NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F022010

Metagenome Family F022010

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022010
Family Type Metagenome
Number of Sequences 216
Average Sequence Length 45 residues
Representative Sequence VFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRAEPRSE
Number of Associated Samples 171
Number of Associated Scaffolds 216

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.69 %
% of genes from short scaffolds (< 2000 bps) 95.37 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.593 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.648 % of family members)
Environment Ontology (ENVO) Unclassified
(43.056 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.648 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.84%    β-sheet: 0.00%    Coil/Unstructured: 81.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 216 Family Scaffolds
PF01661Macro 66.20
PF11897DUF3417 12.50
PF00215OMPdecase 0.46
PF01584CheW 0.46
PF14684Tricorn_C1 0.46
PF00108Thiolase_N 0.46
PF00571CBS 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 216 Family Scaffolds
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 66.20
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.59 %
UnclassifiedrootN/A7.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104929045All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300000550|F24TB_12233507Not Available588Open in IMG/M
3300000559|F14TC_101830265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia875Open in IMG/M
3300000890|JGI11643J12802_12051260All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300002503|C687J35164_10158563All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300003319|soilL2_10119779All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300003996|Ga0055467_10271357All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300004463|Ga0063356_104974451All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter571Open in IMG/M
3300004480|Ga0062592_101424623All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300004480|Ga0062592_102535223All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300004643|Ga0062591_100626121All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300005176|Ga0066679_10899486All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium558Open in IMG/M
3300005184|Ga0066671_10031487All Organisms → cellular organisms → Bacteria2496Open in IMG/M
3300005293|Ga0065715_10186054All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300005293|Ga0065715_11116196All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300005328|Ga0070676_11536665All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula513Open in IMG/M
3300005332|Ga0066388_101722595All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300005334|Ga0068869_100877815All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300005334|Ga0068869_100944603All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300005336|Ga0070680_100594738All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300005353|Ga0070669_101087203All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300005364|Ga0070673_100111893All Organisms → cellular organisms → Bacteria2266Open in IMG/M
3300005406|Ga0070703_10403882Not Available595Open in IMG/M
3300005440|Ga0070705_101485239All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium567Open in IMG/M
3300005445|Ga0070708_100831057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300005446|Ga0066686_10286859All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300005456|Ga0070678_101206876All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300005518|Ga0070699_101937851Not Available539Open in IMG/M
3300005543|Ga0070672_100201913All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300005543|Ga0070672_101470124All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300005544|Ga0070686_100410467All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300005544|Ga0070686_101617191All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300005545|Ga0070695_101404538All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300005545|Ga0070695_101835824All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula509Open in IMG/M
3300005546|Ga0070696_100639517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300005549|Ga0070704_100845503All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300005558|Ga0066698_10426453All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300005564|Ga0070664_101894333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300005577|Ga0068857_102118461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300005578|Ga0068854_101274141All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300005615|Ga0070702_100915320All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300005616|Ga0068852_101243801All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300005617|Ga0068859_100258392All Organisms → cellular organisms → Bacteria1833Open in IMG/M
3300005618|Ga0068864_101004097All Organisms → cellular organisms → Bacteria → Acidobacteria828Open in IMG/M
3300005764|Ga0066903_108453371All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300005841|Ga0068863_102623135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter513Open in IMG/M
