| Basic Information | |
|---|---|
| Family ID | F022010 |
| Family Type | Metagenome |
| Number of Sequences | 216 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRAEPRSE |
| Number of Associated Samples | 171 |
| Number of Associated Scaffolds | 216 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.69 % |
| % of genes from short scaffolds (< 2000 bps) | 95.37 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.593 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.648 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.056 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.648 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 216 Family Scaffolds |
|---|---|---|
| PF01661 | Macro | 66.20 |
| PF11897 | DUF3417 | 12.50 |
| PF00215 | OMPdecase | 0.46 |
| PF01584 | CheW | 0.46 |
| PF14684 | Tricorn_C1 | 0.46 |
| PF00108 | Thiolase_N | 0.46 |
| PF00571 | CBS | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
|---|---|---|---|
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 66.20 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.59 % |
| Unclassified | root | N/A | 7.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104929045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300000550|F24TB_12233507 | Not Available | 588 | Open in IMG/M |
| 3300000559|F14TC_101830265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
| 3300000890|JGI11643J12802_12051260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300002503|C687J35164_10158563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300003319|soilL2_10119779 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300003996|Ga0055467_10271357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300004463|Ga0063356_104974451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 571 | Open in IMG/M |
| 3300004480|Ga0062592_101424623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300004480|Ga0062592_102535223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300004643|Ga0062591_100626121 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005176|Ga0066679_10899486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300005184|Ga0066671_10031487 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300005293|Ga0065715_10186054 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300005293|Ga0065715_11116196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300005328|Ga0070676_11536665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 513 | Open in IMG/M |
| 3300005332|Ga0066388_101722595 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005334|Ga0068869_100877815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005334|Ga0068869_100944603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300005336|Ga0070680_100594738 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005353|Ga0070669_101087203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300005364|Ga0070673_100111893 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300005406|Ga0070703_10403882 | Not Available | 595 | Open in IMG/M |
| 3300005440|Ga0070705_101485239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300005445|Ga0070708_100831057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300005446|Ga0066686_10286859 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300005456|Ga0070678_101206876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300005518|Ga0070699_101937851 | Not Available | 539 | Open in IMG/M |
| 3300005543|Ga0070672_100201913 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300005543|Ga0070672_101470124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300005544|Ga0070686_100410467 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300005544|Ga0070686_101617191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300005545|Ga0070695_101404538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300005545|Ga0070695_101835824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 509 | Open in IMG/M |
| 3300005546|Ga0070696_100639517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
| 3300005549|Ga0070704_100845503 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005558|Ga0066698_10426453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300005564|Ga0070664_101894333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005577|Ga0068857_102118461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300005578|Ga0068854_101274141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300005615|Ga0070702_100915320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300005616|Ga0068852_101243801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300005617|Ga0068859_100258392 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300005618|Ga0068864_101004097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300005764|Ga0066903_108453371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005841|Ga0068863_102623135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 513 | Open in IMG/M |
| 3300005843|Ga0068860_100328467 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300005843|Ga0068860_100635506 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300006046|Ga0066652_100578719 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300006046|Ga0066652_100721524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300006196|Ga0075422_10590783 | Not Available | 513 | Open in IMG/M |
