NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022056

Metagenome / Metatranscriptome Family F022056

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022056
Family Type Metagenome / Metatranscriptome
Number of Sequences 216
Average Sequence Length 40 residues
Representative Sequence VTEDSSRVAWLQQARSYLRNADPVLARLIDDRPDFDPRAW
Number of Associated Samples 189
Number of Associated Scaffolds 216

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.66 %
% of genes near scaffold ends (potentially truncated) 97.22 %
% of genes from short scaffolds (< 2000 bps) 91.67 %
Associated GOLD sequencing projects 183
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.574 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.482 % of family members)
Environment Ontology (ENVO) Unclassified
(26.852 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.889 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.59%    β-sheet: 0.00%    Coil/Unstructured: 54.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 216 Family Scaffolds
PF00857Isochorismatase 9.72
PF00196GerE 6.94
PF07690MFS_1 4.17
PF13193AMP-binding_C 2.31
PF00496SBP_bac_5 1.85
PF03060NMO 1.85
PF00903Glyoxalase 1.39
PF00676E1_dh 1.39
PF12270Cyt_c_ox_IV 1.39
PF00753Lactamase_B 1.39
PF12681Glyoxalase_2 0.93
PF07366SnoaL 0.93
PF13231PMT_2 0.93
PF12697Abhydrolase_6 0.93
PF13683rve_3 0.93
PF13460NAD_binding_10 0.93
PF01717Meth_synt_2 0.93
PF00440TetR_N 0.93
PF01596Methyltransf_3 0.93
PF13561adh_short_C2 0.93
PF00582Usp 0.93
PF03328HpcH_HpaI 0.93
PF07730HisKA_3 0.46
PF00355Rieske 0.46
PF00144Beta-lactamase 0.46
PF00248Aldo_ket_red 0.46
PF01183Glyco_hydro_25 0.46
PF01638HxlR 0.46
PF01027Bax1-I 0.46
PF08125Mannitol_dh_C 0.46
PF02779Transket_pyr 0.46
PF02148zf-UBP 0.46
PF04545Sigma70_r4 0.46
PF00141peroxidase 0.46
PF04389Peptidase_M28 0.46
PF00271Helicase_C 0.46
PF00924MS_channel 0.46
PF01243Putative_PNPOx 0.46
PF00892EamA 0.46
PF12902Ferritin-like 0.46
PF16124RecQ_Zn_bind 0.46
PF00571CBS 0.46
PF12680SnoaL_2 0.46
PF05235CHAD 0.46
PF08281Sigma70_r4_2 0.46
PF12802MarR_2 0.46
PF00106adh_short 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 216 Family Scaffolds
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 9.72
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 9.72
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 1.85
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 1.85
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 1.39
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 1.39
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.93
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.93
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.93
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.93
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.93
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.93
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.93
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.46
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.46
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.46
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.46
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 0.46
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.46
COG0246Mannitol-1-phosphate/altronate dehydrogenasesCarbohydrate transport and metabolism [G] 0.46
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 0.46
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.46
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 0.46
COG2367Beta-lactamase class ADefense mechanisms [V] 0.46
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.46
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.46
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.46
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.46
COG0376Catalase (peroxidase I)Inorganic ion transport and metabolism [P] 0.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.57 %
UnclassifiedrootN/A13.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_11403917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300004091|Ga0062387_101375641All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300004629|Ga0008092_11161976Not Available506Open in IMG/M
3300005334|Ga0068869_101454435All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005337|Ga0070682_101380453Not Available602Open in IMG/M
3300005366|Ga0070659_100114986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2174Open in IMG/M
3300005435|Ga0070714_100199147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus1831Open in IMG/M
3300005436|Ga0070713_101684731All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005456|Ga0070678_102203501All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005535|Ga0070684_101487562All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005544|Ga0070686_100573896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8885Open in IMG/M
3300005602|Ga0070762_10593037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii735Open in IMG/M
3300005712|Ga0070764_10786111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300005764|Ga0066903_100774324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1710Open in IMG/M
