| Basic Information | |
|---|---|
| Family ID | F022040 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 216 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSADTDSTRPAAADAAAAPLDLLLTDAATGMLRRVNPGGSGLRLA |
| Number of Associated Samples | 174 |
| Number of Associated Scaffolds | 216 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.37 % |
| % of genes near scaffold ends (potentially truncated) | 96.76 % |
| % of genes from short scaffolds (< 2000 bps) | 86.11 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.685 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.148 % of family members) |
| Environment Ontology (ENVO) | Unclassified (15.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.074 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.84% β-sheet: 0.00% Coil/Unstructured: 56.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 216 Family Scaffolds |
|---|---|---|
| PF13564 | DoxX_2 | 6.48 |
| PF02525 | Flavodoxin_2 | 4.17 |
| PF13556 | HTH_30 | 4.17 |
| PF06772 | LtrA | 3.70 |
| PF00126 | HTH_1 | 3.70 |
| PF12802 | MarR_2 | 2.78 |
| PF00248 | Aldo_ket_red | 2.31 |
| PF02737 | 3HCDH_N | 1.85 |
| PF04972 | BON | 1.85 |
| PF01381 | HTH_3 | 1.39 |
| PF13193 | AMP-binding_C | 1.39 |
| PF02310 | B12-binding | 0.93 |
| PF01047 | MarR | 0.93 |
| PF02678 | Pirin | 0.93 |
| PF13466 | STAS_2 | 0.93 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF06210 | DUF1003 | 0.93 |
| PF00005 | ABC_tran | 0.46 |
| PF00672 | HAMP | 0.46 |
| PF13460 | NAD_binding_10 | 0.46 |
| PF13560 | HTH_31 | 0.46 |
| PF03706 | LPG_synthase_TM | 0.46 |
| PF00484 | Pro_CA | 0.46 |
| PF06253 | MTTB | 0.46 |
| PF06197 | DUF998 | 0.46 |
| PF08241 | Methyltransf_11 | 0.46 |
| PF07883 | Cupin_2 | 0.46 |
| PF13340 | DUF4096 | 0.46 |
| PF00857 | Isochorismatase | 0.46 |
| PF01544 | CorA | 0.46 |
| PF13577 | SnoaL_4 | 0.46 |
| PF07366 | SnoaL | 0.46 |
| PF13185 | GAF_2 | 0.46 |
| PF01814 | Hemerythrin | 0.46 |
| PF00561 | Abhydrolase_1 | 0.46 |
| PF00440 | TetR_N | 0.46 |
| PF13191 | AAA_16 | 0.46 |
| PF05368 | NmrA | 0.46 |
| PF05378 | Hydant_A_N | 0.46 |
| PF01329 | Pterin_4a | 0.46 |
| PF13796 | Sensor | 0.46 |
| PF13462 | Thioredoxin_4 | 0.46 |
| PF07859 | Abhydrolase_3 | 0.46 |
| PF12323 | HTH_OrfB_IS605 | 0.46 |
| PF00903 | Glyoxalase | 0.46 |
| PF04978 | DUF664 | 0.46 |
| PF13602 | ADH_zinc_N_2 | 0.46 |
| PF06983 | 3-dmu-9_3-mt | 0.46 |
| PF01738 | DLH | 0.46 |
| PF00486 | Trans_reg_C | 0.46 |
| PF13302 | Acetyltransf_3 | 0.46 |
| PF01494 | FAD_binding_3 | 0.46 |
| PF00471 | Ribosomal_L33 | 0.46 |
| PF02129 | Peptidase_S15 | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
|---|---|---|---|
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 3.70 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.85 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 1.85 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 1.85 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.85 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.85 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.93 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 0.93 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.93 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.46 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.46 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.46 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.46 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.46 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.46 |
| COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.46 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.46 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.46 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.46 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.46 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.46 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.69 % |
| Unclassified | root | N/A | 27.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_108033579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 545 | Open in IMG/M |
| 3300001356|JGI12269J14319_10053837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2363 | Open in IMG/M |
| 3300001356|JGI12269J14319_10289681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300001384|JGI20190J14840_1004146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1640 | Open in IMG/M |
| 3300001593|JGI12635J15846_10244667 | Not Available | 1155 | Open in IMG/M |
| 3300001867|JGI12627J18819_10250672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 712 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100502486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1090 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100556749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
| 3300004092|Ga0062389_103657036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus obscurus | 577 | Open in IMG/M |
| 3300004092|Ga0062389_104688913 | Not Available | 515 | Open in IMG/M |
| 3300004479|Ga0062595_102530747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 513 | Open in IMG/M |
| 3300005179|Ga0066684_10780789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300005335|Ga0070666_11470290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus siccatus | 509 | Open in IMG/M |
| 3300005434|Ga0070709_10054308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2525 | Open in IMG/M |
| 3300005435|Ga0070714_100947531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 837 | Open in IMG/M |
| 3300005439|Ga0070711_100270485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1341 | Open in IMG/M |
| 3300005439|Ga0070711_101353664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300005468|Ga0070707_101400170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Rothia → Rothia dentocariosa | 666 | Open in IMG/M |