| 3300006755|Ga0079222_10444164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300006794|Ga0066658_10735798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300006797|Ga0066659_10441200 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300006847|Ga0075431_100894941 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300006852|Ga0075433_10164755 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300006852|Ga0075433_11629668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 556 | Open in IMG/M |
| 3300006853|Ga0075420_100383541 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300006894|Ga0079215_10000466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9519 | Open in IMG/M |
| 3300006894|Ga0079215_10147227 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300006904|Ga0075424_101070106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300006904|Ga0075424_101603425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300006931|Ga0097620_102702132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300006969|Ga0075419_10394101 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300007258|Ga0099793_10621068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300009094|Ga0111539_10043876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 5359 | Open in IMG/M |
| 3300009094|Ga0111539_11083965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300009094|Ga0111539_12990393 | Not Available | 546 | Open in IMG/M |
| 3300009098|Ga0105245_11147534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300009100|Ga0075418_10360523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1552 | Open in IMG/M |
| 3300009101|Ga0105247_10787574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300009137|Ga0066709_104155865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 527 | Open in IMG/M |
| 3300009143|Ga0099792_10020633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2932 | Open in IMG/M |
| 3300009147|Ga0114129_12549097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300009147|Ga0114129_12729826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 588 | Open in IMG/M |
| 3300009147|Ga0114129_13376521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 514 | Open in IMG/M |
| 3300009162|Ga0075423_11344971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 764 | Open in IMG/M |
| 3300009174|Ga0105241_10227107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1572 | Open in IMG/M |
| 3300009174|Ga0105241_10613380 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300009177|Ga0105248_12846735 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009553|Ga0105249_11129020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300009789|Ga0126307_10763999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300010039|Ga0126309_11183226 | Not Available | 524 | Open in IMG/M |
| 3300010040|Ga0126308_11340481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 508 | Open in IMG/M |
| 3300010041|Ga0126312_10790321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300010046|Ga0126384_11051436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300010047|Ga0126382_11831016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300010359|Ga0126376_10717800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300010366|Ga0126379_11436721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300010375|Ga0105239_11798647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300010397|Ga0134124_10526702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1147 | Open in IMG/M |
| 3300010397|Ga0134124_12275277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300010397|Ga0134124_12875143 | Not Available | 525 | Open in IMG/M |
| 3300010398|Ga0126383_10085637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2767 | Open in IMG/M |
| 3300010399|Ga0134127_12170594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300010399|Ga0134127_12954004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300010400|Ga0134122_10307846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1363 | Open in IMG/M |
| 3300010400|Ga0134122_10833004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300010400|Ga0134122_11217225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 755 | Open in IMG/M |
| 3300010401|Ga0134121_10223131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1638 | Open in IMG/M |
| 3300010401|Ga0134121_11763864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300010403|Ga0134123_11139350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300010403|Ga0134123_11646963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300010403|Ga0134123_12855673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300011270|Ga0137391_11554936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300011993|Ga0120182_1021630 | Not Available | 582 | Open in IMG/M |
| 3300012045|Ga0136623_10491807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012199|Ga0137383_10022156 | All Organisms → cellular organisms → Bacteria | 4407 | Open in IMG/M |
| 3300012202|Ga0137363_11729612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300012205|Ga0137362_10621099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300012205|Ga0137362_10687796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300012207|Ga0137381_11499784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 566 | Open in IMG/M |
