
| PF00685 | Sulfotransfer_1 | 0.46 |
| PF10728 | DUF2520 | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
|---|---|---|---|
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 79.17 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 8.33 |
| COG2046 | ATP sulfurylase (sulfate adenylyltransferase) | Inorganic ion transport and metabolism [P] | 5.56 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.46 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.06 % |
| Unclassified | root | N/A | 6.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002239|JGI24034J26672_10008558 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100081405 | All Organisms → cellular organisms → Bacteria | 3007 | Open in IMG/M |
| 3300002562|JGI25382J37095_10262333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300004080|Ga0062385_10603036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300004082|Ga0062384_100125267 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300004091|Ga0062387_101222234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300004092|Ga0062389_100208303 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300004092|Ga0062389_104661528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300004152|Ga0062386_100568217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300004152|Ga0062386_100862108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300005167|Ga0066672_10313074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300005174|Ga0066680_10050933 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
| 3300005176|Ga0066679_10125603 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300005177|Ga0066690_10088383 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300005180|Ga0066685_10488288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300005343|Ga0070687_101102984 | Not Available | 581 | Open in IMG/M |
| 3300005436|Ga0070713_100180173 | Not Available | 1898 | Open in IMG/M |
| 3300005445|Ga0070708_101182122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300005451|Ga0066681_10015530 | All Organisms → cellular organisms → Bacteria | 3803 | Open in IMG/M |
| 3300005518|Ga0070699_100677663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300005536|Ga0070697_102126127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005542|Ga0070732_10789613 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005559|Ga0066700_10445049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300005568|Ga0066703_10361700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300005569|Ga0066705_10244515 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300005602|Ga0070762_10344324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300005712|Ga0070764_10498275 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005712|Ga0070764_10662648 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005921|Ga0070766_10436113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300005938|Ga0066795_10240974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300005993|Ga0080027_10297893 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006031|Ga0066651_10494323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300006052|Ga0075029_100526440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300006102|Ga0075015_100552774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300006102|Ga0075015_100791344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300006172|Ga0075018_10443710 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006176|Ga0070765_100215633 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300006354|Ga0075021_10737350 | Not Available | 634 | Open in IMG/M |
| 3300006642|Ga0075521_10200713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300006797|Ga0066659_10104241 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300006797|Ga0066659_11215141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300006800|Ga0066660_10076257 | All Organisms → cellular organisms → Bacteria | 2293 | Open in IMG/M |
| 3300006800|Ga0066660_10182910 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300006852|Ga0075433_10566634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300006854|Ga0075425_101274290 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006872|Ga0101947_1093323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300009012|Ga0066710_104530779 | Not Available | 519 | Open in IMG/M |
| 3300009038|Ga0099829_10999998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300009088|Ga0099830_10016071 | All Organisms → cellular organisms → Bacteria | 4743 | Open in IMG/M |
| 3300009521|Ga0116222_1290154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300009525|Ga0116220_10444830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300009552|Ga0116138_1083424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300009637|Ga0116118_1170371 | Not Available | 695 | Open in IMG/M |