| 3300005541|Ga0070733_10632818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300005610|Ga0070763_10499538 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005921|Ga0070766_10632021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300005921|Ga0070766_10746240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
| 3300006028|Ga0070717_10026028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4663 | Open in IMG/M |
| 3300006028|Ga0070717_11671071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300006174|Ga0075014_100331706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300006176|Ga0070765_100774306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 907 | Open in IMG/M |
| 3300006176|Ga0070765_102174608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300006176|Ga0070765_102209185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300006804|Ga0079221_10247876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1010 | Open in IMG/M |
| 3300006804|Ga0079221_10382661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 864 | Open in IMG/M |
| 3300006904|Ga0075424_100212938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2053 | Open in IMG/M |
| 3300009038|Ga0099829_10485488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1025 | Open in IMG/M |
| 3300009101|Ga0105247_11383469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300009520|Ga0116214_1040301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1688 | Open in IMG/M |
| 3300009521|Ga0116222_1260704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
| 3300009522|Ga0116218_1527018 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009524|Ga0116225_1251629 | Not Available | 793 | Open in IMG/M |
| 3300009698|Ga0116216_10855120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia | 545 | Open in IMG/M |
| 3300009700|Ga0116217_10079052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2288 | Open in IMG/M |
| 3300009762|Ga0116130_1239918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 576 | Open in IMG/M |
| 3300009824|Ga0116219_10766522 | Not Available | 526 | Open in IMG/M |
| 3300009839|Ga0116223_10212417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1178 | Open in IMG/M |
| 3300010048|Ga0126373_11197130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300010343|Ga0074044_10668382 | Not Available | 678 | Open in IMG/M |
| 3300010373|Ga0134128_10942166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
| 3300010379|Ga0136449_100425640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2342 | Open in IMG/M |
| 3300010379|Ga0136449_101269413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1152 | Open in IMG/M |
| 3300010379|Ga0136449_101301220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
| 3300010379|Ga0136449_101562862 | Not Available | 1005 | Open in IMG/M |
| 3300010861|Ga0126349_1136279 | Not Available | 520 | Open in IMG/M |
| 3300010880|Ga0126350_10932091 | Not Available | 665 | Open in IMG/M |
| 3300010880|Ga0126350_10934621 | Not Available | 1371 | Open in IMG/M |
| 3300010880|Ga0126350_11277788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 816 | Open in IMG/M |
| 3300011269|Ga0137392_10248063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1465 | Open in IMG/M |
| 3300011270|Ga0137391_11231550 | Not Available | 596 | Open in IMG/M |
| 3300011271|Ga0137393_10007145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7462 | Open in IMG/M |
| 3300012189|Ga0137388_11526569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300012211|Ga0137377_10031709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4796 | Open in IMG/M |
| 3300012211|Ga0137377_10682998 | Not Available | 962 | Open in IMG/M |
| 3300012353|Ga0137367_10121533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1916 | Open in IMG/M |
| 3300012356|Ga0137371_10070720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2702 | Open in IMG/M |
| 3300012356|Ga0137371_11428640 | Not Available | 506 | Open in IMG/M |
| 3300012363|Ga0137390_10119372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2611 | Open in IMG/M |
| 3300012917|Ga0137395_10368227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1025 | Open in IMG/M |
| 3300013104|Ga0157370_11534860 | Not Available | 599 | Open in IMG/M |
| 3300014492|Ga0182013_10179499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Smaragdicoccus → Smaragdicoccus niigatensis | 1298 | Open in IMG/M |
| 3300014495|Ga0182015_10037212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3681 | Open in IMG/M |
| 3300014501|Ga0182024_10134712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3503 | Open in IMG/M |
| 3300014654|Ga0181525_10741695 | Not Available | 552 | Open in IMG/M |
| 3300015264|Ga0137403_11465765 | Not Available | 532 | Open in IMG/M |
| 3300015374|Ga0132255_105725094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300016294|Ga0182041_10169508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. GESEQ-35 | 1707 | Open in IMG/M |
| 3300016319|Ga0182033_11984739 | Not Available | 530 | Open in IMG/M |
| 3300017821|Ga0187812_1049246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1423 | Open in IMG/M |
| 3300017823|Ga0187818_10139006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter melonis | 1056 | Open in IMG/M |
| 3300017937|Ga0187809_10200644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300017937|Ga0187809_10257789 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300017942|Ga0187808_10005871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 4648 | Open in IMG/M |
| 3300017942|Ga0187808_10344749 | Not Available | 675 | Open in IMG/M |
| 3300017946|Ga0187879_10007151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 7325 | Open in IMG/M |