| 3300012208|Ga0137376_11650503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300012209|Ga0137379_11035100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300012210|Ga0137378_10584941 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300012354|Ga0137366_11205869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300012355|Ga0137369_10455389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300012357|Ga0137384_11333267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012530|Ga0136635_10091326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300012532|Ga0137373_10626417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300012582|Ga0137358_10312081 | Not Available | 1067 | Open in IMG/M |
| 3300012679|Ga0136616_10492677 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012682|Ga0136611_10830843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300012685|Ga0137397_10580783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300012923|Ga0137359_10765445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300012924|Ga0137413_10148194 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300012927|Ga0137416_10606281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300012927|Ga0137416_12024479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300012944|Ga0137410_10350541 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300012944|Ga0137410_11414026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300012948|Ga0126375_10058249 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300012951|Ga0164300_10290566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300012955|Ga0164298_10795911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012958|Ga0164299_10176258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300012977|Ga0134087_10471480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300013102|Ga0157371_10304205 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300013296|Ga0157374_11275515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300013307|Ga0157372_13368157 | Not Available | 509 | Open in IMG/M |
| 3300013308|Ga0157375_10305583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1755 | Open in IMG/M |
| 3300013308|Ga0157375_10580064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1282 | Open in IMG/M |
| 3300013308|Ga0157375_10616001 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300013308|Ga0157375_10831113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300013308|Ga0157375_12451204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300014325|Ga0163163_12304324 | Not Available | 597 | Open in IMG/M |
| 3300014326|Ga0157380_10487063 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300014745|Ga0157377_10576824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300014745|Ga0157377_11272704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300014968|Ga0157379_11435581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300015262|Ga0182007_10429250 | Not Available | 507 | Open in IMG/M |
| 3300015371|Ga0132258_10891492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2245 | Open in IMG/M |
| 3300015371|Ga0132258_12001999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300015371|Ga0132258_13786850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300015371|Ga0132258_13801449 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300015371|Ga0132258_13856439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1020 | Open in IMG/M |
| 3300015372|Ga0132256_101053950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300015374|Ga0132255_104354097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 600 | Open in IMG/M |
| 3300017659|Ga0134083_10473282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300017787|Ga0183260_10267843 | Not Available | 1173 | Open in IMG/M |
| 3300018429|Ga0190272_10612094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300018429|Ga0190272_11409660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300018433|Ga0066667_11171711 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300018433|Ga0066667_11395097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 615 | Open in IMG/M |
| 3300018476|Ga0190274_11721820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300018920|Ga0190273_10627878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300020006|Ga0193735_1103336 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300020012|Ga0193732_1049243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300020059|Ga0193745_1088569 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300021445|Ga0182009_10396673 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300025900|Ga0207710_10700881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300025903|Ga0207680_10753035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300025913|Ga0207695_11161249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300025916|Ga0207663_11024622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300025923|Ga0207681_10856690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300025925|Ga0207650_10622759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300025925|Ga0207650_11470094 | Not Available | 579 | Open in IMG/M |
| 3300025934|Ga0207686_10772708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300025935|Ga0207709_11089068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300025937|Ga0207669_11391183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300025941|Ga0207711_10385295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1301 | Open in IMG/M |
| 3300025942|Ga0207689_11497571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300025942|Ga0207689_11563610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 549 | Open in IMG/M |