| 3300009643|Ga0116110_1064143 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300009645|Ga0116106_1172027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300009645|Ga0116106_1186415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300009683|Ga0116224_10173243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300009700|Ga0116217_10004199 | All Organisms → cellular organisms → Bacteria | 12875 | Open in IMG/M |
| 3300009762|Ga0116130_1171254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300009764|Ga0116134_1301575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300010048|Ga0126373_11274334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300010333|Ga0134080_10267691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300010362|Ga0126377_10894836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300010366|Ga0126379_11701644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300010379|Ga0136449_102349821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300011269|Ga0137392_10741943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300011270|Ga0137391_10449497 | Not Available | 1096 | Open in IMG/M |
| 3300011271|Ga0137393_10511087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300012096|Ga0137389_10487303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300012198|Ga0137364_10577473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300012202|Ga0137363_10287980 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300012203|Ga0137399_10241710 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300012203|Ga0137399_10464880 | Not Available | 1059 | Open in IMG/M |
| 3300012205|Ga0137362_10555087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300012208|Ga0137376_11249565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300012208|Ga0137376_11491264 | Not Available | 567 | Open in IMG/M |
| 3300012209|Ga0137379_11775535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012210|Ga0137378_10459356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300012351|Ga0137386_10486550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300012356|Ga0137371_10458658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300012362|Ga0137361_11774812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012363|Ga0137390_10499702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300012917|Ga0137395_10522301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300012927|Ga0137416_11924514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300012986|Ga0164304_10712000 | Not Available | 764 | Open in IMG/M |
| 3300012988|Ga0164306_10660985 | Not Available | 826 | Open in IMG/M |
| 3300014156|Ga0181518_10103841 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300014162|Ga0181538_10154314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
| 3300014200|Ga0181526_10905414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300014492|Ga0182013_10311937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300014501|Ga0182024_12503702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300014638|Ga0181536_10011185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8261 | Open in IMG/M |
| 3300015264|Ga0137403_10523266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300015264|Ga0137403_11471800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300015264|Ga0137403_11570529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300016387|Ga0182040_11012301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300016702|Ga0181511_1173382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300017656|Ga0134112_10276086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300017822|Ga0187802_10214976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300017823|Ga0187818_10285308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300017930|Ga0187825_10086684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300017931|Ga0187877_1322985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300017933|Ga0187801_10204285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300017933|Ga0187801_10308041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300017938|Ga0187854_10207831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300017946|Ga0187879_10244628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300017955|Ga0187817_10591830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300017955|Ga0187817_10863393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300017959|Ga0187779_11201984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300017961|Ga0187778_10054961 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300017966|Ga0187776_10746060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300017975|Ga0187782_10436019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300017988|Ga0181520_10160529 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300018007|Ga0187805_10189690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300018009|Ga0187884_10416576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300018013|Ga0187873_1113666 | Not Available | 1060 | Open in IMG/M |