| 3300017946|Ga0187879_10052072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2410 | Open in IMG/M |
| 3300017946|Ga0187879_10691632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300017970|Ga0187783_10474623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
| 3300017975|Ga0187782_10669908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 799 | Open in IMG/M |
| 3300017994|Ga0187822_10282888 | Not Available | 580 | Open in IMG/M |
| 3300018009|Ga0187884_10132996 | Not Available | 1059 | Open in IMG/M |
| 3300018044|Ga0187890_10017470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4449 | Open in IMG/M |
| 3300018047|Ga0187859_10551859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter marinus | 645 | Open in IMG/M |
| 3300018057|Ga0187858_10347669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
| 3300018062|Ga0187784_11222155 | Not Available | 596 | Open in IMG/M |
| 3300019888|Ga0193751_1206849 | Not Available | 651 | Open in IMG/M |
| 3300020583|Ga0210401_10847240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Rothia → Rothia dentocariosa | 773 | Open in IMG/M |
| 3300021170|Ga0210400_10965099 | Not Available | 694 | Open in IMG/M |
| 3300021377|Ga0213874_10229657 | Not Available | 677 | Open in IMG/M |
| 3300021401|Ga0210393_10127836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 2035 | Open in IMG/M |
| 3300021402|Ga0210385_10121196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1846 | Open in IMG/M |
| 3300021402|Ga0210385_11342212 | Not Available | 547 | Open in IMG/M |
| 3300021402|Ga0210385_11456576 | Not Available | 523 | Open in IMG/M |
| 3300021403|Ga0210397_10169926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1538 | Open in IMG/M |
| 3300021403|Ga0210397_11357675 | Not Available | 552 | Open in IMG/M |
| 3300021404|Ga0210389_10316503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1224 | Open in IMG/M |
| 3300021405|Ga0210387_10391533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1231 | Open in IMG/M |
| 3300021405|Ga0210387_11623926 | Not Available | 549 | Open in IMG/M |
| 3300021406|Ga0210386_10311259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1351 | Open in IMG/M |
| 3300021407|Ga0210383_10207800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1675 | Open in IMG/M |
| 3300021407|Ga0210383_10572478 | Not Available | 974 | Open in IMG/M |
| 3300021407|Ga0210383_11319976 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021477|Ga0210398_10518406 | Not Available | 970 | Open in IMG/M |
| 3300021478|Ga0210402_10236292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1685 | Open in IMG/M |
| 3300021479|Ga0210410_10189298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1842 | Open in IMG/M |
| 3300022720|Ga0242672_1034192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 786 | Open in IMG/M |
| 3300024288|Ga0179589_10159831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
| 3300025574|Ga0208717_1000196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 24836 | Open in IMG/M |
| 3300025625|Ga0208219_1134618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia | 545 | Open in IMG/M |
| 3300025915|Ga0207693_10089223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2416 | Open in IMG/M |
| 3300025916|Ga0207663_10199339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1443 | Open in IMG/M |
| 3300025916|Ga0207663_10444000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300025929|Ga0207664_11523434 | Not Available | 590 | Open in IMG/M |
| 3300027096|Ga0208099_1047846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter marinus | 612 | Open in IMG/M |
| 3300027497|Ga0208199_1120711 | Not Available | 536 | Open in IMG/M |
| 3300027568|Ga0208042_1101688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
| 3300027676|Ga0209333_1177648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 567 | Open in IMG/M |
| 3300027824|Ga0209040_10258055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
| 3300027846|Ga0209180_10252328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1015 | Open in IMG/M |
| 3300027853|Ga0209274_10444342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter marinus | 671 | Open in IMG/M |
| 3300027854|Ga0209517_10731126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 506 | Open in IMG/M |
| 3300027855|Ga0209693_10394682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300027882|Ga0209590_10315733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1005 | Open in IMG/M |
| 3300027889|Ga0209380_10572179 | Not Available | 656 | Open in IMG/M |
| 3300027905|Ga0209415_10045011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5846 | Open in IMG/M |
| 3300027905|Ga0209415_11139951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300027908|Ga0209006_10104657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2507 | Open in IMG/M |
| 3300027908|Ga0209006_10574359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 933 | Open in IMG/M |
| 3300027908|Ga0209006_10607817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 903 | Open in IMG/M |
| 3300027908|Ga0209006_11277491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300028047|Ga0209526_10618220 | Not Available | 692 | Open in IMG/M |
| 3300028742|Ga0302220_10001551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 17876 | Open in IMG/M |
| 3300028759|Ga0302224_10195064 | Not Available | 801 | Open in IMG/M |
| 3300028780|Ga0302225_10596153 | Not Available | 512 | Open in IMG/M |
| 3300028789|Ga0302232_10349477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 728 | Open in IMG/M |
| 3300028795|Ga0302227_10426992 | Not Available | 503 | Open in IMG/M |
| 3300028806|Ga0302221_10043747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2077 | Open in IMG/M |