3300005764|Ga0066903_104410966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. ATCC 31491751Open in IMG/M
3300006028|Ga0070717_11066629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. ATCC 31491736Open in IMG/M
3300006028|Ga0070717_11168401All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006028|Ga0070717_11982827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus525Open in IMG/M
3300006058|Ga0075432_10061993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1332Open in IMG/M
3300006059|Ga0075017_100373064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1066Open in IMG/M
3300006102|Ga0075015_100784933All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006173|Ga0070716_100895047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300006175|Ga0070712_101628582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300006578|Ga0074059_11999503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300006606|Ga0074062_12516190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300006755|Ga0079222_10166627Not Available1277Open in IMG/M
3300006794|Ga0066658_10003036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. DC125933Open in IMG/M
3300006804|Ga0079221_10874339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium fulvum656Open in IMG/M
3300006844|Ga0075428_102741988All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300006847|Ga0075431_102202676All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006854|Ga0075425_102204928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300006904|Ga0075424_101821156All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006954|Ga0079219_10768415All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006954|Ga0079219_11032726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300007076|Ga0075435_101017303All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300007788|Ga0099795_10117228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1061Open in IMG/M
3300009088|Ga0099830_10879379Not Available741Open in IMG/M
3300009089|Ga0099828_11023919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium735Open in IMG/M
3300009156|Ga0111538_14103810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Gandjariella → Gandjariella thermophila503Open in IMG/M
3300009162|Ga0075423_12337500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300009520|Ga0116214_1028210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2014Open in IMG/M
3300009551|Ga0105238_10944389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300010042|Ga0126314_11438641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MBT53518Open in IMG/M
3300010043|Ga0126380_10278656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1176Open in IMG/M
3300010358|Ga0126370_10606172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium946Open in IMG/M
3300010361|Ga0126378_10834151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1030Open in IMG/M
3300010361|Ga0126378_11996535Not Available661Open in IMG/M
3300010366|Ga0126379_10406187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin1001411Open in IMG/M
3300010366|Ga0126379_12849657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. ATCC 31491579Open in IMG/M
3300010376|Ga0126381_103382937All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300010398|Ga0126383_10169997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2058Open in IMG/M
3300010398|Ga0126383_11670799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300010401|Ga0134121_11509558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium fulvum687Open in IMG/M
3300011271|Ga0137393_10407743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1164Open in IMG/M
3300012096|Ga0137389_11353543All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012199|Ga0137383_10650498All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300012205|Ga0137362_11486259All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012210|Ga0137378_10550544All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300012349|Ga0137387_10063357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2501Open in IMG/M
3300012350|Ga0137372_10024086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5658Open in IMG/M
3300012353|Ga0137367_10394470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300012354|Ga0137366_11112504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300012362|Ga0137361_11086501All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300012481|Ga0157320_1005311All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300012917|Ga0137395_10789099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300012951|Ga0164300_10808874All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012951|Ga0164300_11211209All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012971|Ga0126369_11896173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300012988|Ga0164306_10697914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300012988|Ga0164306_11094172Not Available662Open in IMG/M
3300013100|Ga0157373_10342540All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300013307|Ga0157372_13179876All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300014495|Ga0182015_10819571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300014745|Ga0157377_11049212All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300015077|Ga0173483_10126091Not Available1101Open in IMG/M