3300005843|Ga0068860_100328467All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300005843|Ga0068860_100635506All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300006046|Ga0066652_100578719All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300006046|Ga0066652_100721524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium950Open in IMG/M
3300006196|Ga0075422_10590783Not Available513Open in IMG/M
3300006755|Ga0079222_10444164All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300006794|Ga0066658_10735798All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300006797|Ga0066659_10441200All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300006847|Ga0075431_100894941All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300006852|Ga0075433_10164755All Organisms → cellular organisms → Bacteria1973Open in IMG/M
3300006852|Ga0075433_11629668All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula556Open in IMG/M
3300006853|Ga0075420_100383541All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300006894|Ga0079215_10000466All Organisms → cellular organisms → Bacteria → Acidobacteria9519Open in IMG/M
3300006894|Ga0079215_10147227All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300006904|Ga0075424_101070106All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium860Open in IMG/M
3300006904|Ga0075424_101603425All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300006931|Ga0097620_102702132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300006969|Ga0075419_10394101All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300007258|Ga0099793_10621068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300009094|Ga0111539_10043876All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia5359Open in IMG/M
3300009094|Ga0111539_11083965All Organisms → cellular organisms → Bacteria → Acidobacteria931Open in IMG/M
3300009094|Ga0111539_12990393Not Available546Open in IMG/M
3300009098|Ga0105245_11147534All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300009100|Ga0075418_10360523All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1552Open in IMG/M
3300009101|Ga0105247_10787574All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300009137|Ga0066709_104155865All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula527Open in IMG/M
3300009143|Ga0099792_10020633All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2932Open in IMG/M
3300009147|Ga0114129_12549097All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium611Open in IMG/M
3300009147|Ga0114129_12729826All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter588Open in IMG/M
3300009147|Ga0114129_13376521All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter514Open in IMG/M
3300009162|Ga0075423_11344971All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter764Open in IMG/M
3300009174|Ga0105241_10227107All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1572Open in IMG/M
3300009174|Ga0105241_10613380All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300009177|Ga0105248_12846735All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009553|Ga0105249_11129020All Organisms → cellular organisms → Bacteria → Acidobacteria854Open in IMG/M
3300009789|Ga0126307_10763999All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300010039|Ga0126309_11183226Not Available524Open in IMG/M
3300010040|Ga0126308_11340481All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter508Open in IMG/M
3300010041|Ga0126312_10790321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300010046|Ga0126384_11051436All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium744Open in IMG/M
3300010047|Ga0126382_11831016All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300010359|Ga0126376_10717800All Organisms → cellular organisms → Bacteria → Acidobacteria964Open in IMG/M
3300010366|Ga0126379_11436721All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300010375|Ga0105239_11798647All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300010397|Ga0134124_10526702All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1147Open in IMG/M
3300010397|Ga0134124_12275277All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300010397|Ga0134124_12875143Not Available525Open in IMG/M
3300010398|Ga0126383_10085637All Organisms → cellular organisms → Bacteria → Acidobacteria2767Open in IMG/M
3300010399|Ga0134127_12170594All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300010399|Ga0134127_12954004All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium554Open in IMG/M
3300010400|Ga0134122_10307846All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1363Open in IMG/M
3300010400|Ga0134122_10833004All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300010400|Ga0134122_11217225All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter755Open in IMG/M
3300010401|Ga0134121_10223131All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1638Open in IMG/M
3300010401|Ga0134121_11763864All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300010403|Ga0134123_11139350All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300010403|Ga0134123_11646963All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300010403|Ga0134123_12855673All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300011270|Ga0137391_11554936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300011993|Ga0120182_1021630Not Available582Open in IMG/M
3300012045|Ga0136623_10491807All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300012199|Ga0137383_10022156All Organisms → cellular organisms → Bacteria4407Open in IMG/M