| 3300028808|Ga0302228_10372269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300028877|Ga0302235_10162570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 993 | Open in IMG/M |
| 3300028884|Ga0307308_10662468 | Not Available | 500 | Open in IMG/M |
| 3300028906|Ga0308309_10577200 | Not Available | 975 | Open in IMG/M |
| 3300029914|Ga0311359_10312394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Smaragdicoccus → Smaragdicoccus niigatensis | 1291 | Open in IMG/M |
| 3300029917|Ga0311326_10138403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Smaragdicoccus → Smaragdicoccus niigatensis | 1318 | Open in IMG/M |
| 3300029939|Ga0311328_10233821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Smaragdicoccus → Smaragdicoccus niigatensis | 1398 | Open in IMG/M |
| 3300029943|Ga0311340_10324571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1452 | Open in IMG/M |
| 3300030056|Ga0302181_10289434 | Not Available | 730 | Open in IMG/M |
| 3300030057|Ga0302176_10024084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2302 | Open in IMG/M |
| 3300030058|Ga0302179_10001631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13479 | Open in IMG/M |
| 3300030494|Ga0310037_10153204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1044 | Open in IMG/M |
| 3300030509|Ga0302183_10037348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1955 | Open in IMG/M |
| 3300030524|Ga0311357_10354534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1394 | Open in IMG/M |
| 3300030524|Ga0311357_11767692 | Not Available | 515 | Open in IMG/M |
| 3300030618|Ga0311354_10391052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
| 3300030688|Ga0311345_10582506 | Not Available | 934 | Open in IMG/M |
| 3300031057|Ga0170834_107152521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Rothia → Rothia dentocariosa | 505 | Open in IMG/M |
| 3300031170|Ga0307498_10179655 | Not Available | 724 | Open in IMG/M |
| 3300031234|Ga0302325_10664673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1512 | Open in IMG/M |
| 3300031240|Ga0265320_10040723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 2314 | Open in IMG/M |
| 3300031249|Ga0265339_10363144 | Not Available | 681 | Open in IMG/M |
| 3300031261|Ga0302140_10218529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1702 | Open in IMG/M |
| 3300031564|Ga0318573_10298291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
| 3300031572|Ga0318515_10611656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300031572|Ga0318515_10783369 | Not Available | 503 | Open in IMG/M |
| 3300031640|Ga0318555_10819082 | Not Available | 503 | Open in IMG/M |
| 3300031679|Ga0318561_10526634 | Not Available | 651 | Open in IMG/M |
| 3300031680|Ga0318574_10604450 | Not Available | 643 | Open in IMG/M |
| 3300031708|Ga0310686_107517383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4954 | Open in IMG/M |
| 3300031708|Ga0310686_107913602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1688 | Open in IMG/M |
| 3300031708|Ga0310686_111907256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300031724|Ga0318500_10169669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1034 | Open in IMG/M |
| 3300031736|Ga0318501_10815687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 517 | Open in IMG/M |
| 3300031751|Ga0318494_10249656 | Not Available | 1017 | Open in IMG/M |
| 3300031764|Ga0318535_10490993 | Not Available | 546 | Open in IMG/M |
| 3300031768|Ga0318509_10467773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300031769|Ga0318526_10264661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300031769|Ga0318526_10463217 | Not Available | 518 | Open in IMG/M |
| 3300031779|Ga0318566_10271651 | Not Available | 840 | Open in IMG/M |
| 3300031781|Ga0318547_10200001 | Not Available | 1193 | Open in IMG/M |
| 3300031792|Ga0318529_10194603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 940 | Open in IMG/M |
| 3300031792|Ga0318529_10435218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 610 | Open in IMG/M |
| 3300031793|Ga0318548_10299752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
| 3300031805|Ga0318497_10188062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1139 | Open in IMG/M |
| 3300031819|Ga0318568_10009650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4947 | Open in IMG/M |
| 3300031821|Ga0318567_10727810 | Not Available | 562 | Open in IMG/M |
| 3300031823|Ga0307478_11686016 | Not Available | 522 | Open in IMG/M |
| 3300031846|Ga0318512_10011604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3426 | Open in IMG/M |
| 3300031962|Ga0307479_11490582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300032008|Ga0318562_10859851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 518 | Open in IMG/M |
| 3300032010|Ga0318569_10129665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1152 | Open in IMG/M |
| 3300032039|Ga0318559_10425341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300032041|Ga0318549_10236152 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300032043|Ga0318556_10351719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300032043|Ga0318556_10694173 | Not Available | 530 | Open in IMG/M |
| 3300032055|Ga0318575_10366258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300032063|Ga0318504_10312918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300032089|Ga0318525_10008857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4467 | Open in IMG/M |
| 3300032160|Ga0311301_12050099 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032805|Ga0335078_11674388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300032828|Ga0335080_11074687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia | 815 | Open in IMG/M |