3300015242|Ga0137412_10072223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis2808Open in IMG/M
3300015245|Ga0137409_10457858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1096Open in IMG/M
3300015264|Ga0137403_11525311All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300015374|Ga0132255_103414472Not Available676Open in IMG/M
3300016270|Ga0182036_11165335All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300016341|Ga0182035_10281281Not Available1356Open in IMG/M
3300016357|Ga0182032_11854633All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300016371|Ga0182034_11434890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300016422|Ga0182039_11778974All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300017926|Ga0187807_1271564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300017928|Ga0187806_1075357All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300017942|Ga0187808_10059722All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300017947|Ga0187785_10077991All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300017994|Ga0187822_10146770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia755Open in IMG/M
3300018017|Ga0187872_10051140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus2210Open in IMG/M
3300018075|Ga0184632_10371282Not Available607Open in IMG/M
3300020579|Ga0210407_11313869All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300020581|Ga0210399_10181209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1749Open in IMG/M
3300020581|Ga0210399_10333918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300020582|Ga0210395_10587184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae836Open in IMG/M
3300020583|Ga0210401_10914094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300021180|Ga0210396_10993198All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300021180|Ga0210396_11244173Not Available621Open in IMG/M
3300021180|Ga0210396_11593633All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300021401|Ga0210393_11121911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia634Open in IMG/M
3300021402|Ga0210385_10633295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300021404|Ga0210389_11252253All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300021405|Ga0210387_11042464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300021407|Ga0210383_11392401All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300021433|Ga0210391_10310425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1237Open in IMG/M
3300021474|Ga0210390_10405357All Organisms → cellular organisms → Bacteria → Terrabacteria group1152Open in IMG/M
3300021477|Ga0210398_10320686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1264Open in IMG/M
3300021477|Ga0210398_11249923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300021478|Ga0210402_10025109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5127Open in IMG/M
3300021478|Ga0210402_10329830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus1414Open in IMG/M
3300021560|Ga0126371_10235724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1939Open in IMG/M
3300025625|Ga0208219_1121986All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300025703|Ga0208357_1033835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1788Open in IMG/M
3300025898|Ga0207692_10915410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300025905|Ga0207685_10075151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1382Open in IMG/M
3300025906|Ga0207699_11269174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300025908|Ga0207643_10373020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300025910|Ga0207684_10229156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1603Open in IMG/M
3300025915|Ga0207693_10607651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria851Open in IMG/M
3300025916|Ga0207663_10510292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria935Open in IMG/M
3300025922|Ga0207646_11184441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300025928|Ga0207700_10474794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1104Open in IMG/M
3300025928|Ga0207700_11830018Not Available533Open in IMG/M
3300025937|Ga0207669_10226060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G81377Open in IMG/M
3300025949|Ga0207667_10488000All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300025972|Ga0207668_11932254All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300026089|Ga0207648_11160455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8725Open in IMG/M
3300026089|Ga0207648_11775393All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium578Open in IMG/M
3300026490|Ga0257153_1119754All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027567|Ga0209115_1067931Not Available812Open in IMG/M
3300027662|Ga0208565_1153580All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300027750|Ga0209461_10008671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1703Open in IMG/M