3300012202|Ga0137363_11729612All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300012205|Ga0137362_10621099All Organisms → cellular organisms → Bacteria → Acidobacteria931Open in IMG/M
3300012205|Ga0137362_10687796All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300012207|Ga0137381_11499784All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula566Open in IMG/M
3300012208|Ga0137376_11650503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300012209|Ga0137379_11035100All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300012210|Ga0137378_10584941All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300012354|Ga0137366_11205869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300012355|Ga0137369_10455389All Organisms → cellular organisms → Bacteria → Acidobacteria912Open in IMG/M
3300012357|Ga0137384_11333267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300012530|Ga0136635_10091326All Organisms → cellular organisms → Bacteria → Acidobacteria959Open in IMG/M
3300012532|Ga0137373_10626417All Organisms → cellular organisms → Bacteria → Acidobacteria809Open in IMG/M
3300012582|Ga0137358_10312081Not Available1067Open in IMG/M
3300012679|Ga0136616_10492677All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012682|Ga0136611_10830843All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300012685|Ga0137397_10580783All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300012923|Ga0137359_10765445All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300012924|Ga0137413_10148194All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300012927|Ga0137416_10606281All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300012927|Ga0137416_12024479All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium528Open in IMG/M
3300012944|Ga0137410_10350541All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300012944|Ga0137410_11414026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300012948|Ga0126375_10058249All Organisms → cellular organisms → Bacteria2100Open in IMG/M
3300012951|Ga0164300_10290566All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300012955|Ga0164298_10795911All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300012958|Ga0164299_10176258All Organisms → cellular organisms → Bacteria → Acidobacteria1211Open in IMG/M
3300012977|Ga0134087_10471480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300013102|Ga0157371_10304205All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300013296|Ga0157374_11275515All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300013307|Ga0157372_13368157Not Available509Open in IMG/M
3300013308|Ga0157375_10305583All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1755Open in IMG/M
3300013308|Ga0157375_10580064All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1282Open in IMG/M
3300013308|Ga0157375_10616001All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300013308|Ga0157375_10831113All Organisms → cellular organisms → Bacteria → Acidobacteria1071Open in IMG/M
3300013308|Ga0157375_12451204All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300014325|Ga0163163_12304324Not Available597Open in IMG/M
3300014326|Ga0157380_10487063All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300014745|Ga0157377_10576824All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300014745|Ga0157377_11272704All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300014968|Ga0157379_11435581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300015262|Ga0182007_10429250Not Available507Open in IMG/M
3300015371|Ga0132258_10891492All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2245Open in IMG/M
3300015371|Ga0132258_12001999All Organisms → cellular organisms → Bacteria → Acidobacteria1457Open in IMG/M
3300015371|Ga0132258_13786850All Organisms → cellular organisms → Bacteria → Acidobacteria1030Open in IMG/M
3300015371|Ga0132258_13801449All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300015371|Ga0132258_13856439All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1020Open in IMG/M
3300015372|Ga0132256_101053950All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
3300015374|Ga0132255_104354097All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter600Open in IMG/M
3300017659|Ga0134083_10473282All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300017787|Ga0183260_10267843Not Available1173Open in IMG/M
3300018429|Ga0190272_10612094All Organisms → cellular organisms → Bacteria → Acidobacteria958Open in IMG/M
3300018429|Ga0190272_11409660All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300018433|Ga0066667_11171711All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300018433|Ga0066667_11395097All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula615Open in IMG/M
3300018476|Ga0190274_11721820All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300018920|Ga0190273_10627878All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300020006|Ga0193735_1103336All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300020012|Ga0193732_1049243All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300020059|Ga0193745_1088569All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300021445|Ga0182009_10396673All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300025900|Ga0207710_10700881All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300025903|Ga0207680_10753035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300025913|Ga0207695_11161249All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300025916|Ga0207663_11024622All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300025923|Ga0207681_10856690All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300025925|Ga0207650_10622759All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300025925|Ga0207650_11470094Not Available579Open in IMG/M