| 3300018017|Ga0187872_10285737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300018021|Ga0187882_1139261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300018033|Ga0187867_10399910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300018046|Ga0187851_10877694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300018085|Ga0187772_10021146 | All Organisms → cellular organisms → Bacteria | 3742 | Open in IMG/M |
| 3300018085|Ga0187772_10332801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300018085|Ga0187772_11408378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300018090|Ga0187770_10598135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300018090|Ga0187770_11143849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300018431|Ga0066655_11335662 | Not Available | 516 | Open in IMG/M |
| 3300019240|Ga0181510_1161676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300019284|Ga0187797_1269868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300019787|Ga0182031_1323430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1446 | Open in IMG/M |
| 3300019789|Ga0137408_1413112 | Not Available | 1091 | Open in IMG/M |
| 3300019890|Ga0193728_1140508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300020583|Ga0210401_10518720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300020583|Ga0210401_10569951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300021171|Ga0210405_10309467 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300021180|Ga0210396_11383710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300021181|Ga0210388_10111435 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
| 3300021181|Ga0210388_10313221 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300021181|Ga0210388_10966555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300021401|Ga0210393_11566113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021402|Ga0210385_10907620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300021403|Ga0210397_10669335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300021404|Ga0210389_10242037 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300021405|Ga0210387_10393236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300021405|Ga0210387_11737970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300021407|Ga0210383_10553662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300021479|Ga0210410_11097636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300021560|Ga0126371_13085917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300022533|Ga0242662_10097948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300022557|Ga0212123_10193800 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300025878|Ga0209584_10138915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300025927|Ga0207687_10387684 | Not Available | 1146 | Open in IMG/M |
| 3300026023|Ga0207677_10483074 | Not Available | 1068 | Open in IMG/M |
| 3300026294|Ga0209839_10160738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300026298|Ga0209236_1049712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2100 | Open in IMG/M |
| 3300026308|Ga0209265_1016518 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300026318|Ga0209471_1194973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300026320|Ga0209131_1136988 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300026331|Ga0209267_1015654 | All Organisms → cellular organisms → Bacteria | 3930 | Open in IMG/M |
| 3300026332|Ga0209803_1126935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300026333|Ga0209158_1063470 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300026335|Ga0209804_1208285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300026342|Ga0209057_1105315 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300026497|Ga0257164_1057460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300026498|Ga0257156_1135392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300026499|Ga0257181_1055484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300026532|Ga0209160_1010233 | All Organisms → cellular organisms → Bacteria | 6921 | Open in IMG/M |
| 3300026538|Ga0209056_10692667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300027439|Ga0209332_1021473 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300027562|Ga0209735_1076827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300027570|Ga0208043_1187916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300027641|Ga0208827_1085473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300027662|Ga0208565_1232300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300027696|Ga0208696_1086829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300027729|Ga0209248_10064598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 1116 | Open in IMG/M |