3300027767|Ga0209655_10139498All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300027867|Ga0209167_10723073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300027908|Ga0209006_11386969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300027909|Ga0209382_11571097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300028780|Ga0302225_10241117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300028806|Ga0302221_10042497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2112Open in IMG/M
3300028810|Ga0307294_10036656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G81375Open in IMG/M
3300028814|Ga0307302_10046013All Organisms → cellular organisms → Bacteria2028Open in IMG/M
3300028828|Ga0307312_10535634All Organisms → cellular organisms → Bacteria → Terrabacteria group774Open in IMG/M
3300028884|Ga0307308_10393166All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300029999|Ga0311339_10478032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CB018811274Open in IMG/M
3300030499|Ga0268259_10079295All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300030520|Ga0311372_10296079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae2562Open in IMG/M
3300030739|Ga0302311_10966677All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031091|Ga0308201_10228254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi630Open in IMG/M
3300031114|Ga0308187_10429269Not Available528Open in IMG/M
3300031544|Ga0318534_10022499Not Available3366Open in IMG/M
3300031546|Ga0318538_10552745All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300031546|Ga0318538_10720468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300031549|Ga0318571_10150495All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300031572|Ga0318515_10020584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae3111Open in IMG/M
3300031668|Ga0318542_10472307All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300031680|Ga0318574_10349096Not Available862Open in IMG/M
3300031680|Ga0318574_10877465All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031708|Ga0310686_104551934All Organisms → cellular organisms → Bacteria → Terrabacteria group577Open in IMG/M
3300031708|Ga0310686_119451396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300031718|Ga0307474_10656807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria828Open in IMG/M
3300031724|Ga0318500_10583495All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031740|Ga0307468_102243424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300031744|Ga0306918_10197611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1514Open in IMG/M
3300031747|Ga0318502_10899839Not Available538Open in IMG/M
3300031751|Ga0318494_10073383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1847Open in IMG/M
3300031763|Ga0318537_10275721All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300031764|Ga0318535_10242036Not Available807Open in IMG/M
3300031765|Ga0318554_10588826Not Available627Open in IMG/M
3300031768|Ga0318509_10801587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300031781|Ga0318547_10441853All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300031793|Ga0318548_10307630Not Available778Open in IMG/M
3300031793|Ga0318548_10448650All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300031795|Ga0318557_10313079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300031796|Ga0318576_10608653All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031797|Ga0318550_10662882Not Available500Open in IMG/M
3300031819|Ga0318568_10212805All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300031821|Ga0318567_10353165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300031823|Ga0307478_10395242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1144Open in IMG/M
3300031833|Ga0310917_10378107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia962Open in IMG/M
3300031835|Ga0318517_10110519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1211Open in IMG/M
3300031845|Ga0318511_10514983All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300031846|Ga0318512_10363255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia725Open in IMG/M
3300031859|Ga0318527_10189438Not Available869Open in IMG/M
3300031879|Ga0306919_10976819All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031880|Ga0318544_10448567All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031894|Ga0318522_10156265Not Available860Open in IMG/M
3300031897|Ga0318520_10960906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300031910|Ga0306923_11059570All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300031946|Ga0310910_10147334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1798Open in IMG/M
3300031947|Ga0310909_11612825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300031954|Ga0306926_12140626All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300032001|Ga0306922_10821392All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300032010|Ga0318569_10366848All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300032043|Ga0318556_10230101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia966Open in IMG/M
3300032043|Ga0318556_10607698All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300032060|Ga0318505_10407699Not Available642Open in IMG/M