3300025934|Ga0207686_10772708All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300025935|Ga0207709_11089068All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300025937|Ga0207669_11391183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300025941|Ga0207711_10385295All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1301Open in IMG/M
3300025942|Ga0207689_11497571All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300025942|Ga0207689_11563610All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter549Open in IMG/M
3300025945|Ga0207679_11213603All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300025960|Ga0207651_10926540All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300025981|Ga0207640_10794911All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300026023|Ga0207677_10937420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia782Open in IMG/M
3300026023|Ga0207677_12184216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter515Open in IMG/M
3300026041|Ga0207639_11797245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria574Open in IMG/M
3300026088|Ga0207641_12449067All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium521Open in IMG/M
3300026095|Ga0207676_10568484All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300026116|Ga0207674_12057890Not Available535Open in IMG/M
3300026312|Ga0209153_1173073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium781Open in IMG/M
3300026312|Ga0209153_1199474All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula704Open in IMG/M
3300026319|Ga0209647_1308802All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium532Open in IMG/M
3300027639|Ga0209387_1029726All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1109Open in IMG/M
3300027750|Ga0209461_10090863All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300027775|Ga0209177_10148174All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300027880|Ga0209481_10741245Not Available511Open in IMG/M
3300027886|Ga0209486_10426616All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300027907|Ga0207428_10232013All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1381Open in IMG/M
3300027909|Ga0209382_11655725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300028380|Ga0268265_10548772All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1097Open in IMG/M
3300030513|Ga0268242_1021053All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1100Open in IMG/M
3300031538|Ga0310888_10646160All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300031716|Ga0310813_11382606All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300031720|Ga0307469_11498271All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Yanofskybacteria → Candidatus Yanofskybacteria bacterium RIFCSPLOWO2_01_FULL_49_25646Open in IMG/M
3300031720|Ga0307469_12250591All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031754|Ga0307475_11361908All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300032002|Ga0307416_102889448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula575Open in IMG/M
3300032005|Ga0307411_10508816All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300032122|Ga0310895_10302141All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300034005|Ga0334930_038976All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300034005|Ga0334930_090941All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium543Open in IMG/M
3300034376|Ga0334923_130233All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium520Open in IMG/M
3300034377|Ga0334931_044169All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300034377|Ga0334931_105517All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula660Open in IMG/M
3300034781|Ga0334935_004000All Organisms → cellular organisms → Bacteria → Acidobacteria4186Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil6.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.78%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.31%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.85%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.46%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.46%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.46%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.46%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.46%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.46%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.46%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.46%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011993Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012679Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)EnvironmentalOpen in IMG/M
3300012682Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030513Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300034005Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNSEnvironmentalOpen in IMG/M
3300034376Biocrust microbial communities from Mojave Desert, California, United States - 19HNCEnvironmentalOpen in IMG/M