| 3300025945|Ga0207679_11213603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300025960|Ga0207651_10926540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300025981|Ga0207640_10794911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300026023|Ga0207677_10937420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300026023|Ga0207677_12184216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 515 | Open in IMG/M |
| 3300026041|Ga0207639_11797245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 574 | Open in IMG/M |
| 3300026088|Ga0207641_12449067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300026095|Ga0207676_10568484 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300026116|Ga0207674_12057890 | Not Available | 535 | Open in IMG/M |
| 3300026312|Ga0209153_1173073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300026312|Ga0209153_1199474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 704 | Open in IMG/M |
| 3300026319|Ga0209647_1308802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300027639|Ga0209387_1029726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1109 | Open in IMG/M |
| 3300027750|Ga0209461_10090863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300027775|Ga0209177_10148174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300027880|Ga0209481_10741245 | Not Available | 511 | Open in IMG/M |
| 3300027886|Ga0209486_10426616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300027907|Ga0207428_10232013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1381 | Open in IMG/M |
| 3300027909|Ga0209382_11655725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300028380|Ga0268265_10548772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1097 | Open in IMG/M |
| 3300030513|Ga0268242_1021053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1100 | Open in IMG/M |
| 3300031538|Ga0310888_10646160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300031716|Ga0310813_11382606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300031720|Ga0307469_11498271 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Yanofskybacteria → Candidatus Yanofskybacteria bacterium RIFCSPLOWO2_01_FULL_49_25 | 646 | Open in IMG/M |
| 3300031720|Ga0307469_12250591 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031754|Ga0307475_11361908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300032002|Ga0307416_102889448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 575 | Open in IMG/M |
| 3300032005|Ga0307411_10508816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300032122|Ga0310895_10302141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300034005|Ga0334930_038976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300034005|Ga0334930_090941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300034376|Ga0334923_130233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300034377|Ga0334931_044169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300034377|Ga0334931_105517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Microvirgula | 660 | Open in IMG/M |
| 3300034781|Ga0334935_004000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4186 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.46% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.46% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.46% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.46% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.46% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.46% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.46% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300034005 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNS | Environmental | Open in IMG/M |
| 3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| 3300034781 | Biocrust microbial communities from Mojave Desert, California, United States - 31SMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1049290452 | 3300000364 | Soil | VDGDHPLTEHKAKSVAEALRRQDMFDEVNVEAREDEQA* |
| F24TB_122335072 | 3300000550 | Soil | DPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRDGE* |
| F14TC_1018302651 | 3300000559 | Soil | VMLDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPRETE* |
| JGI11643J12802_120512603 | 3300000890 | Soil | GIVMIDDRVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEVKTEPRAEE* |
| C687J35164_101585631 | 3300002503 | Soil | IASTDPDHPLTEHKAKGVAEALRRQDMFDEIRVEPREDE* |
| soilL2_101197793 | 3300003319 | Sugarcane Root And Bulk Soil | VFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRNND* |
| Ga0055467_102713572 | 3300003996 | Natural And Restored Wetlands | LDDRLFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGEN* |
| Ga0063356_1049744512 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VMLDDGVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEIRAEPRPEEDL* |
| Ga0062592_1014246231 | 3300004480 | Soil | GVVMLDDRIFEIASADAEHPLTEHKAKGVAEALRRQDMFEEVKVEPRGEE* |
| Ga0062592_1025352232 | 3300004480 | Soil | VVMLDDRVFEIASTDPDHPLTEHTANAVAGALRRQDMFDEIKTEPRPEE* |
| Ga0062591_1006261213 | 3300004643 | Soil | VVMLDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPRETE* |
| Ga0066679_108994861 | 3300005176 | Soil | EIASVDPEHPLTEHKAKGVAEALRRQDMFDEVSVEPREEA* |
| Ga0066671_100314871 | 3300005184 | Soil | EIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRGEQ* |
| Ga0065715_101860541 | 3300005293 | Miscanthus Rhizosphere | ASEDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV* |
| Ga0065715_111161961 | 3300005293 | Miscanthus Rhizosphere | FEIASTDPDHPLTEHKAKGVADALRRQDMFDEVRTEPRGE* |
| Ga0070676_115366652 | 3300005328 | Miscanthus Rhizosphere | GVIMLDERVFEIASADPGHPLTEHKAKGVAEALRRQDMFDEIRVEPRDVDEV* |