3300032060|Ga0318505_10436984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium ahvazicum619Open in IMG/M
3300032066|Ga0318514_10584451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii595Open in IMG/M
3300032067|Ga0318524_10195895All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300032068|Ga0318553_10264023All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300032068|Ga0318553_10620336All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300032076|Ga0306924_11089276Not Available871Open in IMG/M
3300032089|Ga0318525_10184609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1072Open in IMG/M
3300032089|Ga0318525_10374616Not Available730Open in IMG/M
3300032160|Ga0311301_10147404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4276Open in IMG/M
3300032174|Ga0307470_10358426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300032180|Ga0307471_102982617All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300032805|Ga0335078_11227119All Organisms → cellular organisms → Bacteria → Terrabacteria group863Open in IMG/M
3300032805|Ga0335078_11728941Not Available684Open in IMG/M
3300032892|Ga0335081_10689486All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300032895|Ga0335074_10254987All Organisms → cellular organisms → Bacteria2059Open in IMG/M
3300033179|Ga0307507_10640864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Ornithinicoccus → Ornithinicoccus soli541Open in IMG/M
3300033289|Ga0310914_10230810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1659Open in IMG/M
3300033289|Ga0310914_10383379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1272Open in IMG/M
3300033289|Ga0310914_11096155All Organisms → cellular organisms → Bacteria697Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.31%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.39%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.93%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.93%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.46%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.46%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.46%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.46%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.46%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.46%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.46%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.46%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.46%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.46%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.46%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025703Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1140391713300000891SoilMTDDSDRAAWLRQARDHLRAADPVLARLIDDRPDFDPRAW
Ga0062387_10137564113300004091Bog Forest SoilVTKDAGRAAWLRQARAYLRDADPVLARLIDERPDFDPQAWMA
Ga0008092_1116197623300004629Tropical Rainforest SoilVEGAGSVTGDSTRVAWLQQGRSYLHHADTVLARLIDDRPDF
Ga0068869_10145443523300005334Miscanthus RhizosphereVVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWL
Ga0070682_10138045313300005337Corn RhizosphereMVTEDSGREAWLRHARSYLRNADPVLARLIDDRPDFDLAEA
Ga0070659_10011498633300005366Corn RhizosphereVVERTNRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWL
Ga0070714_10019914733300005435Agricultural SoilVTTDTSRTEWLRRARSYLRDADPVLARLIDARPDFDPRAWLS
Ga0070713_10168473123300005436Corn, Switchgrass And Miscanthus RhizosphereMAGHHGSVTDDADRAAGLSGARSYLRAADPVLARLIDDRPDFDP
Ga0070678_10220350113300005456Miscanthus RhizosphereVVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAW
Ga0070684_10148756213300005535Corn RhizosphereVTEDPGHDVWLRQARSHLRGADAVLARLIDDRPAPDPRAWLAPPVARLGSG*
Ga0070686_10057389613300005544Switchgrass RhizosphereMVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLAQ
Ga0070762_1059303713300005602SoilVTEDSGRAAWLRAARSYLHSADPVLARLIDERPDFDPRAW
Ga0070764_1078611113300005712SoilMATGDSSHAEWLHRARSHLRNADPVLARVIDERPAFDPQESF
Ga0066903_10077432413300005764Tropical Forest SoilVSEDSSRAAWLQQARAYLREADPVLARLIEDRPDFDPRAWMA
Ga0066903_10441096623300005764Tropical Forest SoilVTEDSSRVAWLQQARSYLRNADPVLARLIDDRPDFDPRAW
Ga0070717_1106662913300006028Corn, Switchgrass And Miscanthus RhizosphereVTEDPSRAVWLQQARSYLRNADPVLARLIDDRPAFDPR
Ga0070717_1116840123300006028Corn, Switchgrass And Miscanthus RhizosphereVTDPDPGRAAWLQQARSFLHDADPVLARLIDERPGFDPQEWMAQLP
Ga0070717_1198282733300006028Corn, Switchgrass And Miscanthus RhizosphereMTEDSDRAAWLRQARDHLRAADPVLARLIDDRPDFDPR
Ga0075432_1006199313300006058Populus RhizosphereVSEDSSSAVWLQQARSYQRDADPVLARLIDDRPTFDPRAWMA
Ga0075017_10037306413300006059WatershedsMTRDSGRAEWLRQARAYLRGADPVLARLIDDRPDFDPR
Ga0075015_10078493323300006102WatershedsMSSMTEDSSRAEWLQQARAYLSDADPVLARLIDER
Ga0070716_10089504723300006173Corn, Switchgrass And Miscanthus RhizosphereVTEDSGPAEGLEQARSYLRNADPVLARLIDDRPAFDP
Ga0070712_10162858213300006175Corn, Switchgrass And Miscanthus RhizosphereVSEDSSRAVWLQQARSYLRDADPVLARLIDDRPDFDPQAWLAQLPPMD
Ga0074059_1199950313300006578SoilVTEDSGRAMRLQQARGYLHNADPVLARLIDDRPAFDPQAWMA
Ga0074062_1251619023300006606SoilVTEDSIRAVRLQQARSYLREADPVLAGLIDDRPAFDPQAWLAQL
Ga0079222_1016662723300006755Agricultural SoilVTGGSSRDAWLRQARSYLHNADPVLARLIDERPEFDPRAWMTQL