| 3300027748|Ga0209689_1173425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300027767|Ga0209655_10264297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300027767|Ga0209655_10309717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027879|Ga0209169_10716002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300027894|Ga0209068_10537792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300027895|Ga0209624_10810165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300027903|Ga0209488_10147150 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300027903|Ga0209488_10827614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300027905|Ga0209415_10087547 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300027908|Ga0209006_10607971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300027908|Ga0209006_11025871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300027911|Ga0209698_10872757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300028776|Ga0302303_10221499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300029636|Ga0222749_10145592 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300029914|Ga0311359_10133995 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
| 3300029915|Ga0311358_10130929 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300029918|Ga0302143_1183853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300029922|Ga0311363_10115774 | All Organisms → cellular organisms → Bacteria | 3599 | Open in IMG/M |
| 3300029956|Ga0302150_10268777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300029999|Ga0311339_11918678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300030007|Ga0311338_11599892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300030011|Ga0302270_10357760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300030019|Ga0311348_10534371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300030617|Ga0311356_11145936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300030659|Ga0316363_10092461 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300030991|Ga0073994_12425446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300031057|Ga0170834_104268488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300031231|Ga0170824_127939588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300031232|Ga0302323_100505603 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300031236|Ga0302324_101659488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300031521|Ga0311364_11362108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300031716|Ga0310813_10728577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300031718|Ga0307474_11317397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031720|Ga0307469_10838477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300031720|Ga0307469_12005845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300031823|Ga0307478_10745132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300031823|Ga0307478_11054520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300032180|Ga0307471_100390697 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300032180|Ga0307471_104212571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300032893|Ga0335069_10888587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300033405|Ga0326727_10019671 | All Organisms → cellular organisms → Bacteria | 13517 | Open in IMG/M |
| 3300033888|Ga0334792_073351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.09% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.31% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.46% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.46% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.46% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.46% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.46% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.46% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24034J26672_100085581 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRSQQIEILSRIQAALEATRSVFQRFTPGAIETEYKVGHDPVT |
| JGIcombinedJ26739_1000814053 | 3300002245 | Forest Soil | MSSSSNSQELLERIHAALEAARAVLNRFTPGAIETEYKVGHD |
| JGI25382J37095_102623332 | 3300002562 | Grasslands Soil | MNHSLHSETLQRIQTALEAARNVLSRFTAGAIEAEYKIGHDP |
| Ga0062385_106030361 | 3300004080 | Bog Forest Soil | MTSYSSEETLERIHAALEAARTVLNRFTPGAIEAEYKVGHDPVTEADRAVDEVL |
| Ga0062384_1001252673 | 3300004082 | Bog Forest Soil | MTNHSHGETLERIHSALEAARQVFSRFTLGAIETEYKIGHDQVTEADRAVD |
| Ga0062387_1012222342 | 3300004091 | Bog Forest Soil | MSSSSNSQETLERIHAALEAARAVLNRFTPGAIETEYKVGHDPVTEADR |
| Ga0062389_1002083033 | 3300004092 | Bog Forest Soil | MTDSSDADTLQRIQSAMEAARVVLSRFTAGAIETEFKIGHDPVTEADRAPDAVLRKAERGRSKRS* |
| Ga0062389_1046615282 | 3300004092 | Bog Forest Soil | MTSTSTKETLERIHAALEEARAVLNRFTPGDIEAKYKVGTDPVTEADH |
| Ga0062386_1005682172 | 3300004152 | Bog Forest Soil | MPLFGEHKLTSYSSKETLERIHSALESARAVLNRFTPGAI |
| Ga0062386_1008621081 | 3300004152 | Bog Forest Soil | MANNSNAETLQRIQSAMEAARLVFSRFTAGAIEAEYKIGHDPVTEADR |
| Ga0066672_103130742 | 3300005167 | Soil | MGSSSHSEILQRIQVGLEAAREVLGRFTAGDIEAEYKAGHD |
| Ga0066680_100509331 | 3300005174 | Soil | MSSSSNSQEVLERIHAGLEAARVVLNRFTPGAIETEYKVGHDPVTEADRAVD |
| Ga0066679_101256031 | 3300005176 | Soil | MSSSSNSKELLERIHAALEAARTVLKRFTPGAIETEYKVGHDPVTEADRA |
| Ga0066690_100883831 | 3300005177 | Soil | MNHLLHAETLQRIQAALEAARHVLSRFTSGAIEAEYKIGHD |