| 3300032828|Ga0335080_11730017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus | 612 | Open in IMG/M |
| 3300032893|Ga0335069_12256499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300032893|Ga0335069_12484900 | Not Available | 536 | Open in IMG/M |
| 3300032895|Ga0335074_10825044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 859 | Open in IMG/M |
| 3300032896|Ga0335075_11521649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300032897|Ga0335071_11764688 | Not Available | 563 | Open in IMG/M |
| 3300032898|Ga0335072_10587743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1124 | Open in IMG/M |
| 3300032898|Ga0335072_10684605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1008 | Open in IMG/M |
| 3300032898|Ga0335072_11185000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300033158|Ga0335077_10737380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia | 1010 | Open in IMG/M |
| 3300033545|Ga0316214_1018095 | Not Available | 980 | Open in IMG/M |
| 3300034163|Ga0370515_0435044 | Not Available | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.15% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.31% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.39% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.46% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.46% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.46% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.46% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.46% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.46% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.46% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001384 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1080335791 | 3300000956 | Soil | MTSETTEPAAAAPLDLLLTDAALGVLHRVVPDGSGLRLAAAL |
| JGI12269J14319_100538371 | 3300001356 | Peatlands Soil | MSTETIESAAADAVAAPLDLLLTDAALGVLNRVNPGGS |
| JGI12269J14319_102896811 | 3300001356 | Peatlands Soil | MSADTDTIRSAAADAAAGPLDLLLTDAAVGMLRRMNPGGS |
| JGI20190J14840_10041461 | 3300001384 | Arctic Peat Soil | MSQDSETIRSAAADAVAAPLDLLLTDAAIGSLRRVNPGGSGLRLAAA |
| JGI12635J15846_102446671 | 3300001593 | Forest Soil | MSADTDSTRSAASDAAAAPLDLLLGDAATGMLRRMNP |
| JGI12627J18819_102506722 | 3300001867 | Forest Soil | MSTDTDPNGFAAAEAAAAPLDLLLTDAATGMLRRVNPGG |
| JGIcombinedJ26739_1005024861 | 3300002245 | Forest Soil | MSANTDSDRSADSDSSAAEDAAAVPLDLLLGDAATGMLRRLNLGGSGLRLAAAL |
| JGIcombinedJ26739_1005567491 | 3300002245 | Forest Soil | MSQDSETNSSAAAEAAAEAVAAPLDLLLTDAAIGSLR |
| Ga0062389_1036570361 | 3300004092 | Bog Forest Soil | MSADTDSTRSAADDAAAAPLDLLLGDAATGMLRRMNPGGSGLRLAASL |
| Ga0062389_1046889131 | 3300004092 | Bog Forest Soil | MSTDSDMTGTAAEAAAAPLDLLLTDAVFGALRRVNPGGSGVRL |
| Ga0062595_1025307472 | 3300004479 | Soil | MTSETTEPAEADAAAAPLDLLLTDAALGVLHRVVPDGSGLRL |
| Ga0066684_107807891 | 3300005179 | Soil | MSAETIEPAAADAAVAPLDLLLTDAALGALNRVNPGGSGLRLAAALAAR |
| Ga0070666_114702901 | 3300005335 | Switchgrass Rhizosphere | MVISTGPDPTRSAAADAAAAPLDLLLTDGVTGMLRRVNPGGSGLR |
| Ga0070709_100543083 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPDSETIRSAAADAAVAPLDLLLTDAAMGALRRMNPGGSGLRLAVALAGR |
| Ga0070714_1009475311 | 3300005435 | Agricultural Soil | MSPDSETIRSAAADAAVAPLDLLLTDAAMGALRRMNPGGSGLRLAVALAG |
| Ga0070711_1002704851 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTDDDTTRSAAAEAAAAPLDLLLSDAATGMLRRINPGGAGLRLAA |
| Ga0070711_1013536642 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDDTEPAGSAADAAAAPLDLLLADAATGMLRRINPGGAGL |
| Ga0070707_1014001702 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPDSDTIGSAAADAASAPLDLLLTDAAIGVLRRVNPGGSGLRL |
| Ga0070733_106328182 | 3300005541 | Surface Soil | MSADTDPTRTADAAAAPLDLLLADAATGMLRRVNPGGSGLRL |
| Ga0070763_104995381 | 3300005610 | Soil | MSADSDTIRSAADDVAAAPLDLLLGDAATGMLRRFNPGGSGLRLAAA |
| Ga0070766_106320211 | 3300005921 | Soil | MNSDDNDTFRSAAADAATAPLDLLLTDAAISALRRVNPGGSGLR |
| Ga0070766_107462401 | 3300005921 | Soil | MNPDSDTIRSAAAEAVSAPMDLLLTDAAIGMLRRVNPGGSGL |
| Ga0070717_100260288 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTHTDSLAAAAADAVTAPLDLLLTDAALGALRRMNPGGSGLRLAGALAVRPSLVAR |
| Ga0070717_116710712 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDDTDPSRSAADAAAAPLDFLLADAATGMMRRINPGGSGLRLAAALAVRPRLV |
| Ga0075014_1003317061 | 3300006174 | Watersheds | MSTDTDTTGAAAEAAAAPLDLLLTDAVFGALRRVNPGGSG |
| Ga0070765_1007743062 | 3300006176 | Soil | MRSAADEAAAAPLDLLLTDAATGMLRRMNPGGSGL |
| Ga0070765_1021746081 | 3300006176 | Soil | MSADTDSIRTAAADAAAAPLDLLLADAATGMLRRVNPGGSG |
| Ga0070765_1022091852 | 3300006176 | Soil | MGPESDTLRSEAADAITAPLDLLLTDAAIGMLRRVNP |
| Ga0079221_102478761 | 3300006804 | Agricultural Soil | MTADTDTTRSAGADAAAAPLDLLLTDAATGMLRRMNPGGSGLRLAA |
| Ga0079221_103826611 | 3300006804 | Agricultural Soil | MSTDSDTNRSDPADAAAAPLDLLLTDAAVGVLRRM |
| Ga0075424_1002129384 | 3300006904 | Populus Rhizosphere | MSADTDPTRPAAANAAAAPLDLLLTDAATGMPRRVNPGGSSL |
| Ga0099829_104854882 | 3300009038 | Vadose Zone Soil | MNPDSDTTRSAAADAAAAPLDLLLTDAAIGVLRRVNPGGSGLRLA |
| Ga0105247_113834691 | 3300009101 | Switchgrass Rhizosphere | MSAETIESAAADADAAPLDLLLTDAALGILNRVNPGGSGLRLTAALAARPRLVA |
| Ga0116214_10403011 | 3300009520 | Peatlands Soil | MSTDSDPIGASAADAAAAPLDLLLTDAVFGALRRVNPGGSGVRLAAALAT |
| Ga0116222_12607041 | 3300009521 | Peatlands Soil | MLGWRKEIMSADTDTIRSAAADAAAGPLDLLLTDAAVGMLRRMNPGG |
| Ga0116218_15270181 | 3300009522 | Peatlands Soil | MSTETDPIGSAAADAAAAPLDLLLTDAVFGALRRVNPGGSGVRLAAALATRP |
| Ga0116225_12516292 | 3300009524 | Peatlands Soil | MSTDSDPIGASAADAAAAPLDLLLTDAVFGALRRV |
| Ga0116216_108551202 | 3300009698 | Peatlands Soil | MSTETMESAAADAAAAPLDLLLTDAALGVLNRVNPGG |
| Ga0116217_100790525 | 3300009700 | Peatlands Soil | MSADTDSTRPAAADAAAAPLDLLLTDAATGMLRRV |