Ga0066658_1000303693300006794SoilVEGAGSVTGDSSRVVWLRQARSYLHHADPVLARLID
Ga0079221_1087433923300006804Agricultural SoilMVTEDSGREAWLRHARSYLRNADPVLAPLIDDRPDFDLAEA
Ga0075428_10274198823300006844Populus RhizosphereVSEDSSRAVSLQQARSYLRDADPVLARLIDDRPAFDPRAWLA
Ga0075431_10220267623300006847Populus RhizosphereVTEDSSRAMWLQQARSYLRDADPVLARLIDDRPAFDPRAWMA
Ga0075425_10220492823300006854Populus RhizosphereVTEDSGPGEGLEQARSYLRNADPVLARLIDDRPAFDPRAWL
Ga0075424_10182115623300006904Populus RhizosphereVSEDSNRAVWLPGARSYLRHADAVLARLIDDRPAPDPRAWLAPPVARLGSG*
Ga0079219_1076841523300006954Agricultural SoilMTEDPDHAAWLEQARSHLRNADPVLARLIDDRPDFDPR
Ga0079219_1103272623300006954Agricultural SoilVTEDSGPAEGLEQARSYLRNADPVLARLIDDRPAFDPRAWLA
Ga0075435_10101730323300007076Populus RhizosphereVTEDADRAAGLQQARSYLRQADPVLARLIDDRPAFDPRAWMA
Ga0099795_1011722823300007788Vadose Zone SoilVTRDSSRAVWLQRERSYLRHTDPVLARLIDDRPDF
Ga0099830_1087937923300009088Vadose Zone SoilVTEDSSRAEWLQQARSYLRNADPVLARLIDDRPAFDPRAW
Ga0099828_1102391913300009089Vadose Zone SoilVTGDSGRAGWLAQARSYLRGADPVLARLIDERLDSIRGRGWLS
Ga0111538_1410381013300009156Populus RhizosphereMTELSSHAAWLQHARSALRDADPVLARLIDHRPDFDPRAWMAQ
Ga0075423_1233750013300009162Populus RhizosphereVTDDSDRAAWLRQARSYLRNADPVLARLIDDRPAFD
Ga0116214_102821053300009520Peatlands SoilVGSVSEDSSRAAWLRQARSYLRNADPVLARLIDGR
Ga0105238_1094438913300009551Corn RhizosphereVTGDGDRAERLERARARLRDADPVLASLIDKQPDFDPQ
Ga0126314_1143864113300010042Serpentine SoilVSEDSSRAVWLPRARSYLRHADPVLARLIDDRPAFDPRAW
Ga0126380_1027865623300010043Tropical Forest SoilVTEDSGRAGTLEQARSYLHGADPVLARLIDKRPDFDPRAW
Ga0126370_1060617213300010358Tropical Forest SoilVTEDASRAEWLQQARSYLRGADPVLARLIDQRPDFDPRAWL
Ga0126378_1083415123300010361Tropical Forest SoilMTDDAGRAAWLQQARSYLRGADPVLARLIDERPDFDPRA
Ga0126378_1199653513300010361Tropical Forest SoilVEGVGSVTRDSSRIVWLRQARSYLHHADPVLARLIDDRPDFDPRA
Ga0126379_1040618713300010366Tropical Forest SoilVTEDSSRAAWLQQARSYLRGADPVLARLIDDRPAFDPRAWLAQ
Ga0126379_1284965723300010366Tropical Forest SoilVTEDSSRVVWLRQARSYLRNADPVLARLVDDRPDFDP
Ga0126381_10338293713300010376Tropical Forest SoilVTEDSSHDAWLQQARSSLRNADPVLARLIDDRPDFDPRAWL
Ga0126383_1016999713300010398Tropical Forest SoilVTEDSSRAAWLQEARSYLRSADPVLARLIDDRPAFDPRAWM
Ga0126383_1167079913300010398Tropical Forest SoilMTEDSSRTKWLMQARSYLRSADPVLARLIDDRPDFDPRAWMTQ
Ga0134121_1150955823300010401Terrestrial SoilMVTEDSGREAWLRHARSYLRNADPVLARLIDDRPD
Ga0137393_1040774313300011271Vadose Zone SoilMTEDSSRAEWLQQARSYLRNADPVLARLIDDRPAFDPRAWMAQ
Ga0137389_1135354313300012096Vadose Zone SoilVSEDSSRAAWLRQARSYLHDADPVLARLIDDRPDFDPRAW
Ga0137383_1065049813300012199Vadose Zone SoilVTEDANHAAWLQQARSHLGSADPVLARLIDDRPDFDPQA
Ga0137362_1148625913300012205Vadose Zone SoilVSEDPRRAGWLPQARAYLRGADPVLARLIDARPDFDPRGVAGPAAAAGP
Ga0137378_1055054433300012210Vadose Zone SoilVTEDSSRAEWLRQARSHLRSADPVLARLIDDRPAFDPRAWMAQ
Ga0137387_1006335733300012349Vadose Zone SoilVTEDPSRAEWLQQARTYLRNADPVLARLIDDRPAFDPRAWM
Ga0137372_1002408613300012350Vadose Zone SoilVTEDSSRAAWLRQARSYLRNADPVLARLINDRPAFDPR
Ga0137367_1039447033300012353Vadose Zone SoilVTEDSSRAAWLQQARSYLRQADPVLARLIDDRPAF
Ga0137366_1111250413300012354Vadose Zone SoilVTEEAERAAWLQQARSHLRQADPVLARLIDDRPGFDPQAWMAW
Ga0137361_1108650133300012362Vadose Zone SoilVTEDSSRGEWLQQARSYLRNADPVLARLIDDRPAFDPRAWMAQ
Ga0157320_100531123300012481Arabidopsis RhizosphereMVTEDSSREVRLRQARSYLRNTDPVLARLIDDRPDFDLAE
Ga0137395_1078909913300012917Vadose Zone SoilVSEDSSRAGWLRQARSYLRRADPVLARLIDDRPDFDPRAW
Ga0164300_1080887413300012951SoilVTEDSSRAAWLAQARSYLRHADPVLARLINDQPDFDPRAW
Ga0164300_1121120923300012951SoilVTGGSSRAAGLRQARSTLRNADPVLARLIDERPEFDPRAW
Ga0126369_1189617323300012971Tropical Forest SoilVTEDSSRATWLQQARFRLRNADPVLARLIDERPDFDPRAWLSQ
Ga0164306_1069791423300012988SoilMETEDSSRAVGLQQARSYLRKADPVLARLIDDRPDFDLAEAR
Ga0164306_1109417223300012988SoilMVTEDSSREVRLRQARSYLRNADPVLARLIDDRPDFDL
Ga0157373_1034254023300013100Corn RhizosphereMETEDSGREAWLRHARSYLRKADQVLARLIDDRPDFDPRAWRDN
Ga0157372_1317987613300013307Corn RhizosphereMAEGTSPVIERTYRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLAQL
Ga0182015_1081957113300014495PalsaVSEDPKRAAGLRKIRSYLHKADPVLAALIDERPDFDPQAW
Ga0157377_1104921213300014745Miscanthus RhizosphereVTGDSSRAAWLRQARSTLRSADPVLARLIDERPDFDPRAWIAQ
Ga0173483_1012609133300015077SoilLVTEDAGRAEWLQQARSYLHNADPVLARLIDDRPAFDP
Ga0137412_1007222313300015242Vadose Zone SoilVTEDSGPAEGLEQARSYLRNTDPVLARVIDDRPAF
Ga0137409_1045785823300015245Vadose Zone SoilVTEDSGPAEGPEQARSYLRNADPVLALVPADRRATLIA
Ga0137403_1152531123300015264Vadose Zone SoilVSEDSSRAAWLRQARSYLRHADPVLARLIDDRPDFDPR
Ga0132255_10341447213300015374Arabidopsis RhizosphereMSTTADGGSRATSLQQARARLHDADPVLARPIDSQPDFDPNAWLAQL
Ga0182036_1116533513300016270SoilMTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPR
Ga0182035_1028128123300016341SoilVTGDSGRAAWLRQARSHLGDADPVLARLIGERPDFDPRAW
Ga0182032_1185463313300016357SoilMTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRAW
Ga0182034_1143489013300016371SoilMTEDSGQAGRLAEARSYLHDADPVLARLIDDRPDFDPRAWLA
Ga0182039_1177897413300016422SoilVTEDSSRAAWLQQTRSYLHDADPVLARLIDDRPDFDPRAWLTQ
Ga0187807_127156423300017926Freshwater SedimentVTEDSSRSAWLQQARSYLHHADPVLARLIDNRPDF
Ga0187806_107535723300017928Freshwater SedimentMTEDHSDAAWLRQARSHLRGADPVIARCIDARPDFDPR