| Ga0066388_1017225951 | 3300005332 | Tropical Forest Soil | TLGSLGVVMLDERVFEIASTDPDHPLTEHKAQAVAEALRRQDMFDEISTEPRSE* |
| Ga0068869_1008778152 | 3300005334 | Miscanthus Rhizosphere | RMFEIASVDPNHPLTEHKAKGVADALRRQDMFDEVRTEPRDEQ* |
| Ga0068869_1009446031 | 3300005334 | Miscanthus Rhizosphere | IGIVMIDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE* |
| Ga0070680_1005947381 | 3300005336 | Corn Rhizosphere | VYMIDERVFEIASEDPERPLTEHKAKGVAEALRRQDMFDEVNVEAREEAT* |
| Ga0070669_1010872032 | 3300005353 | Switchgrass Rhizosphere | DDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEVRTEPREME* |
| Ga0070673_1001118931 | 3300005364 | Switchgrass Rhizosphere | SLDVYMIDERVFEIASEDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV* |
| Ga0070703_104038822 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DRVFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEIRTEPRSDE* |
| Ga0070705_1014852391 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IVMLDDGVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEIRPEPRDEDV* |
| Ga0070708_1008310572 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VCLDERMFEIASVDPDHPLTEHKAKGVAEALRRQDMFDEIKVETREE* |
| Ga0066686_102868593 | 3300005446 | Soil | ERVFEIASVDPDHPLTEHKAKGVAEALRRQDMFDEINIEPRDKT* |
| Ga0070678_1012068762 | 3300005456 | Miscanthus Rhizosphere | GIVMIDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE* |
| Ga0070699_1019378511 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FEIASADPDHPLTEHKAKGVAEALRRQDMFDEVDVEPREQA* |
| Ga0070672_1002019133 | 3300005543 | Miscanthus Rhizosphere | DDRLFEIASVDPEHPLTEHKAKGVAEALRRQDMFEEVRAEPRSDE* |
| Ga0070672_1014701241 | 3300005543 | Miscanthus Rhizosphere | VVMLDDRLFEIASTDPDHPLTEHKAKGVAEALRRQDMFDDIKTEPRGE* |
| Ga0070686_1004104671 | 3300005544 | Switchgrass Rhizosphere | VFEIASDDADHPLTEHKAKGVAEALRRQAMFDEVSVEPRAEESAAD* |
| Ga0070686_1016171912 | 3300005544 | Switchgrass Rhizosphere | GSLGVYMIDDRVFEIASDDSNHPLTEHKAKGVAEALRRQDMFDEINVELREEPSE* |
| Ga0070695_1014045382 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIDPEHPLSEFKAKGVAEALKRQDMFEEIKVEPREEDA* |
| Ga0070695_1018358242 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SLGVVMLDDRVFEIASSDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE* |
| Ga0070696_1006395171 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | SADPEHPLTEHKAKGVAEALRRQDMFDEIRVEPRGESADEI* |
| Ga0070704_1008455031 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RVFEIASTDPDHPLTEHKAKGVADALRRQDMFDDIKTEPRGE* |
| Ga0066698_104264532 | 3300005558 | Soil | FEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEAKEE* |
| Ga0070664_1018943332 | 3300005564 | Corn Rhizosphere | LTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA* |
| Ga0068857_1021184612 | 3300005577 | Corn Rhizosphere | FEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIKIEPRAEE* |
| Ga0068854_1012741411 | 3300005578 | Corn Rhizosphere | TDPDHPLTEHKAKGVAEALRRQDMFDDIKTEPRGE* |
| Ga0070702_1009153202 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAVNPDHPLTEHKAKGVAEALRRQDMFDEISVEAREEESS* |
| Ga0068852_1012438011 | 3300005616 | Corn Rhizosphere | EIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE* |
| Ga0068859_1002583921 | 3300005617 | Switchgrass Rhizosphere | IASTDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRGE* |
| Ga0068864_1010040971 | 3300005618 | Switchgrass Rhizosphere | GSLGVVMLDDRVFEIASIDPEHPLTEHKAKGVAEALRRQDMFDEIRAEPRSDE* |
| Ga0066903_1084533711 | 3300005764 | Tropical Forest Soil | ERVFEIASDDPNHPLTEHKAKGVAEALRRQDMFDQIDVEPREGEP* |
| Ga0068863_1026231352 | 3300005841 | Switchgrass Rhizosphere | GQLGVVMLDDRVFEIASTDPEHPLTAHTAKGVAEALRRQDMFDEITTEPRGE* |
| Ga0068860_1003284671 | 3300005843 | Switchgrass Rhizosphere | VVMLDDRVFEIASTDADHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE* |
| Ga0068860_1006355063 | 3300005843 | Switchgrass Rhizosphere | FEIASDDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV* |
| Ga0066652_1005787191 | 3300006046 | Soil | STDADHPLTEHKAKGVAEALRRQDMFDEIDVEPREPA* |
| Ga0066652_1007215243 | 3300006046 | Soil | EHPLTEHKAKRVAEALRLQDMFDEIDVEPREEEPA* |
| Ga0075422_105907831 | 3300006196 | Populus Rhizosphere | VMLDDRVFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE* |
| Ga0079222_104441641 | 3300006755 | Agricultural Soil | DDGVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEIRPEPRDEDV* |
| Ga0066658_107357982 | 3300006794 | Soil | MFEIASVDPDHPLTEHKAKGVAEALRRQDMFDEINVELRDGEPA* |
| Ga0066659_104412001 | 3300006797 | Soil | MIDERVFEIASGDPNHPLTEHKAKGVAEALRRQDMFDEIDVELREVG* |
| Ga0075431_1008949413 | 3300006847 | Populus Rhizosphere | FEIASTDPEHPLTEHTAKGVAEALRRQDMFDEIRTEPRGEQ* |
| Ga0075433_101647553 | 3300006852 | Populus Rhizosphere | VFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRAEPRSE* |
| Ga0075433_116296682 | 3300006852 | Populus Rhizosphere | IDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE* |
| Ga0075420_1003835411 | 3300006853 | Populus Rhizosphere | STDPDHPLTEHTAKGVAEALRRQDMFDEITTEPREEA* |
| Ga0079215_100004667 | 3300006894 | Agricultural Soil | ASTDADHPLTEHTAKGVAEALRRQDMFDEIRTEPREEA* |
| Ga0079215_101472271 | 3300006894 | Agricultural Soil | DDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGESDVDA* |
| Ga0075424_1010701063 | 3300006904 | Populus Rhizosphere | RVFEIASNDADHPLTEHKAKGVAEALRRQDMFDQIDIQPFEEG* |
| Ga0075424_1016034251 | 3300006904 | Populus Rhizosphere | MLDECVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRAEPRSE* |
| Ga0097620_1027021321 | 3300006931 | Switchgrass Rhizosphere | TEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA* |