| Ga0066685_104882881 | 3300005180 | Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAEYKAGH |
| Ga0070687_1011029842 | 3300005343 | Switchgrass Rhizosphere | MSSSFQAETLQRIHSALESAREIFARFTLGAIEAEYKAGHDPVTE |
| Ga0070713_1001801732 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSRSQTETLQRIESALSAARLVFDRFTPGAIAAEYKAGHDPV |
| Ga0070708_1011821222 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSYSSKETLERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVTEADR |
| Ga0066681_100155304 | 3300005451 | Soil | MTQDSEKEILQRIQSALESARSVLSRFTAGAIEAEYKAGQDPVTEADKSVDAVLH |
| Ga0070699_1006776631 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSSHDTLQRIHAALEAAREVLNRFTPGAIEAEYKVGHDPVTEA |
| Ga0070697_1021261271 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSSHDTLQRIHAALEAAREVLNRFTPGAIEAEYKVGHDPVTEAD |
| Ga0070732_107896132 | 3300005542 | Surface Soil | MANNLNAETLQRIQSAMEAARVVFSRFTAGAIEAEY* |
| Ga0066700_104450492 | 3300005559 | Soil | MPSSINSEALERIHCALEAARQVLRRFTAGAIEAEYKAGHDPVTEA |
| Ga0066703_103617002 | 3300005568 | Soil | MGSSSHSEILQRIQVALEAAREVLGRFTAGDIEAEY |
| Ga0066705_102445153 | 3300005569 | Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAEYKAGHDPVTEADKCVD |
| Ga0070762_103443242 | 3300005602 | Soil | MSSSNSQEILERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVTEADRAVDD |
| Ga0070764_104982751 | 3300005712 | Soil | MTKDSHAEILKRIQSALQAARSVFDRFTAGAIDAEYKLGHDPVTEADRAADAVLRKEL |
| Ga0070764_106626481 | 3300005712 | Soil | VGLNGQYPSKSMPIDSHAEIVKRIQSALEAARLVFERFTAGAIDAEYKLGHDPVTEADRAADAVLR |
| Ga0070766_104361132 | 3300005921 | Soil | MSDNSNAETLQRIQAAIEAARVVFSRFTAGAIETEYKIGHDPVTEA |
| Ga0066795_102409741 | 3300005938 | Soil | VNSSAETLERIHAALEAARAVLNRFTPGAIATEYKVGH |
| Ga0080027_102978932 | 3300005993 | Prmafrost Soil | MKTDLNAETLHRIQAALESARRIFDRFTAGDIAAEYKAGHDPVTEAD |
| Ga0066651_104943232 | 3300006031 | Soil | MTNGSNTEILQRIQSALEASRAVFSRFTSGAIQAEYKAGHDPVTEV |
| Ga0075029_1005264402 | 3300006052 | Watersheds | MTSSSSKETLERIHAALEAGREVLNRFTPGAIEAEYKA |
| Ga0075015_1005527742 | 3300006102 | Watersheds | MSSTETLERIHAALEAARAVLNRFTPGAIATEYKVGHDPVT |
| Ga0075015_1007913441 | 3300006102 | Watersheds | MTSSSSKETLERIHAALEAAREVLNRFTPGAIDAEYKAGHDPVTEADRALDDV |
| Ga0075018_104437102 | 3300006172 | Watersheds | MTSNSNAETLQRIQSAIEAARVVFSRFTAGAIETEYKIGHDPVTEADRALD |
| Ga0070765_1002156331 | 3300006176 | Soil | MTDYSNLETLRRIESALEAARVVFSRFTPGAIEAKYKIGHDPVTEADR |
| Ga0075021_107373502 | 3300006354 | Watersheds | MSSSSQADTLERIQSALESARAIFAGFTPGAIEAEYKAGHDPITEADTA |
| Ga0075521_102007132 | 3300006642 | Arctic Peat Soil | MSSSFNSQETLERIHAALEAARAVLNRFTPGAIATEYKVGHDPVTEAD |
| Ga0066659_101042413 | 3300006797 | Soil | MASYSNTETLQRIHSALDAARVVFNRFTSGAIEAEYKAGHDPV |
| Ga0066659_112151411 | 3300006797 | Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAEYKAGHD |
| Ga0066660_100762573 | 3300006800 | Soil | MSSNSKETLERIHAALEAARAVLKGFTPGAIEAKFKIGDD |
| Ga0066660_101829103 | 3300006800 | Soil | MSSSSNSQETLERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVT |
| Ga0075433_105666342 | 3300006852 | Populus Rhizosphere | MNRSQQIEILSRIQAALEATRSVFQRFTPGAIETEYKVGHDPVTEADR |
| Ga0075425_1012742902 | 3300006854 | Populus Rhizosphere | MNRSQQIEILSRIQAALEATRSVFQRFTPGAIETEYKVGHDPVTEADRAVDTL |
| Ga0101947_10933232 | 3300006872 | Drinking Water Pipes | MTSAQDTLNRIHAALEAAREVLNRFTPGAIEAEYK |
| Ga0066710_1045307791 | 3300009012 | Grasslands Soil | MTDSNYSEILQRIQSALEAARAVLSRFTAGAVAAEYKIGRDPVTEADRCVDAV |
| Ga0099829_109999981 | 3300009038 | Vadose Zone Soil | MDVTKPGVLMTSSSHDTLHRIHAALEAAREVLNRFTPGAIEAEYKVGHDPVTEADRAVD |
| Ga0099830_100160711 | 3300009088 | Vadose Zone Soil | MSSSNSQELLERIHAALEAARAVLNRFTPGAIETEYKVGHDPVTEADRAVDDI |
| Ga0116222_12901542 | 3300009521 | Peatlands Soil | MSPSSNSQETLERIHAALEAARTVLNRFTPGAIATEYKVGHDPVTE |
| Ga0116220_104448301 | 3300009525 | Peatlands Soil | MINNSNAEILQRIQSAMEAARVVFNRFTAGAIAAEYKIGHDPVTEADRALDAV |
| Ga0116138_10834242 | 3300009552 | Peatland | MTSYSSKETLERIHAALEAARAVLNRFTPGAIETEYKVGHD |
| Ga0116118_11703711 | 3300009637 | Peatland | MTSYSSKEILERIHAALVAARAVLNRFTPGAIETEYKGGHDPVTE |
| Ga0116110_10641433 | 3300009643 | Peatland | MEYKLTSYSSQETLERIHAALEAARTVLNRFTPGAIATEYKVG |
| Ga0116106_11720272 | 3300009645 | Peatland | MTSYSSAETLERIQAALEAARAVLNRFTPGAVEAEY |
| Ga0116106_11864151 | 3300009645 | Peatland | MTSSSSAETLERIHAALEAARTVLNDFTPGAIEAKFKVGDDPVTAA |
| Ga0116224_101732431 | 3300009683 | Peatlands Soil | MTTYSNAETLQRIQSAIDAARIVFSRFTAGAIETEYKIGHDPVTEADRA |
| Ga0116217_1000419914 | 3300009700 | Peatlands Soil | MTSSSSKETLERIHAALEAARAVLNRFTPGAIAAEYKVGHDPVTEADR |
| Ga0116130_11712541 | 3300009762 | Peatland | VETLERIHAALEAARAVLSRFTPGAIEAEYKVGRDPVTEA |
| Ga0116134_13015751 | 3300009764 | Peatland | VETLERIHAALEAARAVLSRFTPGAIEAEYKVGRDPVTE |
| Ga0126373_112743342 | 3300010048 | Tropical Forest Soil | LDYMTANSSSETLERIQAALDAAREVLNQFTPGAIAAEYKVG |
| Ga0134080_102676912 | 3300010333 | Grasslands Soil | MGGNSNSEVLNRIQSALEAARQILGRFTAGAIEAEYKVGHDPV |
| Ga0126377_108948362 | 3300010362 | Tropical Forest Soil | MTKSETQDILRRIHSALEAARTVLSRYTAGEIAAEYKAGHDPVTEAD |