Ga0187808_1005972213300017942Freshwater SedimentVSEDSSRAVWLQQARSYLRDADPVLARLIDGRPDFDP
Ga0187785_1007799133300017947Tropical PeatlandVTEDSSRVVWLQQARSYLRNADPVLARLIDDRPDFDPR
Ga0187822_1014677013300017994Freshwater SedimentVTEDSGPAQGGLEEARSYLRDADPVLARLIDDRPAFDP
Ga0187872_1005114043300018017PeatlandVSEDSSRAVWLPQARSYLRHADPVLARLIDERPDFD
Ga0184632_1037128223300018075Groundwater SedimentVSEDSSRAMWLQQARSYLRDADPVLARLIDDRPAFDPRARLAQLPPM
Ga0210407_1131386923300020579SoilVTGDSGRAVWLEQACSYLRGADPVLARLIGARPDFDPRVWL
Ga0210399_1018120943300020581SoilVIKEDSARAAWLQQARSHLREADTVLARLIDDRPDF
Ga0210399_1033391833300020581SoilVTEHPSRAAWLQQARSYLRNADPVLARLVDDRPDFDPW
Ga0210395_1058718413300020582SoilVSEDPGRAVWLPQARSYLRDGDPVLARLIDDRPDFDPRAWM
Ga0210401_1091409413300020583SoilVTEDPGRAAWLRQTRAYLRDADPVLARLIDERPDFD
Ga0210400_1083284423300021170SoilMTSADARWLQQARSHLRDADPVLARLIDDRPDFDP
Ga0210396_1099319813300021180SoilVSEDPGRAVWLPQARSYLRDGDPVLARLIDDRPDFDPRAW
Ga0210396_1124417323300021180SoilMTDDSSRGASLRQARSYLGNADPVIAKLIDERPAF
Ga0210396_1159363313300021180SoilVTDESGHAAWLEQARSYLHNADPVLAALIDDRPDFDPRA
Ga0210393_1112191113300021401SoilVSEDPGRAVWLPQARSYLRDGDPVLARLIDDRPDFDPRAWMDQ
Ga0210385_1063329533300021402SoilMATGDSSHAEWLHRARSHLRNADPVLARVIDERPAFDPQ
Ga0210389_1125225313300021404SoilVTGDSGRAVWLEQACSYLRGADPVLARLIDARPNFDPR
Ga0210387_1104246413300021405SoilVTEDSSRANWLVQARSYLRDADPVLARLIDERPDFD
Ga0210383_1139240113300021407SoilVTEDSGPAEGLEQARAYLRNADPVLARLIDNRPAFDPRAWM
Ga0210391_1031042513300021433SoilMATGDSSHAEWLHRARSHLRNADPVLARVIDERPAF
Ga0210390_1040535713300021474SoilVTEDSGPAEGLEQARAYLRNADPVLARLIDNRPAFDPRAW
Ga0210398_1032068643300021477SoilVTDDSSRAAWLQQARSHLRTADPVLARLIDERPAFD
Ga0210398_1124992313300021477SoilMDRRTEDSSRAAWLGQARSYLRAADPVLARLIDDRPDFDPRAWMS
Ga0210402_1002510913300021478SoilMETEDSSRAVGLQQARSYLRKADPVLARLIDDRPHFDPRA
Ga0210402_1032983013300021478SoilVATEASRAEWLRRARSHLRDADPVLARLIDARPDF
Ga0126371_1023572413300021560Tropical Forest SoilVSEDSSRAAWLQQARAYLREADPVLARLIEDRPDFDPR
Ga0208219_112198623300025625Arctic Peat SoilVSEDPSRAVWLQQARSYLRNADPVLARLIDDRPDFDPRTWL
Ga0208357_103383513300025703Arctic Peat SoilVTEDSSRAVGLQQARSYLRDADPVLARLIGDRPEFDPRAWIA
Ga0207692_1091541023300025898Corn, Switchgrass And Miscanthus RhizosphereVSKDSSRAEWLPQARSYLRYADPVLARLIDDRPDFDP
Ga0207685_1007515143300025905Corn, Switchgrass And Miscanthus RhizosphereMKTEDSGRQVWLRHARSHLRNADPVLAGLIDDRPDFDPQAWLDNP
Ga0207699_1126917423300025906Corn, Switchgrass And Miscanthus RhizosphereVTEDSGRAMRLQQARAYLHNADPVLAGLIDDRPAFDPQAWMA
Ga0207643_1037302033300025908Miscanthus RhizosphereVTEDSGRAMRLQQARADLHNADPVLARLIDDRPAFDPQAWMARLPP
Ga0207684_1022915613300025910Corn, Switchgrass And Miscanthus RhizosphereMVTEDSSREVWLRQARSYLRNADPVLARLIDDRPD
Ga0207693_1060765113300025915Corn, Switchgrass And Miscanthus RhizosphereVTEHPSRAAWLQQARSYLRNADPVLARLVDDRPDFDPWAWRDNAFGLPPS
Ga0207663_1051029233300025916Corn, Switchgrass And Miscanthus RhizosphereMRLQQARAYLHNADPVLARLIDDRPAFDPQAWMARLPPMDL
Ga0207646_1118444113300025922Corn, Switchgrass And Miscanthus RhizosphereVTEDSGAAGSLPQARAYLRRADPVLARLIDDRPDFDPR
Ga0207700_1047479433300025928Corn, Switchgrass And Miscanthus RhizosphereVTEDSSRAAWLAQARSYLRHADPVLERLINDQPDFDP
Ga0207700_1183001813300025928Corn, Switchgrass And Miscanthus RhizosphereMKTEDSGRQVWLRHARSHLRNADPVLAGLIDDRPDFDPQA
Ga0207669_1022606023300025937Miscanthus RhizosphereVVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLAQLP
Ga0207667_1048800033300025949Corn RhizosphereVSGDSSRAAWLRQARSTLRSADPVLARLIDERPDFDPRAWIAQ
Ga0207668_1193225413300025972Switchgrass RhizosphereVVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLA
Ga0207648_1116045523300026089Miscanthus RhizosphereVVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPD
Ga0207648_1177539323300026089Miscanthus RhizosphereVIERTYRADRLQHARSTLRDADPVLARLIDDRPDF
Ga0257153_111975413300026490SoilVTEDSSPGEGLEQARSYLRSADPVLARLIDDRPAFDPRA
Ga0209115_106793123300027567Forest SoilVTEDSSRAGWLQQARTYLSDADPVLARLIGDRPEFDPR
Ga0208565_115358023300027662Peatlands SoilVSEDPSRAVWLPQARSYLRNVDPVLARLIDDRPDFDP
Ga0209461_1000867123300027750AgaveVTEDSSRAVWLQQARSYLRQADPVLARLIDDRPGFDPRAWM
Ga0209655_1013949823300027767Bog Forest SoilVTEDSGRAAWLRQTRAYLREADPVLARLIDERPDFDPQAWMA
Ga0209167_1072307313300027867Surface SoilMTEVSSHAAWLRQARSHLRDADPVLARLIDERPDFDP
Ga0209006_1138696913300027908Forest SoilVSEDPSRAAWLRQTRSYLRNADPVLARLIDDRPDFDPQAWRAQL
Ga0209382_1157109733300027909Populus RhizosphereMGSVTDDSDRAAWLRKARSYLRNADPVLARLIDDRPAF
Ga0265357_100799123300028023RhizosphereMTSADARWLQQARAHLRDADPVLARLIDDRPDFDP
Ga0302225_1024111713300028780PalsaVTEDPDRAATLRQARAYLHDSDPVLARLIDERPGFDPQ
Ga0302221_1004249713300028806PalsaVTEDPDRAATLRQARAYLHDSDPVLARLIDERPGFDPQAWMTRL
Ga0307294_1003665613300028810SoilVVERTNRADRLQHARSTMRDADPVLARLIDDRPDFDPDAW
Ga0307302_1004601323300028814SoilMKGAGSVTEDASRAAWLQQARSYLRNADPVLARLIDDRPAFDPRAWMA
Ga0307312_1053563423300028828SoilVTEDSSRSAWLQQARSYLSNADPVLARLIEDRPDFDPRA
Ga0307308_1039316623300028884SoilVTEDADRAAWLQRARTHLHQADPVLARLIDDRPAFYP
Ga0311339_1047803213300029999PalsaVEGVSEDSGRTGWLQQARSHLRRADPVLARLIDDRPDAGPDP
Ga0268259_1007929513300030499AgaveVTEDSSRAVWLQQARSYLRNADPVLARLIDDRPAFDPRAWM
Ga0311372_1029607913300030520PalsaVSEDSSRTAALLQTRSYLRNADPVLARLIDERPDFDPQ
Ga0302311_1096667723300030739PalsaVSEDSSRAGGLRQTRSYLSQADPVLARLIDERPDFDPQAWR