| Ga0075419_103941013 | 3300006969 | Populus Rhizosphere | IVMIDDRVFEIASTDPDHPLTEHTAKGVAKALRRQDMFDEITTEPRAEDL* |
| Ga0099793_106210681 | 3300007258 | Vadose Zone Soil | EHPLTEHKAKGVAEAVRRQDMFDEVSIELREEES* |
| Ga0111539_100438765 | 3300009094 | Populus Rhizosphere | GIVMIDDRVFEIASTDPDHPLTEHTAKGVAEALRRQDMFDEMSAEPRDAGL* |
| Ga0111539_110839651 | 3300009094 | Populus Rhizosphere | RLGIVMIDEGVFEIASTDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE* |
| Ga0111539_129903932 | 3300009094 | Populus Rhizosphere | DDYVFEIASTDPEHPLTEHKANGVAEALRRQDMFDEIRIEPRSEQ* |
| Ga0105245_111475341 | 3300009098 | Miscanthus Rhizosphere | TDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRGD* |
| Ga0075418_103605231 | 3300009100 | Populus Rhizosphere | EIASTDPEHPLTEHTARGVAEALRRQDMFEEIRTEPRAEE* |
| Ga0105247_107875742 | 3300009101 | Switchgrass Rhizosphere | DERVFEISSDDPERPLTEHKAKGVAEALRRQDMFDEINVEPREEASVTD* |
| Ga0066709_1041558652 | 3300009137 | Grasslands Soil | MIDDRVFEIASVDADHPLTEHKAKGVAEALRRQDMFDEIDVELREGA* |
| Ga0099792_100206333 | 3300009143 | Vadose Zone Soil | FEIASADPEHPLTEHKAKGVAEAVRRQDMFDEVSIEVREEES* |
| Ga0114129_125490971 | 3300009147 | Populus Rhizosphere | TDPDHPLTEHTAKGVAEALRRQDMFDEITPEPRPEE* |
| Ga0114129_127298262 | 3300009147 | Populus Rhizosphere | SLGVVMLDDRLFEIASIDPEHPLTEHKAKGVAEALRRQDMFEEIRAEPRTDE* |
| Ga0114129_133765212 | 3300009147 | Populus Rhizosphere | LGVVMLDERVFEIASADPEHPLTEHKAKGVADALRRQDMFDEIKVEPRDEDEA* |
| Ga0075423_113449711 | 3300009162 | Populus Rhizosphere | LGSLGVVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRQDMFDEIRTEPRIED* |
| Ga0105241_102271071 | 3300009174 | Corn Rhizosphere | VVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRMDMFDDIRTEPRVEE* |
| Ga0105241_106133801 | 3300009174 | Corn Rhizosphere | SLGVVMLDDRVFEIASTNPDHPLTEHKAKGVAEALRRQDMFDDIKTEPRGE* |
| Ga0105248_128467353 | 3300009177 | Switchgrass Rhizosphere | TEHKAKGIAEALRRQDMFDEVKVEPREEEGVELESN* |
| Ga0105249_111290203 | 3300009553 | Switchgrass Rhizosphere | DRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPREME* |
| Ga0126307_107639992 | 3300009789 | Serpentine Soil | LDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGE* |
| Ga0126309_111832261 | 3300010039 | Serpentine Soil | EIASTDPEHPLTEHKAKGVAEALRRQDMFEEVSVEPRDPDEVDAEP* |
| Ga0126308_113404812 | 3300010040 | Serpentine Soil | FEIVSIDPEHPLTEHKAKGVADALRRQDMFDEVEVEPRAEDDDEEESD* |
| Ga0126312_107903212 | 3300010041 | Serpentine Soil | FEVASTDPDHPLTEHKAKGVADALRRQDMFDEIRTEPRGE* |
| Ga0126384_110514362 | 3300010046 | Tropical Forest Soil | PDHPLTEHKAKGVAEALRRQDMFDQIDVEPREGES* |
| Ga0126382_118310162 | 3300010047 | Tropical Forest Soil | RVFEIASDDPNHPLTEHKAKGVAEALRRQDMFDQIDVEPREGEP* |
| Ga0126376_107178001 | 3300010359 | Tropical Forest Soil | LGVAMLDDRVFEIASIDPEHPLTEHKAKGVAEALRRQDMFDDIRAEPRSDE* |
| Ga0126379_114367211 | 3300010366 | Tropical Forest Soil | DRVFEISSDDPNHPLTEHKAKGVAEALRRQDMFDEIKVEPREEDAQ* |
| Ga0105239_117986471 | 3300010375 | Corn Rhizosphere | RVFEIASADPEQPLTEHKAQAVAAALRRQDMFDEITTEPRSE* |
| Ga0134124_105267021 | 3300010397 | Terrestrial Soil | STDPEHPLTEHKAQAVAEALRRQDMFDEIATEPRSE* |
| Ga0134124_122752772 | 3300010397 | Terrestrial Soil | TDPDHPLTEHKAKGVAEALRRQDMFDEVKTEPRSE* |
| Ga0134124_128751432 | 3300010397 | Terrestrial Soil | RVFEIASADPNHPLTEHKAKGVAEALRRQDMFDEVRTEPRVE* |
| Ga0126383_100856374 | 3300010398 | Tropical Forest Soil | GSLGVYMIDERVFEIASDDPDHPLTEHKAKSVAEALRRQDMFDEINVEPREEPQA* |
| Ga0134127_121705941 | 3300010399 | Terrestrial Soil | ASNDPEHPLTQHTAKGVAEALRRQDMFDEITAEPRGD* |
| Ga0134127_129540041 | 3300010399 | Terrestrial Soil | SLEVVMLDDGLFEIASIDPEHPLTEHKAKGVAEALRRQDMFEEIRTEPRPDE* |
| Ga0134122_103078461 | 3300010400 | Terrestrial Soil | GVVMLDDRIFEIASADPEHPLTEHKAKGVAEALRRQDMFDEIRTEARSNE* |
| Ga0134122_108330041 | 3300010400 | Terrestrial Soil | DRVFEIASVYPDRPLTEHKAKGVAESMRRQDMFDEVNVEPREEEQV* |
| Ga0134122_112172251 | 3300010400 | Terrestrial Soil | SLGVVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRQDMFDEIRTEPRIED* |
| Ga0134121_102231311 | 3300010401 | Terrestrial Soil | FEISSDDPERPLTEHKAKGVAEALRRQDMFDEINVEPREETSVTD* |
| Ga0134121_117638642 | 3300010401 | Terrestrial Soil | IASTDPDHPLNEHTAKGVAEALRRQDMFDEIHTEPRSED* |
| Ga0134123_111393501 | 3300010403 | Terrestrial Soil | SVDPEHPLTEHKAKGVAEALRRQDMFEEIRTEPRVDE* |
| Ga0134123_116469632 | 3300010403 | Terrestrial Soil | FEIASADPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE* |
| Ga0134123_128556732 | 3300010403 | Terrestrial Soil | EISSDDPTHPLTEHKAKGIAEALRRQDMFDEVNVEPREEEFQ* |
| Ga0137391_115549361 | 3300011270 | Vadose Zone Soil | SADPEHPLSEGKAKGVADALRRQDMFEEIKVEPRDEAGLEANL* |
| Ga0120182_10216301 | 3300011993 | Terrestrial | MLDDRIFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSEQ* |
| Ga0136623_104918071 | 3300012045 | Polar Desert Sand | LGVVMLKDRVFEIASADPEHPLTEHKAKGVAEALRRQGMFDEVKVEPRREE* |
| Ga0137383_100221565 | 3300012199 | Vadose Zone Soil | PEHPLTEHKAKGVADAVRRQDMFDEVKVEPREEAPVE* |
| Ga0137363_117296121 | 3300012202 | Vadose Zone Soil | IASVDPDHPLTEHKAKGVAEALRRQDMFDEINVELREGEPA* |
| Ga0137362_106210991 | 3300012205 | Vadose Zone Soil | ASVDPEHPLTEHKAKGVADALRRQDMFDEINVEPRGEDPA* |
| Ga0137362_106877962 | 3300012205 | Vadose Zone Soil | VVMLDERVFEIASADPEHPLTEHKAKGVAEAVRRQDMFDEVSVELREEES* |
| Ga0137381_114997842 | 3300012207 | Vadose Zone Soil | VDPDHPLTEHKAKGVAEALRRQDMFDEINIEPRDKA* |
| Ga0137376_116505032 | 3300012208 | Vadose Zone Soil | ERVFEVASDDPNHPLTEHKAKGVAEALRRQDMFDEIDVELREVG* |
| Ga0137379_110351001 | 3300012209 | Vadose Zone Soil | SDDPDHPLTEHKAKGVAEALRRQDMFDEISVEPREEELA* |