| Ga0126379_117016442 | 3300010366 | Tropical Forest Soil | MNPNSSSETLKRIQAALEAACTVLNQFTPGAIEAEYKSG |
| Ga0136449_1023498211 | 3300010379 | Peatlands Soil | MPSSNSAETLERIHAALEAARGVLNRFTPGAVEAEYKVGHDPVTEADRAVDSVLHK |
| Ga0137392_107419431 | 3300011269 | Vadose Zone Soil | MSSSNSQELLERIHAALEAARAVLDRFTPGAIETEYKVEHDPAT |
| Ga0137391_104494971 | 3300011270 | Vadose Zone Soil | MANPSQTESLQRIGSALESARQIFARFTLGAIEAEYKAGHDPVTEADK |
| Ga0137393_105110872 | 3300011271 | Vadose Zone Soil | MSSSSNSQELLERIHAALEAARAVLNRFTPGAIETEYKVGHDPVTEADRAV |
| Ga0137389_104873031 | 3300012096 | Vadose Zone Soil | MSSSNSQELLERIHAALEAARAVLNRFTPGAIETEYKVGHDPVTEADRAV |
| Ga0137364_105774732 | 3300012198 | Vadose Zone Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAEYKAGHDPVTEA |
| Ga0137363_102879801 | 3300012202 | Vadose Zone Soil | MGANSNSEVLNRIQSALEAARQILGRFTAGASEAEYKAGHDPVTEADKCVD |
| Ga0137399_102417103 | 3300012203 | Vadose Zone Soil | MSSSSNSQELLERIHAALEAARAVLNRFTPGAIETEYKVGHDPVTEADR |
| Ga0137399_104648801 | 3300012203 | Vadose Zone Soil | MSTHSHAETLQRIKSALGAARQVFARFTLGAIAAEYKAGHDP |
| Ga0137362_105550872 | 3300012205 | Vadose Zone Soil | MDDHSQAETLQRIRSALEGACQVLTRFTLGAIEAEYKVGHDPVTDADTSVDSVL |
| Ga0137376_112495652 | 3300012208 | Vadose Zone Soil | MTNRSSSEILQRIQSALEASRTVFSRFTCGAIEAEYKAGHDPVTEADKS |
| Ga0137376_114912641 | 3300012208 | Vadose Zone Soil | LIRTSSHSNFGTLQRIQSALEAAQDVFSRYTPGAVAAEYKAGHDPVTAADKTV |
| Ga0137379_117755352 | 3300012209 | Vadose Zone Soil | MTSSSHDTLQRVHAALEAAREVLNRFTPGAIEAEYKVGHDPV |
| Ga0137378_104593563 | 3300012210 | Vadose Zone Soil | MNHSSHSETLQRIQTALEAARNVLSRFTAGAIEAEYKIG |
| Ga0137386_104865502 | 3300012351 | Vadose Zone Soil | MNHSSHSETLQRIQTALEAARNVLSGFTAGAIEAEYKIGQDPVTEA |
| Ga0137371_104586581 | 3300012356 | Vadose Zone Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAEYKAGHDPVTEAD |
| Ga0137361_117748122 | 3300012362 | Vadose Zone Soil | MNRSSNSETLQRIHAGLEAARKVLSRFTPGAIEIEYKIGHDPVTEADRQVD |
| Ga0137390_104997023 | 3300012363 | Vadose Zone Soil | MMTSSSSTETLERIHAALEAARIVLKRFTPGAIETEYKVGH |
| Ga0137395_105223012 | 3300012917 | Vadose Zone Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAEYKAG |
| Ga0137416_119245142 | 3300012927 | Vadose Zone Soil | MNRSSNSETLQRIHAGLEAARKVLSRFTPGAIEIEYKIG |
| Ga0164304_107120001 | 3300012986 | Soil | MSGSFQAETLQRIHSALESAREIFARFTLGAIEAEYKAGHDPVTEADRA |
| Ga0164306_106609852 | 3300012988 | Soil | MSGSFQAETLQRIHSALESAREIFARFTLGAIEAEYKAGHDPVTEAD |
| Ga0181518_101038413 | 3300014156 | Bog | VTSYSSAETLERIHAALEAARTVLNRFTSGAIEAEYKVGHDPVTE |
| Ga0181538_101543141 | 3300014162 | Bog | MSSSSNSQELLERIHAALEAARTVLNRFTPGAIEAEFKVGHDPVTKADRAVDDILRKNLIRA |
| Ga0181526_109054142 | 3300014200 | Bog | MSSSCNSQELLERIHVALEAARGVLNRFTPGAIATEYTV |
| Ga0182013_103119371 | 3300014492 | Bog | MTSSSSKETLLRIHSALEAGREVLNRFTPGAIDAEYKAGHDPVTEADRA |
| Ga0182024_125037022 | 3300014501 | Permafrost | MTNNSNAETLQRIQSAMEAARIVFSRFTAGAIEAEYKIGHDPVTEADH |
| Ga0181536_100111858 | 3300014638 | Bog | MTSHSSQETLERIHSALEAARAVLNRFTPGAIETEYKVGHDPVTEAD |
| Ga0137403_105232662 | 3300015264 | Vadose Zone Soil | MTSASIHETLERIHAGLEAARAVLNRFTSGAIEAEYK |
| Ga0137403_114718001 | 3300015264 | Vadose Zone Soil | MTSSSQDTLQRIHAALEAAREVLNRFTPGAIEAEYKVGHDPVTE |
| Ga0137403_115705292 | 3300015264 | Vadose Zone Soil | MNDTLQRIHAALEAAREVLNRFTPGAIETEYKVGHDPVTEAD |
| Ga0182040_110123011 | 3300016387 | Soil | MTQSAYADILQRIHSALEAGRAVLSRFTAGAIEAEYKAGHDP |
| Ga0181511_11733821 | 3300016702 | Peatland | MTSYSSSSKSKETLERIHTGLEAARTVLNRFTPGAIATEYKVGHDPVTE |
| Ga0134112_102760861 | 3300017656 | Grasslands Soil | MTQDSEKEILQRIQSALESARSVLSRFTAGAIEAEYKAGQDPVTEADKSVDAV |
| Ga0187802_102149761 | 3300017822 | Freshwater Sediment | MTSHSHADTLARIHSALQAARQVFSRFTAGAIEAEYKIGHDPVTE |
| Ga0187818_102853081 | 3300017823 | Freshwater Sediment | MTSTKETLDRIHAALEEARTVLNRFTPGAIEAQYKVGTDPVTE |
| Ga0187825_100866841 | 3300017930 | Freshwater Sediment | MTTSPHAEILQRIQSALEAARAVFNRFTAGAIDAEYKIGHDPVTEADRAVDA |
| Ga0187877_13229851 | 3300017931 | Peatland | VASYSSAETLERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVTEADRAV |
| Ga0187801_102042852 | 3300017933 | Freshwater Sediment | MTANSSKETLERIHAALEAARVVLNRFTPGAIEAEYKVGHDPVTEA |
| Ga0187801_103080411 | 3300017933 | Freshwater Sediment | MAKSSNAETLQRIHSAMEAARVVFSRFTAGAIEAEYKIGHDPVTEADR |
| Ga0187854_102078311 | 3300017938 | Peatland | MEYKLTSYSSQETLERIHAALEAARTVLNRFTPGAIATEYKVGHDPVTEAD |
| Ga0187879_102446281 | 3300017946 | Peatland | LTSYSSAETLERIHAALEAARAVLNRFTPGAIETEYKVGHDPVTEA |
| Ga0187817_105918301 | 3300017955 | Freshwater Sediment | MTYSSAETLERIHAALEAARAVLKGFTPGAIEAKFKVGDDPVTA |
| Ga0187817_108633932 | 3300017955 | Freshwater Sediment | MANNSNTETLQRIQSAMEAARVVFSRFTAGEIAAEYKIGHDPVTEADRA |
| Ga0187779_112019842 | 3300017959 | Tropical Peatland | MTDCSTEILPRIEAALETARQVLCRFTPGAIEAEY |
| Ga0187778_100549613 | 3300017961 | Tropical Peatland | MVSFPHTETLERIESALRAARTVFQRFTLGAIEAEYKAGHDPVTEADRALDVALRK |
| Ga0187776_107460601 | 3300017966 | Tropical Peatland | MDRHSNAEILARTHAALEAARTVFRRFTPGSIEAEYKIGHDPVTEADRAVDAVL |