Ga0308201_1022825413300031091SoilVTLDASRVAWLQQTRSHLRNADPVLARLIDDRPDFDPRA
Ga0308187_1042926913300031114SoilMKGAGSVPEDASRAAWLQQARSYLRNADPVLARLIDER
Ga0318534_1002249943300031544SoilVTADAGGAEWLERARSYLAGADPVLARLIAQQPDFDPRQPD
Ga0318538_1055274523300031546SoilMTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRAWIT
Ga0318538_1072046813300031546SoilVTEDSSHDAWLQQARSYLRKADPVLARLIDDRPDFDPRAWLTQ
Ga0318571_1015049513300031549SoilVTEDSSRVAWLQQARSHLHDADPVLARLIDDRPDFDPRAWMD
Ga0318515_1002058453300031572SoilVSKDSSRAAWLQQARSYLRQADPVLARLIDDRPEFDPRAWMTQL
Ga0318542_1047230723300031668SoilMTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRA
Ga0318574_1034909613300031680SoilVTADAGGAEWLERARSYLAGADPVLARLIAQQPDFDPRAWLAQL
Ga0318574_1087746523300031680SoilMTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRTW
Ga0310686_10455193423300031708SoilVTEDSGRAALLRQARAYLREADPVLARLIDERPDFD
Ga0310686_11945139613300031708SoilVSEDSSRAAWLRQTRSYLRSADPVLARLIDDRPDFDPQAWRARLP
Ga0307474_1065680713300031718Hardwood Forest SoilVNEDPSRAEWLPRARSYLRQADPVLARLIDDRPDFDPRAWL
Ga0318500_1058349523300031724SoilVTVDSGRAAWLQQSRSHLGDADPVLARLIDERPDFDPGRG
Ga0307468_10224342413300031740Hardwood Forest SoilVTVDASRAAWLQQARSHLRNADPMLARLIDDRPDFDPR
Ga0306918_1019761133300031744SoilMTEDPDHAAWLEQARLHLRNADPVLARLIDDRPDFDP
Ga0318502_1089983923300031747SoilVTENSDRTMWLQDARAYLRKADPVLAGLIDDRPTFD
Ga0318494_1007338313300031751SoilMTEDSSRAEWLTRARSYLKSADPVLAGLIDDRPAFDPRAW
Ga0318537_1027572123300031763SoilVTEDSSRVAWLQQARSYLRQADPVLARLIDNRPDFDPRAWIT
Ga0318535_1024203613300031764SoilMTGDSSRDAWLQQARSHLRSADPVLARLIDDRPAFDP
Ga0318554_1058882613300031765SoilVTEDSSRAAWLQQTRSYLHDADPVLARLIDDRPDFD
Ga0318509_1080158713300031768SoilVSEDPSRAVWLSQARAYLRHAEPVLARLIDGRPGFDPR
Ga0318547_1044185323300031781SoilVTEDSSRAAWLAQARSYLRQADSVLARLIDDRPDFDPRAWMT
Ga0318548_1030763023300031793SoilVTADAGGAEWLERARSYLAGADPVLARLIAQQPDFDPRQ
Ga0318548_1044865013300031793SoilMTEDPDHAAWLEQARSHLRNADPVLARLIDDRPDFD
Ga0318557_1031307913300031795SoilVTEDPSRTAWLQQARSHLRNADPVLARLIEDRPAFDPRAWLA
Ga0318576_1060865323300031796SoilMTDDSSRADWLRQARSYLRGADPVLARLIDDRPDFDPRAW
Ga0318550_1066288213300031797SoilVTEDSSHDAWLQEARSSLRNADPVLARLIDDRPDFD
Ga0318568_1021280513300031819SoilVTEDSSRAAWLAQARSYLRQADSVLARLIDDRPDF
Ga0318567_1035316543300031821SoilVSKDSSRAAWLAQARSYLRQADPVLARLIDDRPDFDPRAWMT
Ga0307478_1039524233300031823Hardwood Forest SoilVTEHSKRVAWLRRARSYLRNADPVLARLIDERPDFDFAQARLDN
Ga0310917_1037810713300031833SoilMTDDSSRADWLRQARSYLRGADPVLARLIDDRPDF
Ga0318517_1011051913300031835SoilMTEDSSRAEWLTRARSYLKSADPVLAGLIDDRPAFDPRA
Ga0318511_1051498313300031845SoilMTEDSSRVVWLQQARSHLRNADPVLARLIDDRPAFD
Ga0318512_1036325513300031846SoilVTSDPGHAEWLQHARSHLRDADPVLARLIDDRPDFDPRGVA
Ga0318527_1018943823300031859SoilVTVDSGRAAWLQQARSHLRNADPVLARLIDERPDFDPGRG
Ga0306919_1097681913300031879SoilVVAVTEDSDRAVWLRQARSYLSTADPVLARLIGDRP
Ga0318544_1044856723300031880SoilMTGDSSRDAWLQQARSHLRSADPVLARLIDDRPAFDPRAW
Ga0318522_1015626523300031894SoilVTADAGGAEWLERARSYLAGADPVLARLIAQQPDFD
Ga0318520_1096090623300031897SoilVTEDSSRDGWLREARSYLRSADPVLARLIDERPDFDPRAW
Ga0306923_1105957023300031910SoilVSKDSSRAAWLQQARSYLRQADPVLARLIDDRPEFDPRAW
Ga0310910_1014733443300031946SoilVTSDPGHAEWLQHARSHLRDADPVLARLIDDRPDFDPRGVAS
Ga0310909_1161282523300031947SoilMTQDSSRAEWLRQARSHLRGADPVLARLIDDQPEFDPREWMSQLPP
Ga0306926_1214062613300031954SoilMTEDPDHAAWLEQARSHLRHADPVLARLIDDRPDFDP
Ga0306922_1082139223300032001SoilVNEDPSRAVWLSQARAYLRDADPVLARLIDGRPDFDPRAW
Ga0318569_1036684813300032010SoilVVAVTEDSGRAVWLRQARSYLSTADPVLARLIHDRPDFNPRA
Ga0318556_1023010113300032043SoilVTEDPSHDAWLQQARSYLRNADPVLARLIDARPDFDPRARLTQ
Ga0318556_1060769813300032043SoilVSKDSSRAAWLQQARSYLRQADPVLARLIDDRPDFDPR
Ga0318505_1040769913300032060SoilMTDDSSRADWLRQARSYLRGADPVLARLIDDRPDFD
Ga0318505_1043698413300032060SoilMTEDPDHAAWLEQARSHLRRADPVLARLINDRPDFDPMAWLAQLP
Ga0318514_1058445113300032066SoilVTQDPGRAGWLQRARSRLRAADPVLARLVDDRPDFDPRA
Ga0318524_1019589523300032067SoilVVAVTEDSDRAVWLRQARSYLSTADPVLARLIHDRPDFDPRAWMSLA
Ga0318553_1026402323300032068SoilVTEDSEHAAWLEQARSHLRDADPVLGRLIAERPDFD
Ga0318553_1062033613300032068SoilVTVDSGRAAWLQQSRSHLGDADPVLARLIDERPDFDPRAWI
Ga0306924_1108927613300032076SoilVTVDSGRAAWLQQSRSHLGDADPVLARLIDERPDFDPR
Ga0318525_1018460923300032089SoilVTGDSGHAAWLQQARSYLRDADPVVARLIDERPGFDPRAW
Ga0318525_1037461623300032089SoilVTEDSSHNAWLQQARSSLRNADPVLARLIDDRPDFDPR
Ga0311301_1014740413300032160Peatlands SoilVSEDSSRAAWLRQARSYLRNADPVLARLIDGRPDFD
Ga0307470_1035842613300032174Hardwood Forest SoilVTEDPGHDVWLRQARSHLRGADAVLARLIDDRPDF
Ga0307471_10298261713300032180Hardwood Forest SoilMVTEDSSREVWLRQARSYLRNADPVLARLIDDRPDFDLAEARL
Ga0335078_1122711923300032805SoilVSEDPSRAVWLPQARAYLRQADPVLARLIDDRPEFDPQ
Ga0335078_1172894123300032805SoilVTGDSSRTVWLQQARSCLRQADPVLARLIGERPGFDPRAWMIQPP
Ga0335081_1068948633300032892SoilMTDLVSTGDRAAWTRSAVRHLRAADPVLARLIDERPDFDPR
Ga0335074_1025498733300032895SoilVSVDSDRAARLSHTRSYLRAADPVMARLIDQRPDFDPQ
Ga0307507_1064086413300033179EctomycorrhizaVSEDSSRADWLLRARSRLRRADPVLARLIDDRPDFDPRA
Ga0310914_1023081033300033289SoilMTDDSSRADWLRQARSYLRGADPVLARLIDDRPDFDP
Ga0310914_1038337913300033289SoilVTGDSGHAAWLQQARSYLRDADPVVARLIDERPDFDPR
Ga0310914_1109615523300033289SoilVVAVSEDSDRVAWLQQARAYLRHADPVLARLIDDRPDFD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.