3300034377Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNSEnvironmentalOpen in IMG/M
3300034781Biocrust microbial communities from Mojave Desert, California, United States - 31SMCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10492904523300000364SoilVDGDHPLTEHKAKSVAEALRRQDMFDEVNVEAREDEQA*
F24TB_1223350723300000550SoilDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRDGE*
F14TC_10183026513300000559SoilVMLDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPRETE*
JGI11643J12802_1205126033300000890SoilGIVMIDDRVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEVKTEPRAEE*
C687J35164_1015856313300002503SoilIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRVEPREDE*
soilL2_1011977933300003319Sugarcane Root And Bulk SoilVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRNND*
Ga0055467_1027135723300003996Natural And Restored WetlandsLDDRLFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGEN*
Ga0063356_10497445123300004463Arabidopsis Thaliana RhizosphereVMLDDGVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEIRAEPRPEEDL*
Ga0062592_10142462313300004480SoilGVVMLDDRIFEIASADAEHPLTEHKAKGVAEALRRQDMFEEVKVEPRGEE*
Ga0062592_10253522323300004480SoilVVMLDDRVFEIASTDPDHPLTEHTANAVAGALRRQDMFDEIKTEPRPEE*
Ga0062591_10062612133300004643SoilVVMLDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPRETE*
Ga0066679_1089948613300005176SoilEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVSVEPREEA*
Ga0066671_1003148713300005184SoilEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRGEQ*
Ga0065715_1018605413300005293Miscanthus RhizosphereASEDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV*
Ga0065715_1111619613300005293Miscanthus RhizosphereFEIASTDPDHPLTEHKAKGVADALRRQDMFDEVRTEPRGE*
Ga0070676_1153666523300005328Miscanthus RhizosphereGVIMLDERVFEIASADPGHPLTEHKAKGVAEALRRQDMFDEIRVEPRDVDEV*
Ga0066388_10172259513300005332Tropical Forest SoilTLGSLGVVMLDERVFEIASTDPDHPLTEHKAQAVAEALRRQDMFDEISTEPRSE*
Ga0068869_10087781523300005334Miscanthus RhizosphereRMFEIASVDPNHPLTEHKAKGVADALRRQDMFDEVRTEPRDEQ*
Ga0068869_10094460313300005334Miscanthus RhizosphereIGIVMIDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE*
Ga0070680_10059473813300005336Corn RhizosphereVYMIDERVFEIASEDPERPLTEHKAKGVAEALRRQDMFDEVNVEAREEAT*
Ga0070669_10108720323300005353Switchgrass RhizosphereDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEVRTEPREME*
Ga0070673_10011189313300005364Switchgrass RhizosphereSLDVYMIDERVFEIASEDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV*
Ga0070703_1040388223300005406Corn, Switchgrass And Miscanthus RhizosphereDRVFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEIRTEPRSDE*
Ga0070705_10148523913300005440Corn, Switchgrass And Miscanthus RhizosphereIVMLDDGVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEIRPEPRDEDV*
Ga0070708_10083105723300005445Corn, Switchgrass And Miscanthus RhizosphereVCLDERMFEIASVDPDHPLTEHKAKGVAEALRRQDMFDEIKVETREE*
Ga0066686_1028685933300005446SoilERVFEIASVDPDHPLTEHKAKGVAEALRRQDMFDEINIEPRDKT*
Ga0070678_10120687623300005456Miscanthus RhizosphereGIVMIDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE*
Ga0070699_10193785113300005518Corn, Switchgrass And Miscanthus RhizosphereFEIASADPDHPLTEHKAKGVAEALRRQDMFDEVDVEPREQA*
Ga0070672_10020191333300005543Miscanthus RhizosphereDDRLFEIASVDPEHPLTEHKAKGVAEALRRQDMFEEVRAEPRSDE*
Ga0070672_10147012413300005543Miscanthus RhizosphereVVMLDDRLFEIASTDPDHPLTEHKAKGVAEALRRQDMFDDIKTEPRGE*
Ga0070686_10041046713300005544Switchgrass RhizosphereVFEIASDDADHPLTEHKAKGVAEALRRQAMFDEVSVEPRAEESAAD*
Ga0070686_10161719123300005544Switchgrass RhizosphereGSLGVYMIDDRVFEIASDDSNHPLTEHKAKGVAEALRRQDMFDEINVELREEPSE*
Ga0070695_10140453823300005545Corn, Switchgrass And Miscanthus RhizosphereAAIDPEHPLSEFKAKGVAEALKRQDMFEEIKVEPREEDA*
Ga0070695_10183582423300005545Corn, Switchgrass And Miscanthus RhizosphereSLGVVMLDDRVFEIASSDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE*
Ga0070696_10063951713300005546Corn, Switchgrass And Miscanthus RhizosphereSADPEHPLTEHKAKGVAEALRRQDMFDEIRVEPRGESADEI*
Ga0070704_10084550313300005549Corn, Switchgrass And Miscanthus RhizosphereRVFEIASTDPDHPLTEHKAKGVADALRRQDMFDDIKTEPRGE*
Ga0066698_1042645323300005558SoilFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEAKEE*
Ga0070664_10189433323300005564Corn RhizosphereLTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA*
Ga0068857_10211846123300005577Corn RhizosphereFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIKIEPRAEE*
Ga0068854_10127414113300005578Corn RhizosphereTDPDHPLTEHKAKGVAEALRRQDMFDDIKTEPRGE*
Ga0070702_10091532023300005615Corn, Switchgrass And Miscanthus RhizosphereIAAVNPDHPLTEHKAKGVAEALRRQDMFDEISVEAREEESS*
Ga0068852_10124380113300005616Corn RhizosphereEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE*
Ga0068859_10025839213300005617Switchgrass RhizosphereIASTDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRGE*
Ga0068864_10100409713300005618Switchgrass RhizosphereGSLGVVMLDDRVFEIASIDPEHPLTEHKAKGVAEALRRQDMFDEIRAEPRSDE*
Ga0066903_10845337113300005764Tropical Forest SoilERVFEIASDDPNHPLTEHKAKGVAEALRRQDMFDQIDVEPREGEP*
Ga0068863_10262313523300005841Switchgrass RhizosphereGQLGVVMLDDRVFEIASTDPEHPLTAHTAKGVAEALRRQDMFDEITTEPRGE*
Ga0068860_10032846713300005843Switchgrass RhizosphereVVMLDDRVFEIASTDADHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE*
Ga0068860_10063550633300005843Switchgrass RhizosphereFEIASDDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV*