| Ga0137378_105849411 | 3300012210 | Vadose Zone Soil | VFEIASTDSEHPLTEHKAKGVADALRRQDMFDEIRVEPRDGE* |
| Ga0137366_112058692 | 3300012354 | Vadose Zone Soil | EIASADPDHPLTEHKAKGVAEALRRQDMFDEIEVEPREEALP* |
| Ga0137369_104553891 | 3300012355 | Vadose Zone Soil | RLFEIASADADHPLTELKAKGVAEALRRQDMCDEINIKPRD* |
| Ga0137384_113332671 | 3300012357 | Vadose Zone Soil | IASDDPNHPLTEHKAKGVAEALRRQDMFDEIDVELREVG* |
| Ga0136635_100913262 | 3300012530 | Polar Desert Sand | GVVMLYDRVFEIASADPEHPLTEHKAKGVAEALRRQDMFDEIKVEPRGEE* |
| Ga0137373_106264171 | 3300012532 | Vadose Zone Soil | FEIASSDSEHPLTEHKARGVADALRRQDMFEEIRVEPRNEE* |
| Ga0137358_103120812 | 3300012582 | Vadose Zone Soil | GVVMLDDRLFEIASVDPEHPLTQHSAKGVSEALIRYDMFDEINVLPRDEAVESL* |
| Ga0136616_104926772 | 3300012679 | Polar Desert Sand | DDRMFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEITVEPRGEE* |
| Ga0136611_108308431 | 3300012682 | Polar Desert Sand | DGVFEIMSSDPKHPLTEKKARGVAEALRRHDMFDDITIEMREAEAEDELNH* |
| Ga0137397_105807832 | 3300012685 | Vadose Zone Soil | DERVFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEVRTEPRGDE* |
| Ga0137359_107654452 | 3300012923 | Vadose Zone Soil | DPEHPLTEHKAKGVAEAVRRQDMFDEVSIEVREDEP* |
| Ga0137413_101481942 | 3300012924 | Vadose Zone Soil | MLDDRLFEIASVDPEHPLTQHSAKGVSEALIRYDMFDEINVLPRDEAVESL* |
| Ga0137416_106062812 | 3300012927 | Vadose Zone Soil | ASVDPEHPLTDHKAKGVADAVRRQDMFDDVKVEPREEAPVE* |
| Ga0137416_120244792 | 3300012927 | Vadose Zone Soil | VFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEARDEA* |
| Ga0137410_103505411 | 3300012944 | Vadose Zone Soil | DPDHPLTEHKAKGVAEALRRQDMFDEVNVELREGEPA* |
| Ga0137410_114140262 | 3300012944 | Vadose Zone Soil | GVVMLDERVFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVDVEPREEG* |
| Ga0126375_100582491 | 3300012948 | Tropical Forest Soil | VFEIASTDVDHPLTEHKARGVAEALRRQDMFDAIEIELRDAE* |
| Ga0164300_102905663 | 3300012951 | Soil | DDRVFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEVRTEPRGE* |
| Ga0164298_107959112 | 3300012955 | Soil | STDPDHPLTEHKAKGVAEALRRHDMFEDIRTEPRPEE* |
| Ga0164299_101762583 | 3300012958 | Soil | GVYMIDERIFEIASDDPNHPLTEHKAKGVAEALRRQDMFDEVNVELREEESV* |
| Ga0134087_104714802 | 3300012977 | Grasslands Soil | GVLMIDERVFEIASDDPNHPLTEHKAKGVAEAMRRQDMFDEINVELREVESA* |
| Ga0157371_103042053 | 3300013102 | Corn Rhizosphere | DDRLFEIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA* |
| Ga0157374_112755152 | 3300013296 | Miscanthus Rhizosphere | LDERVFEIASVDPEHPLSEFKAKGVAEALKRQDMFEEIKVEPREEEV* |
| Ga0157372_133681572 | 3300013307 | Corn Rhizosphere | VLLEYGIFEVASTDPDHPLTEHKAKCVADALRRQDMFDEIRTEPRSD* |
| Ga0157375_103055833 | 3300013308 | Miscanthus Rhizosphere | DPEHPLTEHKAQAVADALRRQDMFDEITTEPRSE* |
| Ga0157375_105800643 | 3300013308 | Miscanthus Rhizosphere | VMLDDRIFEIASADAEHPLTEHKAKGVAEALRRQDMFEEVKVEPRGEE* |
| Ga0157375_106160013 | 3300013308 | Miscanthus Rhizosphere | DDRVFEIAAVDPDHPLTEHKAKGVAEALRRQDMFDEVSVEPREEDSI* |
| Ga0157375_108311133 | 3300013308 | Miscanthus Rhizosphere | GSLGVVMLDDRIFEIASTDPDHPLTEHKAKGVAEALRRQDMFDEVKTEPRGE* |
| Ga0157375_124512042 | 3300013308 | Miscanthus Rhizosphere | DERVFEIAAIDPEHPLSEFKAKGVAEALKRQDMFEEIKVEPREEEV* |
| Ga0163163_123043242 | 3300014325 | Switchgrass Rhizosphere | LDDRVFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE* |
| Ga0157380_104870633 | 3300014326 | Switchgrass Rhizosphere | FEIASTDPDHPLTEHKAKGVAEALRRQDMFEEVRTEPREME* |
| Ga0157377_105768241 | 3300014745 | Miscanthus Rhizosphere | NHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV* |
| Ga0157377_112727042 | 3300014745 | Miscanthus Rhizosphere | RVFEIASTDADHPLTEHTAKGVAEALRRQDMFDEIRVAPRDEDL* |
| Ga0157379_114355811 | 3300014968 | Switchgrass Rhizosphere | STDPEHPLTEHTAKGVAEALRRQDMFDEINAEPRGE* |
| Ga0182007_104292502 | 3300015262 | Rhizosphere | FEIASTDPDHPLTEHKAKGVAEALRRQDMFDDIRTEPRGD* |
| Ga0132258_108914923 | 3300015371 | Arabidopsis Rhizosphere | VMLDDRLFEIASVDPEHPLTEHKAKGVAEALRRQDMFEEIKTEPRLDE* |
| Ga0132258_120019991 | 3300015371 | Arabidopsis Rhizosphere | EHPLTEHKAKSVAEALRRQDMFDEVSVEPREEEQS* |
| Ga0132258_137868501 | 3300015371 | Arabidopsis Rhizosphere | DHPLTEHKAKGVAEALRRQDMFDEINVEAREDQQA* |
| Ga0132258_138014493 | 3300015371 | Arabidopsis Rhizosphere | FEIASTDPDHPLNEHTAKGVAEALRRQDMFDEIRTEPRIED* |
| Ga0132258_138564393 | 3300015371 | Arabidopsis Rhizosphere | VDPERPLTEHKAKGVAEALRRQDMFDEVRTEPRDQEGNGNTGS* |
| Ga0132256_1010539503 | 3300015372 | Arabidopsis Rhizosphere | MLDDRVFEIAAVDPDHPLTEHKAKGVAEALRRQDMFDEINVEPREEEPA* |
| Ga0132255_1043540972 | 3300015374 | Arabidopsis Rhizosphere | LGSLGVVMLDDRLFEIASVDPEHPLTEHKAKGVAEALRRQDMFEEIRTEPRLDEQ* |
| Ga0134083_104732821 | 3300017659 | Grasslands Soil | SVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEAKEE |
| Ga0183260_102678432 | 3300017787 | Polar Desert Sand | FEIASTDPERPLTEHKSKGVAEALKRHGMFDEISVELRGEEAVGE |
| Ga0190272_106120941 | 3300018429 | Soil | ASADPEHPLTEHKAKGVAEALRRQDMFDEIKVEPRGEEASVE |
| Ga0190272_114096601 | 3300018429 | Soil | AAVDENHPLTEFKAKGVAEALRRQDMFEEIEVKPRDEETLEST |
| Ga0066667_111717112 | 3300018433 | Grasslands Soil | GVEMIDDGVFRVASLDPERPLTERKAQGIAEALRRQDMFDEISVEPRARADEDD |
| Ga0066667_113950971 | 3300018433 | Grasslands Soil | GVVCLDDRVFEIASVDPEHPLTEHKAKGVAEALRRQDMFDEVNVEPREEA |
| Ga0190274_117218202 | 3300018476 | Soil | GSLGVVMLDDGVFEVASTDPDHPLTEHKAKGVAEALRRQDMFEEIKCEPRGE |
| Ga0190273_106278782 | 3300018920 | Soil | MLDERVFEIASADPEHPLNELKAKGVADALRRQDMFEEIKVEPKEDL |
| Ga0193735_11033362 | 3300020006 | Soil | LGVVMLDERVFEIASTDAEHPLTEHKAKGVAEALRRQDMFDEVDVEPREPTEDL |