| Ga0187782_104360192 | 3300017975 | Tropical Peatland | MTSHTETLHRIESALNAARTVFQRFTLGTIEPEYKAGHDPVTEADRA |
| Ga0181520_101605293 | 3300017988 | Bog | MSDNSNAETLQRIQSAIEAARVVFSRFTAGAIETE |
| Ga0187805_101896901 | 3300018007 | Freshwater Sediment | MTSSKETLDRIHAALEEARTVLNRFTPGAIEAQYKVGT |
| Ga0187884_104165761 | 3300018009 | Peatland | MSDNSNAETLQRIQAAIEAARVVFSRFTAGAIETEYKIGHDPV |
| Ga0187873_11136661 | 3300018013 | Peatland | MTSHSSQETLERIHAALEAARAVINRFTPGAIETEYKVGHDPVTEADRAVDDI |
| Ga0187872_102857371 | 3300018017 | Peatland | VASYSSAETLERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVTEADR |
| Ga0187882_11392612 | 3300018021 | Peatland | LTSYSSKETLERIHAALEAAREVLNRFTPGAIEAEYK |
| Ga0187867_103999102 | 3300018033 | Peatland | MSNNSNAETLQRIQSAIEAARVVFSRFTAGAIETE |
| Ga0187851_108776941 | 3300018046 | Peatland | MTSSFTKETLERIHAALEEARTVLNRFTPGAIEAQYKV |
| Ga0187772_100211464 | 3300018085 | Tropical Peatland | MSSHSHAETLERIYSALEAARKVFSRFTAGAIEAEYKIGH |
| Ga0187772_103328011 | 3300018085 | Tropical Peatland | MISSLNSETLQRIQSALEAAREILNQFTAGAIEAEYKVG |
| Ga0187772_114083782 | 3300018085 | Tropical Peatland | MTSNLNAETLQRIQAALEAAREILNGFTPGAIEAEYKAG |
| Ga0187770_105981352 | 3300018090 | Tropical Peatland | VASYSSAETLERIQAALEAARGVLNRFTPGAVEAEYKVGHD |
| Ga0187770_111438492 | 3300018090 | Tropical Peatland | MISYSSQETLERIHAALEAARAVLNTFTPGAIEAKFKSGDDPVT |
| Ga0066655_113356622 | 3300018431 | Grasslands Soil | VKDNFQSEALQRIHSALEATRLILSHFTPGEIQTEYKAGHDPVTWADH |
| Ga0181510_11616762 | 3300019240 | Peatland | MTDLNSETLQRIHAALEAARDVLNRFTPGAIETEYKIGHDPV |
| Ga0187797_12698681 | 3300019284 | Peatland | MTSPCTKETLERIHAALEAGREVLNRYTPGAIEAEYKAGHDP |
| Ga0182031_13234301 | 3300019787 | Bog | MTSSSSAETLERIHAALEAARTVLNDFTPGAIEAKFKVGDDP |
| Ga0137408_14131122 | 3300019789 | Vadose Zone Soil | MSTHSHAETLQRIKSALGAARQVFARFTLGAIEAEYKAGHDPVTEADKAV |
| Ga0193728_11405081 | 3300019890 | Soil | MDPYSNSETLERIHAGLEAARSVLNRFTAGAVATQFK |
| Ga0210401_105187202 | 3300020583 | Soil | MTNYSNNETLRRIQSALEAARVVLTRFISGAIEAEYKAGHD |
| Ga0210401_105699512 | 3300020583 | Soil | MPNHSNAETLQRIQSAIEAARVVFSRFTAGAIAAEYKVGHD |
| Ga0210405_103094673 | 3300021171 | Soil | MSDYSNNETLRRIESALEAARVVFSGFTPGAIEAEYKIGH |
| Ga0210396_113837102 | 3300021180 | Soil | MSDNSNAETLQRIQSAIEAARVVFSRFTAGAIETEYKIGHDPVTE |
| Ga0210388_101114353 | 3300021181 | Soil | MTSHSSVETLERIHSALEAAREVLNRFTPGAIETEYKA |
| Ga0210388_103132211 | 3300021181 | Soil | MSPANTQETLERIHAALEAAREVLNRFTPGAIETEYK |
| Ga0210388_109665552 | 3300021181 | Soil | MSSSTNSREFLERIHAALEAARTVLNRFTPGAIETEYKVGHDPVTEA |
| Ga0210393_115661132 | 3300021401 | Soil | MTSHSSVETLERIHSALEAAREVLTRFTPGAIETEYKAGHDPVTEADRA |
| Ga0210385_109076202 | 3300021402 | Soil | MSSSTNSREFLERIHAALEAARTVLNRFTPGAIETEYKVGHDPVTEADRAVDDVL |
| Ga0210397_106693351 | 3300021403 | Soil | MANNRDAETLQRIQSAIDAARVVFSRFTAGAIEAEYKIGHDPVTEADR |
| Ga0210389_102420371 | 3300021404 | Soil | MSSSTNSREFLERIHAALEAARTVLNRFTPGAIETEYKVGHD |
| Ga0210387_103932363 | 3300021405 | Soil | MTSYSSEETLERIQAALEAARAVLNRFTPGAIEAE |
| Ga0210387_117379701 | 3300021405 | Soil | MANNRDAETLQRIQSAMEAARVVFSRFTAGAIEAEYKIGHDPVTE |
| Ga0210383_105536621 | 3300021407 | Soil | MPNSNAETLQRIQSAMEAARVVFSRFTAGAIETEYKIGHDPVTEADRALDA |
| Ga0210410_110976361 | 3300021479 | Soil | MANNRNAETLQRIQSAMEAARVVFSRFTAGAIEAEYKIGHDPVTEA |
| Ga0126371_130859173 | 3300021560 | Tropical Forest Soil | MTLSSQAEGLARIQAALEAARSVLNRFTPGAIEAEYK |
| Ga0242662_100979481 | 3300022533 | Soil | MSSSNSQEILERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVTEADRAVD |
| Ga0212123_101938003 | 3300022557 | Iron-Sulfur Acid Spring | MSSSSNSQELLERIHAALEAARAVLNRFTPGAIET |
| Ga0209584_101389152 | 3300025878 | Arctic Peat Soil | MSSSFNSQETLERIHAALEAARAVLNRFTPGAIATEYK |
| Ga0207687_103876841 | 3300025927 | Miscanthus Rhizosphere | MSSSSQAGTLERIRSALESAHQIFSRFTPGAIEAEYKAGHDPVT |
| Ga0207677_104830743 | 3300026023 | Miscanthus Rhizosphere | MNSSFQTETVERIQAALESARQVFARFTPGEIEAEYKAGHDPVTEADKA |
| Ga0209839_101607381 | 3300026294 | Soil | LTSYSPKETLERIHTALEAARTVLNGFTPGAIEAKFKVGDDPVTAA |
| Ga0209236_10497123 | 3300026298 | Grasslands Soil | MINRSSTEILQRIQSALEASRTVFSRFTCGTIEAEYKAGQDPVTEADRS |
| Ga0209265_10165181 | 3300026308 | Soil | MGANSNSEVLNRIQSALEAARQILGRFTAGAIEAEY |
| Ga0209471_11949732 | 3300026318 | Soil | MTTSLDILKRIESALDAARVVLNRFTAGAIEAEYKIG |
| Ga0209131_11369883 | 3300026320 | Grasslands Soil | MTSSSHDTLQRIHAALEAAREVLNRFTPGAIDAEYK |
| Ga0209267_10156541 | 3300026331 | Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAE |
| Ga0209803_11269352 | 3300026332 | Soil | MGANSNSEVLNRIQSALEAARQILGRFTAGAIEAEYKAGHDPVTEADKC |
| Ga0209158_10634703 | 3300026333 | Soil | MSSSSNSQELLERIHAGLEAARVVLNRFTPGAIETEYKVGRD |
| Ga0209804_12082851 | 3300026335 | Soil | MSSSSNSQETLERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVTEADRAVDDI |
| Ga0209057_11053151 | 3300026342 | Soil | MGSNSNSDVLKRIQSALEAARQILGRFTAGGIEAEYKAG |
| Ga0257164_10574602 | 3300026497 | Soil | MTSSSHDTLQRIHAALEAAREVLNRFTPGAIEAEYKVGH |
| Ga0257156_11353921 | 3300026498 | Soil | MTSSSRDTLQRIHAALEAAREVLNRFTPGAIEAEYKVGHDPVTEA |