Ga0066652_10057871913300006046SoilSTDADHPLTEHKAKGVAEALRRQDMFDEIDVEPREPA*
Ga0066652_10072152433300006046SoilEHPLTEHKAKRVAEALRLQDMFDEIDVEPREEEPA*
Ga0075422_1059078313300006196Populus RhizosphereVMLDDRVFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE*
Ga0079222_1044416413300006755Agricultural SoilDDGVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEIRPEPRDEDV*
Ga0066658_1073579823300006794SoilMFEIASVDPDHPLTEHKAKGVAEALRRQDMFDEINVELRDGEPA*
Ga0066659_1044120013300006797SoilMIDERVFEIASGDPNHPLTEHKAKGVAEALRRQDMFDEIDVELREVG*
Ga0075431_10089494133300006847Populus RhizosphereFEIASTDPEHPLTEHTAKGVAEALRRQDMFDEIRTEPRGEQ*
Ga0075433_1016475533300006852Populus RhizosphereVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRAEPRSE*
Ga0075433_1162966823300006852Populus RhizosphereIDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE*
Ga0075420_10038354113300006853Populus RhizosphereSTDPDHPLTEHTAKGVAEALRRQDMFDEITTEPREEA*
Ga0079215_1000046673300006894Agricultural SoilASTDADHPLTEHTAKGVAEALRRQDMFDEIRTEPREEA*
Ga0079215_1014722713300006894Agricultural SoilDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGESDVDA*
Ga0075424_10107010633300006904Populus RhizosphereRVFEIASNDADHPLTEHKAKGVAEALRRQDMFDQIDIQPFEEG*
Ga0075424_10160342513300006904Populus RhizosphereMLDECVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRAEPRSE*
Ga0097620_10270213213300006931Switchgrass RhizosphereTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA*
Ga0075419_1039410133300006969Populus RhizosphereIVMIDDRVFEIASTDPDHPLTEHTAKGVAKALRRQDMFDEITTEPRAEDL*
Ga0099793_1062106813300007258Vadose Zone SoilEHPLTEHKAKGVAEAVRRQDMFDEVSIELREEES*
Ga0111539_1004387653300009094Populus RhizosphereGIVMIDDRVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEMSAEPRDAGL*
Ga0111539_1108396513300009094Populus RhizosphereRLGIVMIDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE*
Ga0111539_1299039323300009094Populus RhizosphereDDYVFEIASTDPEHPLTEHKANGVAEALRRQDMFDEIRIEPRSEQ*
Ga0105245_1114753413300009098Miscanthus RhizosphereTDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRGD*
Ga0075418_1036052313300009100Populus RhizosphereEIASTDPEHPLTEHTARGVAEALRRQDMFEEIRTEPRAEE*
Ga0105247_1078757423300009101Switchgrass RhizosphereDERVFEISSDDPERPLTEHKAKGVAEALRRQDMFDEINVEPREEASVTD*
Ga0066709_10415586523300009137Grasslands SoilMIDDRVFEIASVDADHPLTEHKAKGVAEALRRQDMFDEIDVELREGA*
Ga0099792_1002063333300009143Vadose Zone SoilFEIASADPEHPLTEHKAKGVAEAVRRQDMFDEVSIEVREEES*
Ga0114129_1254909713300009147Populus RhizosphereTDPDHPLTEHTAKGVAEALRRQDMFDEITPEPRPEE*
Ga0114129_1272982623300009147Populus RhizosphereSLGVVMLDDRLFEIASIDPEHPLTEHKAKGVAEALRRQDMFEEIRAEPRTDE*
Ga0114129_1337652123300009147Populus RhizosphereLGVVMLDERVFEIASADPEHPLTEHKAKGVADALRRQDMFDEIKVEPRDEDEA*
Ga0075423_1134497113300009162Populus RhizosphereLGSLGVVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRQDMFDEIRTEPRIED*
Ga0105241_1022710713300009174Corn RhizosphereVVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRMDMFDDIRTEPRVEE*
Ga0105241_1061338013300009174Corn RhizosphereSLGVVMLDDRVFEIASTNPDHPLTEHKAKGVAEALRRQDMFDDIKTEPRGE*
Ga0105248_1284673533300009177Switchgrass RhizosphereTEHKAKGIAEALRRQDMFDEVKVEPREEEGVELESN*
Ga0105249_1112902033300009553Switchgrass RhizosphereDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPREME*
Ga0126307_1076399923300009789Serpentine SoilLDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGE*
Ga0126309_1118322613300010039Serpentine SoilEIASTDPEHPLTEHKAKGVAEALRRQDMFEEVSVEPRDPDEVDAEP*
Ga0126308_1134048123300010040Serpentine SoilFEIVSIDPEHPLTEHKAKGVADALRRQDMFDEVEVEPRAEDDDEEESD*
Ga0126312_1079032123300010041Serpentine SoilFEVASTDPDHPLTEHKAKGVADALRRQDMFDEIRTEPRGE*
Ga0126384_1105143623300010046Tropical Forest SoilPDHPLTEHKAKGVAEALRRQDMFDQIDVEPREGES*
Ga0126382_1183101623300010047Tropical Forest SoilRVFEIASDDPNHPLTEHKAKGVAEALRRQDMFDQIDVEPREGEP*
Ga0126376_1071780013300010359Tropical Forest SoilLGVAMLDDRVFEIASIDPEHPLTEHKAKGVAEALRRQDMFDDIRAEPRSDE*
Ga0126379_1143672113300010366Tropical Forest SoilDRVFEISSDDPNHPLTEHKAKGVAEALRRQDMFDEIKVEPREEDAQ*
Ga0105239_1179864713300010375Corn RhizosphereRVFEIASADPEQPLTEHKAQAVAAALRRQDMFDEITTEPRSE*
Ga0134124_1052670213300010397Terrestrial SoilSTDPEHPLTEHKAQAVAEALRRQDMFDEIATEPRSE*
Ga0134124_1227527723300010397Terrestrial SoilTDPDHPLTEHKAKGVAEALRRQDMFDEVKTEPRSE*
Ga0134124_1287514323300010397Terrestrial SoilRVFEIASADPNHPLTEHKAKGVAEALRRQDMFDEVRTEPRVE*
Ga0126383_1008563743300010398Tropical Forest SoilGSLGVYMIDERVFEIASDDPDHPLTEHKAKSVAEALRRQDMFDEINVEPREEPQA*
Ga0134127_1217059413300010399Terrestrial SoilASNDPEHPLTQHTAKGVAEALRRQDMFDEITAEPRGD*
Ga0134127_1295400413300010399Terrestrial SoilSLEVVMLDDGLFEIASIDPEHPLTEHKAKGVAEALRRQDMFEEIRTEPRPDE*
Ga0134122_1030784613300010400Terrestrial SoilGVVMLDDRIFEIASADPEHPLTEHKAKGVAEALRRQDMFDEIRTEARSNE*
Ga0134122_1083300413300010400Terrestrial SoilDRVFEIASVYPDRPLTEHKAKGVAESMRRQDMFDEVNVEPREEEQV*
Ga0134122_1121722513300010400Terrestrial SoilSLGVVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRQDMFDEIRTEPRIED*
Ga0134121_1022313113300010401Terrestrial SoilFEISSDDPERPLTEHKAKGVAEALRRQDMFDEINVEPREETSVTD*
Ga0134121_1176386423300010401Terrestrial SoilIASTDPDHPLNEHTAKGVAEALRRQDMFDEIHTEPRSED*
Ga0134123_1113935013300010403Terrestrial SoilSVDPEHPLTEHKAKGVAEALRRQDMFEEIRTEPRVDE*
Ga0134123_1164696323300010403Terrestrial SoilFEIASADPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE*
Ga0134123_1285567323300010403Terrestrial SoilEISSDDPTHPLTEHKAKGIAEALRRQDMFDEVNVEPREEEFQ*