| Ga0193732_10492431 | 3300020012 | Soil | LGVVELDERIFEIASVDADHPLTEHKAKGIAEALRRQDMFDEIDVEPREGEPA |
| Ga0193745_10885691 | 3300020059 | Soil | TDEQHPLTELKAKGVAEALKRQDMFDEIEVKPRDEAEEV |
| Ga0182009_103966732 | 3300021445 | Soil | LDERVFEIASNDPDHPLTEHKAKGVAEALRRHDMFEEIKTEPRPEE |
| Ga0207710_107008811 | 3300025900 | Switchgrass Rhizosphere | LGSLDVYMIDERVFEIASEDPNHPLTEHKAKGVAEALRRQDMFDEVKVEAREEEAV |
| Ga0207680_107530351 | 3300025903 | Switchgrass Rhizosphere | IASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA |
| Ga0207695_111612491 | 3300025913 | Corn Rhizosphere | VMLDDRVFEIASIDPEHPLTEHKAKGVAEALRRQDMFDEIRAEPRSDE |
| Ga0207663_110246222 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SLGVVELDERIFEIASVDPDHPLTEHKAKGVAEAMRRQDMFDEISVEPREEDQS |
| Ga0207681_108566901 | 3300025923 | Switchgrass Rhizosphere | TDEDHPLTEHTAKGVAEALRRQDMFDEITLEPRVAE |
| Ga0207650_106227593 | 3300025925 | Switchgrass Rhizosphere | DPNHPLTEHKAKGIAEALRRQDMFDEVRTEPRDEE |
| Ga0207650_114700941 | 3300025925 | Switchgrass Rhizosphere | LGVVMLDDRVFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEIRTEPRSDE |
| Ga0207686_107727082 | 3300025934 | Miscanthus Rhizosphere | EIASIDPEHPLTEHKAKGVAEALRRQDMFDEIRAEPRSDE |
| Ga0207709_110890681 | 3300025935 | Miscanthus Rhizosphere | LGSLGVVMLDDRVFEIASTDPDHPLTEHKAKGVADALRRQDMFDDIKTEPRGE |
| Ga0207669_113911832 | 3300025937 | Miscanthus Rhizosphere | EIASTDPEHPLTEHKAKGVAEALRRQDMFDDVKTEPREEVE |
| Ga0207711_103852953 | 3300025941 | Switchgrass Rhizosphere | IASTDADHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE |
| Ga0207689_114975712 | 3300025942 | Miscanthus Rhizosphere | GSLGVVMLDERLFEIASADPEHPLSESKAKGVADALRRQDMFEEIKVEPREEED |
| Ga0207689_115636102 | 3300025942 | Miscanthus Rhizosphere | RMFEIASVDPNHPLTEHKAKGVADALRRQDMFDEVRTEPRDEQ |
| Ga0207679_112136031 | 3300025945 | Corn Rhizosphere | VFEIASTDPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE |
| Ga0207651_109265401 | 3300025960 | Switchgrass Rhizosphere | FEIAAVDPERPLTEHKAKGVAEALRRQDMFDEVNVEPREDAEP |
| Ga0207640_107949112 | 3300025981 | Corn Rhizosphere | RVFEIAAVNPDHPLTEHKAKGVAEALRRQDMFDEISVEAREDESS |
| Ga0207677_109374201 | 3300026023 | Miscanthus Rhizosphere | EIASTDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPREEELVNDGA |
| Ga0207677_121842161 | 3300026023 | Miscanthus Rhizosphere | DRIFEIASVDPNHPLTEHKAKGVAEAVRRQDMFDEVRTEPRDEQ |
| Ga0207639_117972451 | 3300026041 | Corn Rhizosphere | LGSLGVVMLDERVFEIASTDADHPLTEHKAKGVAEALRRQDMFDEVKTEPRGE |
| Ga0207641_124490671 | 3300026088 | Switchgrass Rhizosphere | GVYMLDERVFEISSDDPERPLTEHKAKGIAEALRRQDMFDEINVEPRGEASVTE |
| Ga0207676_105684843 | 3300026095 | Switchgrass Rhizosphere | RPLTEHKAKGIAEALRRQAMFDEVKVEPREAQSDLD |
| Ga0207674_120578901 | 3300026116 | Corn Rhizosphere | VMLDERVFEIASSDPEHPLTEHKAQAVAEALRRQDMFDEITTEPRSE |
| Ga0209153_11730731 | 3300026312 | Soil | VMIDERVFEIASVDADHPLTEHQAKGVAEALRRQDMFDEIDVEPRELE |
| Ga0209153_11994742 | 3300026312 | Soil | VFEIASTDPEHPLTEHTAKGVAEALRRQDMFDEIRTEPRGEQ |
| Ga0209647_13088022 | 3300026319 | Grasslands Soil | VVMLDERVFEIASADPEHPLTEHKAKGVAEAVRRQDMFDEVSVELLEEEP |
| Ga0209387_10297263 | 3300027639 | Agricultural Soil | FEIASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGESDVDA |
| Ga0209461_100908632 | 3300027750 | Agave | VFEVASTDPDHPLTEHKAKGVAEALRRQDMFDEVRTEPRGE |
| Ga0209177_101481741 | 3300027775 | Agricultural Soil | SLGVVMLDDRVFEIASTDPDHPLNEHTAKGVAEALRRQDMFEEIRTEPRSEE |
| Ga0209481_107412451 | 3300027880 | Populus Rhizosphere | STDPEHPLTEHKAKGVAEALRRQDMFDEIRTEPRSE |
| Ga0209486_104266161 | 3300027886 | Agricultural Soil | VFEIASTDPDHPLSEHTAKGVAAALRRQDMFDEVRTEPRGD |
| Ga0207428_102320131 | 3300027907 | Populus Rhizosphere | STDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPREME |
| Ga0209382_116557252 | 3300027909 | Populus Rhizosphere | IASTDPEHPLTEHTAKGVAEALRRQDMFDEIRTEPRGEQ |
| Ga0268265_105487723 | 3300028380 | Switchgrass Rhizosphere | EVASTDPDHPLTEHKAKGVAEALRRQDMFDEIRTEPRGE |
| Ga0268242_10210531 | 3300030513 | Soil | IASIDPEHPLTEHKAKGVAEALKRQDMFDEISVEPRYEEVMSNE |
| Ga0310888_106461601 | 3300031538 | Soil | DDRVFEIASTDPEHPLTEHTAKGVAEALRRQDMFDEITTEPRAE |
| Ga0310813_113826061 | 3300031716 | Soil | DPDHPLTEHKAKGVAEALRRHDMFEEIKTEPRPEE |
| Ga0307469_114982711 | 3300031720 | Hardwood Forest Soil | DAEHPLTEHKAKGVAEALRRQDMFDEIDVEPRETE |
| Ga0307469_122505912 | 3300031720 | Hardwood Forest Soil | EHPLTEHKAKGVAEALRRQDMFDEVKVEPRAEDEAATSEP |
| Ga0307475_113619081 | 3300031754 | Hardwood Forest Soil | GVVMLDERIFEIASSDPEHPLTEHKAKGVAEALRRQDMFDEVRTELRGDE |
| Ga0307416_1028894482 | 3300032002 | Rhizosphere | FEIASSDPEHPLTEHKARGVADALRRQDMFDEISVEPREEGEEV |
| Ga0307411_105088161 | 3300032005 | Rhizosphere | GVVMLDDRVFEIASADPEHPLTEHKAQAVAEALRRQDMFDEIRTEPRSDE |
| Ga0310895_103021411 | 3300032122 | Soil | MLDDRVFEIASTDPDHPLTEHKAKGVAEALRRQDMFEEIRTEPREME |
| Ga0334930_038976_8_172 | 3300034005 | Sub-Biocrust Soil | MLDDELFEIASTDPEHPLTEHKAKGIAEALRRHDMFDEISVEPREAETSADEPV |
| Ga0334930_090941_9_170 | 3300034005 | Sub-Biocrust Soil | MLDDGVFEIASTDPEHPLTEHKARGVAAALRRHDMFDEVSVEPRELADEDAAE |
| Ga0334923_130233_385_519 | 3300034376 | Hypolithic Biocrust | IASVDPEHPLTEHKAKGIAEALRRQDMFDEVTVEPRDDEESTDE |
| Ga0334931_044169_823_978 | 3300034377 | Sub-Biocrust Soil | MLDERLFEIASSDPEHPLTEHQAKGVADALRRQDMFDEISVEPREEVMSDE |
| Ga0334931_105517_491_658 | 3300034377 | Sub-Biocrust Soil | LDEGVFEIASTDPEHPLTEHKARVVGDALRRQGMFDDIAVEPRRAGDDEAAEVAE |
| Ga0334935_004000_1_150 | 3300034781 | Biocrust | DDRLFEIASADPERPLTERRARGVADTLRLYDMFDEISVEPREDEEEFD |
| ⦗Top⦘ |