| Ga0257181_10554842 | 3300026499 | Soil | MSSSNSQEILERIHAALEAARAVLNRFTPGAIEAEYKVGHDPVTEADRAV |
| Ga0209160_10102331 | 3300026532 | Soil | MINRSSTEILQRIQSALEASRTVFSRFTCGTIEAEYKAGQDPVTEAD |
| Ga0209056_106926671 | 3300026538 | Soil | MTSAYSEILTRIDNALEAARDVFSRFNAGAIEAEFKAGHDPVTEADRAVD |
| Ga0209332_10214733 | 3300027439 | Forest Soil | MSSSLNSKEILERIHAALEAARAVLNGFTPGAIEAEYKVGHD |
| Ga0209735_10768271 | 3300027562 | Forest Soil | MDNKLNSETLRRIQAALESASNILSRFTPGDIETEYKKGHDPVT |
| Ga0208043_11879162 | 3300027570 | Peatlands Soil | MSPSSNSQETLERIHAALEAARTVLNRFTPGAIATEYKVGHDP |
| Ga0208827_10854732 | 3300027641 | Peatlands Soil | MTNNSNAETLQRIESAMEAARVVFGRFTAGAIAAEYKIGHDPVTEADRALD |
| Ga0208565_12323002 | 3300027662 | Peatlands Soil | MTTYSNAETLQRIQSAIDAARIVFSRFTAGAIETEY |
| Ga0208696_10868292 | 3300027696 | Peatlands Soil | MTTYSNAETLQRIQSAIDAARIVFSRFTAGAIETEYKIGHDPVTEADRALDA |
| Ga0209248_100645983 | 3300027729 | Bog Forest Soil | MTSSTSSTSKETLERIHAALEAAREVLNRFTPGAIETE |
| Ga0209689_11734251 | 3300027748 | Soil | MGSNSNSDVLQRIQSALEAARQILGRFTAGAIEAEYKAGHDPVTEADKC |
| Ga0209655_102642972 | 3300027767 | Bog Forest Soil | MTKNSNAETLQRIQSAIDAARVVFSRFTAGAIETEYKIGHDP |
| Ga0209655_103097171 | 3300027767 | Bog Forest Soil | MSSSNSQEILERIHAALEAARAVLKGFTPGAIEAKFKVGDD |
| Ga0209169_107160022 | 3300027879 | Soil | MTHNSNAETLQRIQAAIEAARVVFTRFTAGAIETEYKIGH |
| Ga0209068_105377922 | 3300027894 | Watersheds | MTSSNDTLERIHAALEAAREVLNRFTPGAIETEYKVGHDPV |
| Ga0209624_108101652 | 3300027895 | Forest Soil | MTSNSDAETLQRIQSAIEAARGVFSRFTAGAIAAEYKIGHDPVT |
| Ga0209488_101471503 | 3300027903 | Vadose Zone Soil | MNDTLQRIHTALEAAREVLNRFTPGAIETEYKSGHDPVTEADRA |
| Ga0209488_108276142 | 3300027903 | Vadose Zone Soil | MTTSLDILKRIESALDAARVVLNRFTAGAIEAEYKIGH |
| Ga0209415_100875474 | 3300027905 | Peatlands Soil | MTNNSNAETLQRIQSAMEAARVVFGRFTAGAIAAEYKIGHDPVTEAD |
| Ga0209006_106079712 | 3300027908 | Forest Soil | MTSHSSVETLERIHSALEAAREVLNRFTPGAIETEYKAGHDPVTEA |
| Ga0209006_110258711 | 3300027908 | Forest Soil | MTSSLVKETLERIHAALEAARAVLNRFTPGAIETEYKV |
| Ga0209698_108727572 | 3300027911 | Watersheds | LTSYSNAETLERIHAALEAARTVLNGFTPGAIEAKFKVGDDPITAADHAVD |
| Ga0302303_102214992 | 3300028776 | Palsa | LISYSSKETLDRIHAALEAARAVLNRFTPGAIATEYKVGHDPVTEADRSVDNILRK |
| Ga0222749_101455923 | 3300029636 | Soil | MTQHSRQDILDRIHSALEAARMVFSRFNAGAIEAEY |
| Ga0311359_101339951 | 3300029914 | Bog | MSSSTSQEFLERIHAGLEAARAVLNRFTPGAIETEYKVGHDPVTEADRAV |
| Ga0311358_101309291 | 3300029915 | Bog | MSSSISNSKEILERLHAGLEAARTVLNRFTPGAIETE |
| Ga0302143_11838532 | 3300029918 | Bog | MSSSTSQEFLERIHAGLEAARAVLNRFTPGAIETEYKVGHDPVTEA |
| Ga0311363_101157744 | 3300029922 | Fen | MSSSISNSKEILERLHAGLEAERTVLNRFTPGAIETEYK |
| Ga0302150_102687771 | 3300029956 | Bog | MSSSNLKEILERLHAGLEAARTVLNRFTPGAIETEYKVGHDPVTEAD |
| Ga0311339_119186781 | 3300029999 | Palsa | MTSSSKEILERIHTALEAARTVLNRFTPGAIETEYKVGHDPVTEADRAVDDI |
| Ga0311338_115998922 | 3300030007 | Palsa | MTSSSSQELLERIHTVLESARTVLNRFTPGAIETDYKVGQDPVTEADR |
| Ga0302270_103577602 | 3300030011 | Bog | MSSSNLKEILERLHAGLEAARTVLNRFTPGAIETEYKVGHDPVTEADRAVDDVL |
| Ga0311348_105343711 | 3300030019 | Fen | MTKAETEDILKRIHSALEAARVVLSRFTAGAIETEYKVGHDPV |
| Ga0311356_111459361 | 3300030617 | Palsa | MTSSSSSEILERIHAALEAAREVLNRFTPGAIETEYKVGH |
| Ga0316363_100924613 | 3300030659 | Peatlands Soil | MTNNSNAETLQRIQSAMEAARVVFGRFTAGAIAAEYKIGHDPVTEADRALD |
| Ga0073994_124254462 | 3300030991 | Soil | MTNNSNPETLQRIQSAIEAARLVFSRFTPGGIAAEYKIGH |
| Ga0170834_1042684881 | 3300031057 | Forest Soil | MSSSNSQELLERIHAAFEAARAVLNRFTPGAIETEYKVGHDPVTE |
| Ga0170824_1279395881 | 3300031231 | Forest Soil | MTTNHSDADTLHRIQSAIEAARTVFSRFTAGAIET |
| Ga0302323_1005056033 | 3300031232 | Fen | MTSSSNDTLQRIHAALEAAREVLNRFTPGAIETEYK |
| Ga0302324_1016594882 | 3300031236 | Palsa | MSFSSNSQELLERIHAALEAARAVLNRFTPGAIEAEYKVGH |
| Ga0311364_113621081 | 3300031521 | Fen | MTKAETEDILKRIHSALEAARVVLSRFTAGAIETEYKVGHDPVTE |
| Ga0310813_107285772 | 3300031716 | Soil | MNRSQQIEILSRIQAALEATRSVFQRFTPGAIETEYKVGHDPVTE |
| Ga0307474_113173971 | 3300031718 | Hardwood Forest Soil | LTSSSTRETLERIHAALEEARTVLNRFTPGDIEAKYKIGTDPV |
| Ga0307469_108384772 | 3300031720 | Hardwood Forest Soil | MPMTIDSHVEVVQRIQSALEAARKVFERFTAGAIDAEYKLGHDPVT |
| Ga0307469_120058451 | 3300031720 | Hardwood Forest Soil | MTNHSRSEILQRIQSALEAARTVFSRFTCGAIEAEYKAGHDPVTEA |
| Ga0307478_107451322 | 3300031823 | Hardwood Forest Soil | MTNNSNAETLQRIQSAMEAARVVFSRFTAGAIEAEYKIGHDP |
| Ga0307478_110545201 | 3300031823 | Hardwood Forest Soil | MANNRNVETLQRIQSAMEATRVVFSRFTAGAIGAEYKIGHDPVTEADR |
| Ga0307471_1003906973 | 3300032180 | Hardwood Forest Soil | MSSSNSQELLERIHAALEAARAVLNRFTPGAIETE |
| Ga0307471_1042125712 | 3300032180 | Hardwood Forest Soil | MSSSFQAETLQRIHSALESAREIFTRFTPGAIEAEYKAGH |
| Ga0335069_108885872 | 3300032893 | Soil | MSSSSQETLQRIHAALEAAREVLNRFTPGAIETEYKAGHDPVTEADRAV |
| Ga0326727_100196711 | 3300033405 | Peat Soil | MIDTQGTLTRIHAALEAGRAVLNRFTPGAIEAEYKAG |
| Ga0334792_073351_3_164 | 3300033888 | Soil | MPSSNSAETLERIHAALEAARAVLNRFTPGAIQAEYKVGHDPVTDADRAVDSVL |
| ⦗Top⦘ |