Ga0137391_1155493613300011270Vadose Zone SoilSADPEHPLSEGKAKGVADALRRQDMFEEIKVEPRDEAGLEANL*
Ga0120182_102163013300011993TerrestrialMLDDRIFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSEQ*
Ga0136623_1049180713300012045Polar Desert SandLGVVMLKDRVFEIASADPEHPLTEHKAKGVAEALRRQGMFDEVKVEPRREE*
Ga0137383_1002215653300012199Vadose Zone SoilPEHPLTEHKAKGVADAVRRQDMFDEVKVEPREEAPVE*
Ga0137363_1172961213300012202Vadose Zone SoilIASVDPDHPLTEHKAKGVAEALRRQDMFDEINVELREGEPA*
Ga0137362_1062109913300012205Vadose Zone SoilASVDPEHPLTEHKAKGVADALRRQDMFDEINVEPRGEDPA*
Ga0137362_1068779623300012205Vadose Zone SoilVVMLDERVFEIASADPEHPLTEHKAKGVAEAVRRQDMFDEVSVELREEES*
Ga0137381_1149978423300012207Vadose Zone SoilVDPDHPLTEHKAKGVAEALRRQDMFDEINIEPRDKA*
Ga0137376_1165050323300012208Vadose Zone SoilERVFEVASDDPNHPLTEHKAKGVAEALRRQDMFDEIDVELREVG*
Ga0137379_1103510013300012209Vadose Zone SoilSDDPDHPLTEHKAKGVAEALRRQDMFDEISVEPREEELA*
Ga0137378_1058494113300012210Vadose Zone SoilVFEIASTDSEHPLTEHKAKGVADALRRQDMFDEIRVEPRDGE*
Ga0137366_1120586923300012354Vadose Zone SoilEIASADPDHPLTEHKAKGVAEALRRQDMFDEIEVEPREEALP*
Ga0137369_1045538913300012355Vadose Zone SoilRLFEIASADADHPLTELKAKGVAEALRRQDMCDEINIKPRD*
Ga0137384_1133326713300012357Vadose Zone SoilIASDDPNHPLTEHKAKGVAEALRRQDMFDEIDVELREVG*
Ga0136635_1009132623300012530Polar Desert SandGVVMLYDRVFEIASADPEHPLTEHKAKGVAEALRRQDMFDEIKVEPRGEE*
Ga0137373_1062641713300012532Vadose Zone SoilFEIASSDSEHPLTEHKARGVADALRRQDMFEEIRVEPRNEE*
Ga0137358_1031208123300012582Vadose Zone SoilGVVMLDDRLFEIASVDPEHPLTQHSAKGVSEALIRYDMFDEINVLPRDEAVESL*
Ga0136616_1049267723300012679Polar Desert SandDDRMFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEITVEPRGEE*
Ga0136611_1083084313300012682Polar Desert SandDGVFEIMSSDPKHPLTEKKARGVAEALRRHDMFDDITIEMREAEAEDELNH*
Ga0137397_1058078323300012685Vadose Zone SoilDERVFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEVRTEPRGDE*
Ga0137359_1076544523300012923Vadose Zone SoilDPEHPLTEHKAKGVAEAVRRQDMFDEVSIEVREDEP*
Ga0137413_1014819423300012924Vadose Zone SoilMLDDRLFEIASVDPEHPLTQHSAKGVSEALIRYDMFDEINVLPRDEAVESL*
Ga0137416_1060628123300012927Vadose Zone SoilASVDPEHPLTDHKAKGVADAVRRQDMFDDVKVEPREEAPVE*
Ga0137416_1202447923300012927Vadose Zone SoilVFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEARDEA*
Ga0137410_1035054113300012944Vadose Zone SoilDPDHPLTEHKAKGVAEALRRQDMFDEVNVELREGEPA*
Ga0137410_1141402623300012944Vadose Zone SoilGVVMLDERVFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVDVEPREEG*
Ga0126375_1005824913300012948Tropical Forest SoilVFEIASTDVDHPLTEHKARGVAEALRRQDMFDAIEIELRDAE*
Ga0164300_1029056633300012951SoilDDRVFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEVRTEPRGE*
Ga0164298_1079591123300012955SoilSTDPDHPLTEHKAKGVAEALRRHDMFEDIRTEPRPEE*
Ga0164299_1017625833300012958SoilGVYMIDERIFEIASDDPNHPLTEHKAKGVAEALRRQDMFDEVNVELREEESV*
Ga0134087_1047148023300012977Grasslands SoilGVLMIDERVFEIASDDPNHPLTEHKAKGVAEAMRRQDMFDEINVELREVESA*
Ga0157371_1030420533300013102Corn RhizosphereDDRLFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA*
Ga0157374_1127551523300013296Miscanthus RhizosphereLDERVFEIASVDPEHPLSEFKAKGVAEALKRQDMFEEIKVEPREEEV*
Ga0157372_1336815723300013307Corn RhizosphereVLLEYGIFEVASTDPDHPLTEHKAKCVADALRRQDMFDEIRTEPRSD*
Ga0157375_1030558333300013308Miscanthus RhizosphereDPEHPLTEHKAQAVADALRRQDMFDEITTEPRSE*
Ga0157375_1058006433300013308Miscanthus RhizosphereVMLDDRIFEIASADAEHPLTEHKAKGVAEALRRQDMFEEVKVEPRGEE*
Ga0157375_1061600133300013308Miscanthus RhizosphereDDRVFEIAAVDPDHPLTEHKAKGVAEALRRQDMFDEVSVEPREEDSI*
Ga0157375_1083111333300013308Miscanthus RhizosphereGSLGVVMLDDRIFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEVKTEPRGE*
Ga0157375_1245120423300013308Miscanthus RhizosphereDERVFEIAAIDPEHPLSEFKAKGVAEALKRQDMFEEIKVEPREEEV*
Ga0163163_1230432423300014325Switchgrass RhizosphereLDDRVFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE*
Ga0157380_1048706333300014326Switchgrass RhizosphereFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEVRTEPREME*
Ga0157377_1057682413300014745Miscanthus RhizosphereNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV*
Ga0157377_1127270423300014745Miscanthus RhizosphereRVFEIASTDADHPLTEHTAKGVAEALRRQDMFDEIRVAPRDEDL*
Ga0157379_1143558113300014968Switchgrass RhizosphereSTDPEHPLTEHTAKGVAEALRRQDMFDEINAEPRGE*
Ga0182007_1042925023300015262RhizosphereFEIASTDPDHPLTEHKAKGVAEALRRQDMFDDIRTEPRGD*
Ga0132258_1089149233300015371Arabidopsis RhizosphereVMLDDRLFEIASVDPEHPLTEHKAKGVAEALRRQDMFEEIKTEPRLDE*
Ga0132258_1200199913300015371Arabidopsis RhizosphereEHPLTEHKAKSVAEALRRQDMFDEVSVEPREEEQS*
Ga0132258_1378685013300015371Arabidopsis RhizosphereDHPLTEHKAKGVAEALRRQDMFDEINVEAREDQQA*
Ga0132258_1380144933300015371Arabidopsis RhizosphereFEIASTDPDHPLNEHTAKGVAEALRRQDMFDEIRTEPRIED*
Ga0132258_1385643933300015371Arabidopsis RhizosphereVDPERPLTEHKAKGVAEALRRQDMFDEVRTEPRDQEGNGNTGS*
Ga0132256_10105395033300015372Arabidopsis RhizosphereMLDDRVFEIAAVDPDHPLTEHKAKGVAEALRRQDMFDEINVEPREEEPA*
Ga0132255_10435409723300015374Arabidopsis RhizosphereLGSLGVVMLDDRLFEIASVDPEHPLTEHKAKGVAEALRRQDMFEEIRTEPRLDEQ*
Ga0134083_1047328213300017659Grasslands SoilSVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEAKEE
Ga0183260_1026784323300017787Polar Desert SandFEIASTDPERPLTEHKSKGVAEALKRHGMFDEISVELRGEEAVGE
Ga0190272_1061209413300018429SoilASADPEHPLTEHKAKGVAEALRRQDMFDEIKVEPRGEEASVE
Ga0190272_1140966013300018429SoilAAVDENHPLTEFKAKGVAEALRRQDMFEEIEVKPRDEETLEST
Ga0066667_1117171123300018433Grasslands SoilGVEMIDDGVFRVASLDPERPLTERKAQGIAEALRRQDMFDEISVEPRARADEDD