| Ga0116130_12399182 | 3300009762 | Peatland | MSPDSQTIRSAAADAVAAPLDLLLTDAAIGALRRVNPGGSGL |
| Ga0116219_107665222 | 3300009824 | Peatlands Soil | MSANTDSIRSAADDAAAAPLDLLLTDAATGMLRRVN |
| Ga0116223_102124171 | 3300009839 | Peatlands Soil | MSTDSDPIGASAADAAAAPLDLLLTDAVFGALRRVNPGGSGVRLAAALATRP |
| Ga0126373_111971302 | 3300010048 | Tropical Forest Soil | MSTDTDPTKPAAADSAVADSAAAPLDMLLGDAATGMLRRV |
| Ga0074044_106683822 | 3300010343 | Bog Forest Soil | MTMSTDTDPIGSSAADAAAAAPLDLLLTDAVFGALRRVNPGGSGVRLAAALATRP |
| Ga0134128_109421663 | 3300010373 | Terrestrial Soil | MSDDTEPARSAADAAAAPLDLLLSDAATGMLRRLNPGGAGLRLAAALAVRPRL |
| Ga0136449_1004256401 | 3300010379 | Peatlands Soil | MSADTDSTRPAAADAAAAPLDLLLTDAATGMLRRVNPGGSGLRLAAALA |
| Ga0136449_1012694133 | 3300010379 | Peatlands Soil | MSAETIESAAVDAVAAPLDLLLTDAALGVLNRVNPGGSGLRL |
| Ga0136449_1013012201 | 3300010379 | Peatlands Soil | MSTDSDPIGASAADAAAAPLDLLLTDAVFGALRRVNPGGSGVRLAAA |
| Ga0136449_1015628621 | 3300010379 | Peatlands Soil | MSADTDSTGPAAADAAAAPLDLLLTDAATGMLRRVNPGGSGLRLAAALA |
| Ga0126349_11362791 | 3300010861 | Boreal Forest Soil | MSTHTDSLAAAAADAVTAPLDLLLTDAALGAFRRMNPGGSGLRLAGALA |
| Ga0126350_109320912 | 3300010880 | Boreal Forest Soil | MSADDDTTRSAAAEAAAAPLDLLLSDAATGMLRRINPGGSGLRLAAALTAKPR |
| Ga0126350_109346213 | 3300010880 | Boreal Forest Soil | MSADTDSTRSAADDAAAAPLDLLLGDAATGVLRRMNPGGSGLRLAAALAAKPR |
| Ga0126350_112777881 | 3300010880 | Boreal Forest Soil | MMSADSDTIRTAAADATAAPLDLLLTDAATGMLRRVNPGGSGLR |
| Ga0137392_102480632 | 3300011269 | Vadose Zone Soil | MSADTDATRPAAADAAAAPLDLLLADADTAMLRRVTRDAS* |
| Ga0137391_112315502 | 3300011270 | Vadose Zone Soil | MESTAADAVAAPLDLLLTDAVLGSLHRVNPGESGLRLAAALTTRP |
| Ga0137393_100071456 | 3300011271 | Vadose Zone Soil | MSADTTAIESTAADAVAAPLDLLLTDAVLGSLHRVNPGGSGLRLAAALT |
| Ga0137388_115265691 | 3300012189 | Vadose Zone Soil | MSTDTDTIGSAAADAVSASLDLLLTDAAFGALRRVNPGGFGLRLAAV |
| Ga0137377_100317096 | 3300012211 | Vadose Zone Soil | MSADTDATRPAAADAAAAPLDVLFTGADTAMLRRV |
| Ga0137377_106829982 | 3300012211 | Vadose Zone Soil | MSADTDPTRSAAADAAAAPLDLLLTDAATGMLRRVNPGGSGLRLAAALAA |
| Ga0137367_101215331 | 3300012353 | Vadose Zone Soil | MSADTDPTRSAADAAAAPLDLLLADAATGMMRRINPGGSGLRLAAALTARPRLV |
| Ga0137371_100707201 | 3300012356 | Vadose Zone Soil | MSADTDPTRSAADAAAAPLDLLLGDAATGMMRRMNPGGSGLRL |
| Ga0137371_114286402 | 3300012356 | Vadose Zone Soil | MSAETIGSAAAEADAAPLDLLLTDAALGVLNRVNPGGSGLRLAAALA |
| Ga0137390_101193722 | 3300012363 | Vadose Zone Soil | MSADTDATRPAAADAAAAPLDLLLAGADTAMLRRVNRDAS* |
| Ga0137395_103682272 | 3300012917 | Vadose Zone Soil | MSAGTDATRPAAADAAAAPLDLLLAGADTAMLRRVNRDAS* |
| Ga0157370_115348601 | 3300013104 | Corn Rhizosphere | MSADTDPTRSAADAAAAPLDLLLGDAATGMLRRMNPGGSGLRLAAS |
| Ga0182013_101794991 | 3300014492 | Bog | MSTHTGTIGPAAADAVSAPLDLLLTDAAFGALRRVNPGGFDLRLAAALATQPG |
| Ga0182015_100372124 | 3300014495 | Palsa | MDSDDNDTFGSAAADAVTAPLDLLLTDAAIGMLRRVNLGGPVLRLT |
| Ga0182024_101347122 | 3300014501 | Permafrost | MSTETIESAAADAVAVPLDLLLTDALGMLNRVNPGG* |
| Ga0181525_107416952 | 3300014654 | Bog | MSADTDSTRSAAGDAAAAPLDLLLGDAATGMLRRMNPGGSGLR |
| Ga0137403_114657651 | 3300015264 | Vadose Zone Soil | MSTHTDTMGAAAADTVTAPLDLLLTDAALGALRRVNPGGCGLRLAAAL |
| Ga0132255_1057250942 | 3300015374 | Arabidopsis Rhizosphere | MSTDTDPNGFAAAEAAAAPLDLLLTDAATGMLRRVNPGGSGL |
| Ga0182041_101695081 | 3300016294 | Soil | MSTNTDTMAAAAADAVTAPLDLLLTDAALGALHRVNPGGSGLRLAAALAVRPR |
| Ga0182033_119847392 | 3300016319 | Soil | MSTHTDTMAGAAADAMAAPLDLLLTDAALGALRRVNPGGSGLRLA |
| Ga0187812_10492463 | 3300017821 | Freshwater Sediment | MSADTDSIRSAADDAAAAPLDLLLTDAATGMLRRVNPGG |
| Ga0187818_101390062 | 3300017823 | Freshwater Sediment | MSADTNTDTTRPAAADAPAAPLDLLLADAATGMLRRVNPGGSGLRLAAAL |
| Ga0187809_102006442 | 3300017937 | Freshwater Sediment | MTTTESDPTGTVPAEAVSAPLHLLLTDAAIGALNRLNPGVSGLRLAANLAARPRLI |
| Ga0187809_102577891 | 3300017937 | Freshwater Sediment | MSADDDTTRSAAAEAAAAPLDLLLRDAATGMMRRINPGGSGLRLAAAL |
| Ga0187808_100058716 | 3300017942 | Freshwater Sediment | MSADTDSTRPAAADAAAAPLDLLLTDAATGMLRRVNPGGSGLRLA |
| Ga0187808_103447491 | 3300017942 | Freshwater Sediment | MSADTDSIRSAADDAAAAPLDLLLTDAATGMRRRVNPGGSGLRLAAALAV |
| Ga0187879_100071517 | 3300017946 | Peatland | MSTETIESAAADAFAAPLDLLLTDAALGMLNRVNPGG |
| Ga0187879_100520721 | 3300017946 | Peatland | MSPDSQTIRSAAADAVAAPLDLLLTDAAIGALRRVNPGGSG |
| Ga0187879_106916321 | 3300017946 | Peatland | MSAETIGSATADADAAPLDLLLPDAALGVLNRVNPGG |
| Ga0187783_104746231 | 3300017970 | Tropical Peatland | MSADTDTTRPAPADAPAAPLDLLLADAATGMLRRVNPGGSGLRLAAALAAR |
| Ga0187782_106699081 | 3300017975 | Tropical Peatland | MSADTDTSTSAAADAAAAPLDLLLTDAAVGMLRRVNL |
| Ga0187822_102828881 | 3300017994 | Freshwater Sediment | MMTEGDTTGAASAEAVSAPLDLLLTDAAFGALSRLNPGGSGLRLAAALA |
| Ga0187884_101329962 | 3300018009 | Peatland | MSTDTDTIGSAAADAVSAPLDMLLTDAAFGALRRVNPGGFVLRLAAALATQPGLVAGRGP |
| Ga0187890_100174705 | 3300018044 | Peatland | MSTETIESAAANAFAAPLDLLLTDAALGMLNRVNPGG |
| Ga0187859_105518592 | 3300018047 | Peatland | MSADTDSTKPAADDAAAVPLDLLLGDAATGMLRRMNPGGSGLRLAAS |
| Ga0187858_103476691 | 3300018057 | Peatland | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRMNPGG |
| Ga0187784_112221551 | 3300018062 | Tropical Peatland | MSANTDTIRTAAADAAAAPLDLLLTDAATGMLRRVNPAGSGLRLAPSNNPLLNPAAVKAA |
| Ga0193751_12068491 | 3300019888 | Soil | MSADDDTTRSAAAEAAAAPLDLLLSDAATGMLRRMNPGGSG |
| Ga0210401_108472402 | 3300020583 | Soil | MSADSDTTRSAAADATVAPLDLLLTDAAVGILRRANPGGSGLRLAAALA |
| Ga0210400_109650992 | 3300021170 | Soil | MSTDNDPTRPAPPDAAAPLDLLLTDAAMGMLRRLNPGGSGLRLAAAL |
| Ga0213874_102296571 | 3300021377 | Plant Roots | MTTESGSTGAAAAEAVSAPLDLLLTDAAFGALNRLNPGGSGLRLAAALASKPRL |
| Ga0210393_101278363 | 3300021401 | Soil | MSADTDSTRSAAADAAAAPLDMLLGDAATGMLRRMNPGGSGLRLAASLAAKPRLLAGRGGQLAGE |