Ga0066667_1139509713300018433Grasslands SoilGVVCLDDRVFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEPREEA
Ga0190274_1172182023300018476SoilGSLGVVMLDDGVFEVASTDPDHPLTEHKAKGVAEALRRQDMFEEIKCEPRGE
Ga0190273_1062787823300018920SoilMLDERVFEIASADPEHPLNELKAKGVADALRRQDMFEEIKVEPKEDL
Ga0193735_110333623300020006SoilLGVVMLDERVFEIASTDAEHPLTEHKAKGVAEALRRQDMFDEVDVEPREPTEDL
Ga0193732_104924313300020012SoilLGVVELDERIFEIASVDADHPLTEHKAKGIAEALRRQDMFDEIDVEPREGEPA
Ga0193745_108856913300020059SoilTDEQHPLTELKAKGVAEALKRQDMFDEIEVKPRDEAEEV
Ga0182009_1039667323300021445SoilLDERVFEIASNDPDHPLTEHKAKGVAEALRRHDMFEEIKTEPRPEE
Ga0207710_1070088113300025900Switchgrass RhizosphereLGSLDVYMIDERVFEIASEDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV
Ga0207680_1075303513300025903Switchgrass RhizosphereIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA
Ga0207695_1116124913300025913Corn RhizosphereVMLDDRVFEIASIDPEHPLTEHKAKGVAEALRRQDMFDEIRAEPRSDE
Ga0207663_1102462223300025916Corn, Switchgrass And Miscanthus RhizosphereSLGVVELDERIFEIASVDPDHPLTEHKAKGVAEAMRRQDMFDEISVEPREEDQS
Ga0207681_1085669013300025923Switchgrass RhizosphereTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE
Ga0207650_1062275933300025925Switchgrass RhizosphereDPNHPLTEHKAKGIAEALRRQDMFDEVRTEPRDEE
Ga0207650_1147009413300025925Switchgrass RhizosphereLGVVMLDDRVFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEIRTEPRSDE
Ga0207686_1077270823300025934Miscanthus RhizosphereEIASIDPEHPLTEHKAKGVAEALRRQDMFDEIRAEPRSDE
Ga0207709_1108906813300025935Miscanthus RhizosphereLGSLGVVMLDDRVFEIASTDPDHPLTEHKAKGVADALRRQDMFDDIKTEPRGE
Ga0207669_1139118323300025937Miscanthus RhizosphereEIASTDPEHPLTEHKAKGVAEALRRQDMFDDVKTEPREEVE
Ga0207711_1038529533300025941Switchgrass RhizosphereIASTDADHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE
Ga0207689_1149757123300025942Miscanthus RhizosphereGSLGVVMLDERLFEIASADPEHPLSESKAKGVADALRRQDMFEEIKVEPREEED
Ga0207689_1156361023300025942Miscanthus RhizosphereRMFEIASVDPNHPLTEHKAKGVADALRRQDMFDEVRTEPRDEQ
Ga0207679_1121360313300025945Corn RhizosphereVFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE
Ga0207651_1092654013300025960Switchgrass RhizosphereFEIAAVDPERPLTEHKAKGVAEALRRQDMFDEVNVEPREDAEP
Ga0207640_1079491123300025981Corn RhizosphereRVFEIAAVNPDHPLTEHKAKGVAEALRRQDMFDEISVEAREDESS
Ga0207677_1093742013300026023Miscanthus RhizosphereEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA
Ga0207677_1218421613300026023Miscanthus RhizosphereDRIFEIASVDPNHPLTEHKAKGVAEAVRRQDMFDEVRTEPRDEQ
Ga0207639_1179724513300026041Corn RhizosphereLGSLGVVMLDERVFEIASTDADHPLTEHKAKGVAEALRRQDMFDEVKTEPRGE
Ga0207641_1244906713300026088Switchgrass RhizosphereGVYMLDERVFEISSDDPERPLTEHKAKGIAEALRRQDMFDEINVEPRGEASVTE
Ga0207676_1056848433300026095Switchgrass RhizosphereRPLTEHKAKGIAEALRRQAMFDEVKVEPREAQSDLD
Ga0207674_1205789013300026116Corn RhizosphereVMLDERVFEIASSDPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE
Ga0209153_117307313300026312SoilVMIDERVFEIASVDADHPLTEHQAKGVAEALRRQDMFDEIDVEPRELE
Ga0209153_119947423300026312SoilVFEIASTDPEHPLTEHTAKGVAEALRRQDMFDEIRTEPRGEQ
Ga0209647_130880223300026319Grasslands SoilVVMLDERVFEIASADPEHPLTEHKAKGVAEAVRRQDMFDEVSVELLEEEP
Ga0209387_102972633300027639Agricultural SoilFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGESDVDA
Ga0209461_1009086323300027750AgaveVFEVASTDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRGE
Ga0209177_1014817413300027775Agricultural SoilSLGVVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRQDMFEEIRTEPRSEE
Ga0209481_1074124513300027880Populus RhizosphereSTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE
Ga0209486_1042661613300027886Agricultural SoilVFEIASTDPDHPLSEHTAKGVAAALRRQDMFDEVRTEPRGD
Ga0207428_1023201313300027907Populus RhizosphereSTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPREME
Ga0209382_1165572523300027909Populus RhizosphereIASTDPEHPLTEHTAKGVAEALRRQDMFDEIRTEPRGEQ
Ga0268265_1054877233300028380Switchgrass RhizosphereEVASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGE
Ga0268242_102105313300030513SoilIASIDPEHPLTEHKAKGVAEALKRQDMFDEISVEPRYEEVMSNE
Ga0310888_1064616013300031538SoilDDRVFEIASTDPEHPLTEHTAKGVAEALRRQDMFDEITTEPRAE
Ga0310813_1138260613300031716SoilDPDHPLTEHKAKGVAEALRRHDMFEEIKTEPRPEE
Ga0307469_1149827113300031720Hardwood Forest SoilDAEHPLTEHKAKGVAEALRRQDMFDEIDVEPRETE
Ga0307469_1225059123300031720Hardwood Forest SoilEHPLTEHKAKGVAEALRRQDMFDEVKVEPRAEDEAATSEP
Ga0307475_1136190813300031754Hardwood Forest SoilGVVMLDERIFEIASSDPEHPLTEHKAKGVAEALRRQDMFDEVRTELRGDE
Ga0307416_10288944823300032002RhizosphereFEIASSDPEHPLTEHKARGVADALRRQDMFDEISVEPREEGEEV
Ga0307411_1050881613300032005RhizosphereGVVMLDDRVFEIASADPEHPLTEHKAQAVAEALRRQDMFDEIRTEPRSDE
Ga0310895_1030214113300032122SoilMLDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPREME
Ga0334930_038976_8_1723300034005Sub-Biocrust SoilMLDDELFEIASTDPEHPLTEHKAKGIAEALRRHDMFDEISVEPREAETSADEPV
Ga0334930_090941_9_1703300034005Sub-Biocrust SoilMLDDGVFEIASTDPEHPLTEHKARGVAAALRRHDMFDEVSVEPRELADEDAAE
Ga0334923_130233_385_5193300034376Hypolithic BiocrustIASVDPEHPLTEHKAKGIAEALRRQDMFDEVTVEPRDDEESTDE
Ga0334931_044169_823_9783300034377Sub-Biocrust SoilMLDERLFEIASSDPEHPLTEHQAKGVADALRRQDMFDEISVEPREEVMSDE
Ga0334931_105517_491_6583300034377Sub-Biocrust SoilLDEGVFEIASTDPEHPLTEHKARVVGDALRRQGMFDDIAVEPRRAGDDEAAEVAE
Ga0334935_004000_1_1503300034781BiocrustDDRLFEIASADPERPLTERRARGVADTLRLYDMFDEISVEPREDEEEFD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.