| Ga0210385_101211961 | 3300021402 | Soil | MSTDSDPTRPAAPDAAAPLDLLLTDAATGMLRRVNPGGAGLRLAAALA |
| Ga0210385_113422121 | 3300021402 | Soil | MSADTDTTTSAAADAAAAPLDLLLTDAAVGMLRRAN |
| Ga0210385_114565761 | 3300021402 | Soil | MSADTDSMRSAAEDAAAAPLDLLLGDAATGMLRRMNPGGSGL |
| Ga0210397_101699263 | 3300021403 | Soil | MSADTDSTRSAAADAAAAPLDLLLGDAATGMLRRM |
| Ga0210397_113576751 | 3300021403 | Soil | MSPDSDTIRSAAADAAVAPLDLLLSDAAIGALRRVNPG |
| Ga0210389_103165032 | 3300021404 | Soil | MDSDDNGTFRSAATDGATAAADAATAPLDLLLTDAAIGM |
| Ga0210387_103915332 | 3300021405 | Soil | MSQDSETIRSAEADAAADAVAAPLDLLLTDAAIGALRRVNPGGSGLRL |
| Ga0210387_116239262 | 3300021405 | Soil | MSADTDTTTSAAADAAAAPLDLLLTDAAVGMLRRANPGGSGLRLAAA |
| Ga0210386_103112592 | 3300021406 | Soil | MSDDTDPTRPAAPDATAPLDLLLTDAATGMLRRVNPGGSGLRLDAAM |
| Ga0210383_102078001 | 3300021407 | Soil | MSADSDTIRSAADDVAAAPLDLLLGDAATGMLRRFNPGGSGL |
| Ga0210383_105724781 | 3300021407 | Soil | MSADTDSTRSAAEDAAAAPLDLLLGDAATGILRRMNPGSSGLR |
| Ga0210383_113199761 | 3300021407 | Soil | MNTQTDSLAAAAADAVTAPLDLLLTDAALGALRRMNLGGS |
| Ga0210398_105184062 | 3300021477 | Soil | MSADTDSTRSAAEDAAAAPLDLLLGDAATGILRRMNPGSSGL |
| Ga0210402_102362923 | 3300021478 | Soil | MSADTDSTRAAAEDAAVAPLDLLMTDAATGMLRRLNPGGSGLRLAAALA |
| Ga0210410_101892981 | 3300021479 | Soil | MSADTDTTTSAAADAAAAPLDLLLTDAAVGMLRRVNPGGSG |
| Ga0242672_10341921 | 3300022720 | Soil | MSADTDSTRAAAEDAAVAPLDLLMTDAATGMLRRLNP |
| Ga0179589_101598312 | 3300024288 | Vadose Zone Soil | MSQDSETNRSSAAEAAAEAVAAPLDLLLTDAAIGALRRAN |
| Ga0208717_100019614 | 3300025574 | Arctic Peat Soil | MSTETIESAAADTVVAPLDLLLTDAALGVLNRVNPGG |
| Ga0208219_11346182 | 3300025625 | Arctic Peat Soil | MSAETIESAATDAVAAPLDLLLTDAALGALNRVNPGGS |
| Ga0207693_100892231 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTHTDSLAAAAADAVTAPLDLLLTDAALGALRRMNP |
| Ga0207663_101993392 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTDDDTTRSAAAEAAAAPLDLLLSDAATGMLRRINPGGAGLRLA |
| Ga0207663_104440001 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDDTEPAGSAADAAAAPLDLLLADAATGMLRRINPGGAGLRLAAALAVRPR |
| Ga0207664_115234342 | 3300025929 | Agricultural Soil | MSPDSETIRSAAADAAAAPLDLLLTDAAIGVLRRVNP |
| Ga0208099_10478462 | 3300027096 | Forest Soil | MSADTDSTRSAAADAAAAPLDMLLGDAATGMLRRMNPGGSGLRLAASLAAKPRLVAGRGGRL |
| Ga0208199_11207111 | 3300027497 | Peatlands Soil | MSTDTDPIGSAAADAAAAPLDLLLTDAVFGALRRVNPGGSSLRLAAALAT |
| Ga0208042_11016881 | 3300027568 | Peatlands Soil | MSADTDSTRPAAADAAAAPLDLLLTDAATGMLRRVNPGGSGLRLAAA |
| Ga0209333_11776482 | 3300027676 | Forest Soil | MSADTDSNRPSAEDAVAGAPLDLLLTDAATGMLRRVNPGG |
| Ga0209040_102580551 | 3300027824 | Bog Forest Soil | MSTDTDPTGAAAEAAAAPLDLLLTDAVFGALRRVNPGG |
| Ga0209180_102523281 | 3300027846 | Vadose Zone Soil | MNPDSDTTRSAAADAAAAPLDLLLTDAAIGVLRRVNPGGSGLRLAA |
| Ga0209274_104443422 | 3300027853 | Soil | MSENTDSARSDAEAAEDAAAVPLDLLLADAATSMLRRVGPSG |
| Ga0209517_107311262 | 3300027854 | Peatlands Soil | MSANTDSIRSAADDAAAAPLDLLLTDAATGMLRRVNPGGSGLRLAAALAARPRLV |
| Ga0209693_103946822 | 3300027855 | Soil | MSADSDTIRSAADDVAAAPLDLLLGDAATGMLRRFNPGGS |
| Ga0209590_103157331 | 3300027882 | Vadose Zone Soil | MNSDDDTLRSAAAEAGTAPLDLLLTDAAIGMLRRVNLGGPGLRLTAALA |
| Ga0209380_105721792 | 3300027889 | Soil | MSADSDSASSAADAAAAPLDLLLTDAAIGMLRRVNPGNSGL |
| Ga0209415_1004501110 | 3300027905 | Peatlands Soil | VRSAAYARLVMNADTESTRSAAADAAAAPLDLLLTDAATGMLRRVNPGGSGLRLAV |
| Ga0209415_111399511 | 3300027905 | Peatlands Soil | MSTETIESAAADAVAAPLDLLLTDAALGVLNRVNPGGSGL |
| Ga0209006_101046571 | 3300027908 | Forest Soil | MSQDSETIRSAAADAVAAPLDLLLTDAAIGSLRRVNPGGSGLRLAAALS |
| Ga0209006_105743592 | 3300027908 | Forest Soil | MSANTDSDSSDSSAAEDAAAVPLDLLLGDAATGMLRRLNLGGSGLRLAAALAVRPRLVAGRG |
| Ga0209006_106078172 | 3300027908 | Forest Soil | MNPDSETTGSAAPDAAAAPTDLLLTDAAIGMLRRVSPD |
| Ga0209006_112774911 | 3300027908 | Forest Soil | MGPESDTLRSEAADAITAPLDLLLTDAAIGMLRRVSPG |
| Ga0209526_106182202 | 3300028047 | Forest Soil | MSTDSDPTRPAAPDAAAPLDLLLTDAATGMLRRVNPGGA |
| Ga0302220_1000155115 | 3300028742 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRVNLGGSGLRLAAA |
| Ga0302224_101950642 | 3300028759 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRLNLGGSGLRLAAALAAR |
| Ga0302225_105961531 | 3300028780 | Palsa | MSADTDSTRSAADDAAAAPLDLLLGDAATGMLRRMNPGGS |
| Ga0302232_103494771 | 3300028789 | Palsa | MSADTDPTRSAADDAAAAPLDLLLGDAATGMLRRMNPGGSGLRLAASLAAKP |
| Ga0302227_104269922 | 3300028795 | Palsa | MSTHTGTIGPAAADAVSAPLDLLLTDAAFGALRRVNPGGFDLRLAAALATQP |
| Ga0302221_100437473 | 3300028806 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRLNLGGSGLRLAAALAARPRLVAE |
| Ga0302228_103722692 | 3300028808 | Palsa | MNPDSETIRSAAADAVAAPLDLLLTDAAIGALRRVNPGGSGLRLAA |
| Ga0302235_101625702 | 3300028877 | Palsa | MSADSDPTRSAADDAAAAPLDLLLGDAATGMLRRMNP |
| Ga0307308_106624681 | 3300028884 | Soil | MSADTDATRPAAGAPLDLLLTGADTGMLRRVTRDALALLSRP |
| Ga0308309_105772001 | 3300028906 | Soil | MSADTDSTRSAADDAAAAPLDLLLGDAATGMLRRMNPGGSGLRLAAALA |
| Ga0311359_103123941 | 3300029914 | Bog | MSTHTGTIGPAAADAVSAPLDLLLTDAAFGALRRVNP |
| Ga0311326_101384031 | 3300029917 | Bog | MSTHTGTIGPAAADAVSAPLDLLLTDAAFGALRRVNPGGFDLR |
| Ga0311328_102338212 | 3300029939 | Bog | MSTHTGTIGPAAADAVSAPLDLLLTDAAFGALRRVNPGGFDLRLAAALATQPGLVDCRGRQVL |
| Ga0311340_103245711 | 3300029943 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRVNL |
| Ga0302181_102894342 | 3300030056 | Palsa | MSADTDSTGSAADDTAAAPLDLLLGDAATGMLRRMNPGG |
| Ga0302176_100240843 | 3300030057 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRVNLGGSGLRLAAALAARPRLVAERGT |
| Ga0302179_1000163112 | 3300030058 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMRRLNL |
| Ga0310037_101532044 | 3300030494 | Peatlands Soil | MSADTDSTRSAADDAAAAPLDLLLGDAATGVLRRMNPGG |
| Ga0302183_100373481 | 3300030509 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRVN |
| Ga0311357_103545342 | 3300030524 | Palsa | MSADTDPTRSAADDAAAAPLDLLLGDAATGMLRRMNPGGSGLRLAASLAAKPRL |
| Ga0311357_117676921 | 3300030524 | Palsa | MSAETDSARSAAEDAAAAPLDLLLGDAATGVLRRMNPGSSGLR |
| Ga0311354_103910522 | 3300030618 | Palsa | MSADTDPTRSAAADAVAAPVDLLLTDAATGMLRRVNLGGSGLRLAAALAARPRLVAERGTQLAG |
| Ga0311345_105825062 | 3300030688 | Bog | MSTDTDTIGSAAADAVSAPLDMLLTDAAFGALRRVNPGGFVLRLAAALATQPGLVAG |
| Ga0170834_1071525212 | 3300031057 | Forest Soil | MSPESDTIRSAEADAAAAPLDLLLTDAAIGMLRRVNPGSSGLRLAAVARKKKTE |
| Ga0307498_101796551 | 3300031170 | Soil | MSADVDSTRSAAADAAAAPLDLLLGDAATGMLRRMNPGGSGLRLAA |
| Ga0302325_106646731 | 3300031234 | Palsa | MSAETDSARSAAEDAAAAPLDLLLGDAATGMLRRM |
| Ga0265320_100407233 | 3300031240 | Rhizosphere | MSADPYASTPPAADAAAAPLDLLLTDAAVGMLRRVNLGGPGLRLAAA |
| Ga0265339_103631441 | 3300031249 | Rhizosphere | MSTHTDPMVAAAADAVTAPLDLLLTDAALGALRRMGPAGPGLRLAAALAVRPRLVARHGG |
| Ga0302140_102185291 | 3300031261 | Bog | MSADTDPTRSAAADAVAATVDLLLTDAATGMRRVNL |
| Ga0318573_102982911 | 3300031564 | Soil | MSADTDPNRSAAAPLDLLLTDAATGMLRGRVPAHQPDRC |
| Ga0318515_106116561 | 3300031572 | Soil | MSTHTDTMEAAAADAVTAPLDLLLTDAALGALRRVNPGGSGLRLAASLA |
| Ga0318515_107833692 | 3300031572 | Soil | MSPDSDAIRSAATDAVAAPLDLLLTDAALGALRRVNRGGSGLRLAAA |
| Ga0318555_108190821 | 3300031640 | Soil | MTTNTDTMAAATADAVTAPLDLLLTDAALGALRRVNPGGSG |
| Ga0318561_105266341 | 3300031679 | Soil | MTTNTDTMAAATADAVTAPLDLLLTDAALGALRRVNPGGSGLRLAA |
| Ga0318574_106044501 | 3300031680 | Soil | MSTHTDTMAAAAADAVTAPLDLLLTDAALGALRRVNPGGSGLRLAAAL |
| Ga0310686_1075173839 | 3300031708 | Soil | MNPESDTIGSAAADAAAAPMDLLLTDAAVGMLRRLNPGGSGLRLA |
| Ga0310686_1079136023 | 3300031708 | Soil | MSADSDTIRSAAADATAAPLDLLLTDAATGLLRRVNPGGSGLRLAAALA |
| Ga0310686_1119072561 | 3300031708 | Soil | MNPDSDTIRSAAADAATAPMDLLLTSAAMGILRRVNPGGSGLRLAAVLAGQPGLVAGRG |
| Ga0318500_101696691 | 3300031724 | Soil | MSPDSDTTRSAAAEAAAAPLDLLLTDAAMGALRRVN |
| Ga0318501_108156871 | 3300031736 | Soil | VTTDTTITSSDAAEAVSAPLDLLLTDAAFGALSRLNPGASGLRLAANLAA |
| Ga0318494_102496562 | 3300031751 | Soil | MSTNTDTMAAAAADAVTAPLDLLLTDAALGALHRVNPGGSGLRLAAALAVRPRLVAR |
| Ga0318535_104909931 | 3300031764 | Soil | MTADTDATRSAAADATAAPLDLLLTDAATGMLRRFNPGGSGLRL |
| Ga0318509_104677732 | 3300031768 | Soil | MSTHTDTMAGAAADAVTAPLDLLLTDAALGALRRV |
| Ga0318526_102646611 | 3300031769 | Soil | MSTHTDTMEAAAADAVTAPLDLLLTDAALGALRRVNPGGSG |
| Ga0318526_104632171 | 3300031769 | Soil | MTTNTETMAAATADAVTAPLDLLLTDAALGALRRVNPGGSGLRLAAALA |
| Ga0318566_102716511 | 3300031779 | Soil | MSTHTDTMAAAAADAVTAPLDLLLTDAALGALRRVNPGG |
| Ga0318547_102000012 | 3300031781 | Soil | MSADTDPTRSAAADAAAAPIDLLLTDAATGMLRRVNLG |
| Ga0318529_101946031 | 3300031792 | Soil | MSTHTDTMAADTADALTAPVDLLLTDAALGALRRVN |
| Ga0318529_104352181 | 3300031792 | Soil | MSPDSDTTSSAADAAAAPLDLLLTDAATGALRRVN |
| Ga0318548_102997522 | 3300031793 | Soil | MSPDSDTTRSAAAEAAAAPLDLLLTDAAMGALRRVNPGGSGLRLAA |
| Ga0318497_101880621 | 3300031805 | Soil | MSTDTDTDTIRTAAADAAAAPLDLLLTDAATGMLRRVNLGGSG |
| Ga0318568_100096501 | 3300031819 | Soil | MSPDSDTTSSAADAAAAPLDLLLTDAATGALRRVNPGGSGLRLAAALA |
| Ga0318567_107278101 | 3300031821 | Soil | MSTDTDTDTIRTAAADAAAAPLDLLLTDAATGMLRRVN |
| Ga0307478_116860162 | 3300031823 | Hardwood Forest Soil | MSTDNDPTRPAAPDAAAPLDLLLTDAATGMLRRVNPGGSGLRLAAAL |
| Ga0318512_100116041 | 3300031846 | Soil | MMTTDIDTTSSDAAEALSASLDLLLTDAAFGALTRLNPGGSGLRLAAHLAARVQ |
| Ga0307479_114905822 | 3300031962 | Hardwood Forest Soil | MSADTDTTRSAADDVAAAPLDLLLADAATGMLRRVNPGGPGLRL |
| Ga0318562_108598511 | 3300032008 | Soil | VTTDTTITSSDAAEAVSAPLDLLLTDAAFGALSRLNPGGSGLRLAAKLA |
| Ga0318569_101296652 | 3300032010 | Soil | MSPDSDTTRSAAAEAAAAPLDLLLTDAAMGALRRVNPGGSGLRLAAALA |
| Ga0318559_104253411 | 3300032039 | Soil | MSADTDPNRSAAAPLDLLLTDAATGMLRGRVPAHQPD |
| Ga0318549_102361522 | 3300032041 | Soil | MMTTDIDTTSSDAAEALSASLDLLLTDAAFGALTRLNPGGSGLRLAAHLAA |
| Ga0318556_103517192 | 3300032043 | Soil | VTTDTTITSSDAAEAVSAPLDLLLTDAAFGALCRRNPGGSGLRLAAKLAA |
| Ga0318556_106941731 | 3300032043 | Soil | MSADTDTTGAAAADAAAAPLDLLLTDAAVGMLRRVN |
| Ga0318575_103662581 | 3300032055 | Soil | MSTHTDTMEAAAVDAVTAPLDLLLTDAALGALRRVNPGGSGL |
| Ga0318504_103129181 | 3300032063 | Soil | MSTHTDTIEAAAADAVTAPLDLLLTDAALGALRRVNP |
| Ga0318525_100088571 | 3300032089 | Soil | MSPDSDTTRSAAAEAAAAPLDLLLTDAAMGALRRVNP |
| Ga0311301_120500991 | 3300032160 | Peatlands Soil | MSADDDTTRSAADDAAAAPLDLLLGDAAAGILRRMNPGGSGLRLA |
| Ga0335078_116743883 | 3300032805 | Soil | MTAETTQPAAADAAAAPLDLLLTDAALGVLNRVVPDGSGLRLAAALAT |
| Ga0335080_110746871 | 3300032828 | Soil | MTAETTEAAAADAAAAPLDLLLTDAALGVLNRVVPDG |
| Ga0335080_117300171 | 3300032828 | Soil | MSTDSDPIGSAAADAAAAPLDLLLTDAVFGALRRVNPGGSGLRLAAALAT |
| Ga0335069_122564991 | 3300032893 | Soil | MTDTDMTGWAAADAVPAPLDLLLTDAAFGAALGTLRRLNPGGSGLRLAAALAARPRMVA |
| Ga0335069_124849003 | 3300032893 | Soil | MSTDSDTTETAADAVAAPLDLLLTDAVFGALRRVNPGGSGVRL |
| Ga0335074_108250442 | 3300032895 | Soil | MPPAAYARLIMSADTDSTTPAAEDAAAAPLDLLLADAATGMLRRVNLGGAGL |
| Ga0335075_115216492 | 3300032896 | Soil | MSADTDTGRSAAADAAAAPLDLLLTDAAVGMLRRVNP |
| Ga0335071_117646881 | 3300032897 | Soil | MSANTDSDRSAAEDAAAVPLDLLLADAATSMLRRVNLGGSGLRLAAALAVRPRLVA |
| Ga0335072_105877432 | 3300032898 | Soil | MSADTDPVTAAADAAAAPLDLLLADAATGMLRRVNP |
| Ga0335072_106846051 | 3300032898 | Soil | MSDDTDSTRAAGDAAAAPLDLLLTDAATGMLRRVYLGGSGLRL |
| Ga0335072_111850001 | 3300032898 | Soil | MSSDTDSFAAAAADAVTAPLDLLLTDAALGALRRMNPGGPGLRLAGALAV |
| Ga0335077_107373801 | 3300033158 | Soil | MTSETTEPAAADAAAAPLDLLLTDAALGVLNRVVPDG |
| Ga0316214_10180952 | 3300033545 | Roots | MTDNADSTRSAAEDAGAVPLDLLLSDAATGMLRRVNPGG |
| Ga0370515_0435044_392_553 | 3300034163 | Untreated Peat Soil | MSTHTGTIGPAAADAVSAPLDLLLTDAAFGALRRVNPGGFDLRLAAALATQPGL |
| ⦗Top⦘ |