NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F021851

Metagenome / Metatranscriptome Family F021851

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F021851
Family Type Metagenome / Metatranscriptome
Number of Sequences 217
Average Sequence Length 53 residues
Representative Sequence FAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF
Number of Associated Samples 160
Number of Associated Scaffolds 217

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.38 %
% of genes near scaffold ends (potentially truncated) 98.16 %
% of genes from short scaffolds (< 2000 bps) 94.01 %
Associated GOLD sequencing projects 152
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.323 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.972 % of family members)
Environment Ontology (ENVO) Unclassified
(33.641 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.691 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.69%    β-sheet: 0.00%    Coil/Unstructured: 92.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 217 Family Scaffolds
PF13620CarboxypepD_reg 5.07
PF00437T2SSE 4.61
PF00753Lactamase_B 4.61
PF00005ABC_tran 4.15
PF02627CMD 0.92
PF13519VWA_2 0.92
PF00903Glyoxalase 0.92
PF04140ICMT 0.92
PF06739SBBP 0.92
PF07883Cupin_2 0.92
PF03928HbpS-like 0.92
PF13360PQQ_2 0.46
PF028262-Hacid_dh_C 0.46
PF08450SGL 0.46
PF12706Lactamase_B_2 0.46
PF01554MatE 0.46
PF00654Voltage_CLC 0.46
PF04909Amidohydro_2 0.46
PF07690MFS_1 0.46
PF13231PMT_2 0.46
PF01370Epimerase 0.46
PF04892VanZ 0.46
PF00561Abhydrolase_1 0.46
PF02371Transposase_20 0.46
PF14552Tautomerase_2 0.46
PF13376OmdA 0.46
PF11954DUF3471 0.46
PF14417MEDS 0.46
PF00078RVT_1 0.46
PF13474SnoaL_3 0.46
PF01979Amidohydro_1 0.46
PF01436NHL 0.46
PF00190Cupin_1 0.46
PF02732ERCC4 0.46
PF00497SBP_bac_3 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 217 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.92
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.92
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.46
COG1948ERCC4-type crossover junction endonucleaseReplication, recombination and repair [L] 0.46
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.46
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.46
COG3547TransposaseMobilome: prophages, transposons [X] 0.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.32 %
UnclassifiedrootN/A9.22 %
PlanomonosporagenusPlanomonospora0.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459016|G1P06HT02GAH2RAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0579443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1278Open in IMG/M
3300000559|F14TC_103853656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300005181|Ga0066678_10137993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1515Open in IMG/M
3300005294|Ga0065705_10481821All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300005295|Ga0065707_10692239All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005330|Ga0070690_101713649All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005344|Ga0070661_100073067Not Available2525Open in IMG/M
3300005344|Ga0070661_101261560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300005353|Ga0070669_101404257All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300005354|Ga0070675_100721594All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300005356|Ga0070674_102075430All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium518Open in IMG/M
3300005367|Ga0070667_101835047All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005438|Ga0070701_11152574All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300005441|Ga0070700_100314778All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300005468|Ga0070707_101584968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300005471|Ga0070698_100029434All Organisms → cellular organisms → Bacteria → Acidobacteria5702Open in IMG/M
3300005471|Ga0070698_100403364All Organisms → cellular organisms → Bacteria → Acidobacteria1301Open in IMG/M
3300005471|Ga0070698_101666092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18590Open in IMG/M
3300005536|Ga0070697_101227121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18668Open in IMG/M
3300005536|Ga0070697_101235357Not Available666Open in IMG/M
3300005543|Ga0070672_100835126All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300005549|Ga0070704_100073235All Organisms → cellular organisms → Bacteria → Acidobacteria2495Open in IMG/M
3300005549|Ga0070704_101264167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300005549|Ga0070704_101702227Not Available583Open in IMG/M
3300005552|Ga0066701_10044517Not Available2403Open in IMG/M
3300005556|Ga0066707_10115700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1665Open in IMG/M
3300005564|Ga0070664_100933604All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005564|Ga0070664_100948116All Organisms → cellular organisms → Bacteria → Acidobacteria808Open in IMG/M
3300005577|Ga0068857_100709526All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005577|Ga0068857_101674186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales622Open in IMG/M
3300005615|Ga0070702_100654126All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300005615|Ga0070702_101098274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300005615|Ga0070702_101466321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300005764|Ga0066903_108767916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300005841|Ga0068863_100301731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp.1554Open in IMG/M
3300005842|Ga0068858_100332731All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300005842|Ga0068858_101614010All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005843|Ga0068860_101568538Not Available680Open in IMG/M
3300006031|Ga0066651_10233905All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300006046|Ga0066652_101219736All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300006049|Ga0075417_10234233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300006169|Ga0082029_1425103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300006237|Ga0097621_101537796All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300006844|Ga0075428_101216274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium794Open in IMG/M
3300006845|Ga0075421_100672105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1207Open in IMG/M
3300006852|Ga0075433_10300046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1422Open in IMG/M
3300006854|Ga0075425_102373735All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300006865|Ga0073934_10806534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300006871|Ga0075434_100327878All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300006871|Ga0075434_100624327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_181096Open in IMG/M
3300006894|Ga0079215_10371937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium829Open in IMG/M
3300006903|Ga0075426_10684284All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300006918|Ga0079216_10507667All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300007004|Ga0079218_10506574All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1070Open in IMG/M
3300007004|Ga0079218_12262898Not Available634Open in IMG/M
3300007076|Ga0075435_101563534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300009012|Ga0066710_104693922All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009090|Ga0099827_12000180All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009094|Ga0111539_11580163Not Available761Open in IMG/M
3300009098|Ga0105245_12629936All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300009100|Ga0075418_10915129All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300009148|Ga0105243_10682432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18999Open in IMG/M
3300009156|Ga0111538_10437129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1658Open in IMG/M
3300009162|Ga0075423_13163389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300009176|Ga0105242_12200952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18597Open in IMG/M
3300009610|Ga0105340_1230521All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300009804|Ga0105063_1066309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300009806|Ga0105081_1071278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300009819|Ga0105087_1075640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300009837|Ga0105058_1151987All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300010040|Ga0126308_11262343All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300010044|Ga0126310_11861771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300010046|Ga0126384_11071396All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300010333|Ga0134080_10639731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300010360|Ga0126372_12054307Not Available619Open in IMG/M
3300010391|Ga0136847_10326310All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300010399|Ga0134127_13201397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300010403|Ga0134123_12982424All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300011119|Ga0105246_12527186All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300011395|Ga0137315_1007006All Organisms → cellular organisms → Bacteria → Proteobacteria1254Open in IMG/M
3300011398|Ga0137348_1099317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300011403|Ga0137313_1008882All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300011403|Ga0137313_1041430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300011429|Ga0137455_1012677All Organisms → cellular organisms → Bacteria2262Open in IMG/M
3300011434|Ga0137464_1042964All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300011434|Ga0137464_1140890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300011436|Ga0137458_1273524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300011439|Ga0137432_1005298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3549Open in IMG/M
3300011439|Ga0137432_1033587All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300011441|Ga0137452_1299158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300012143|Ga0137354_1074929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300012173|Ga0137327_1079317Not Available730Open in IMG/M
3300012198|Ga0137364_11409471Planomonospora → unclassified Planomonospora → Planomonospora sp. ID91781516Open in IMG/M
3300012208|Ga0137376_10468483All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300012226|Ga0137447_1018686All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_181044Open in IMG/M
3300012232|Ga0137435_1015938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2124Open in IMG/M
3300012232|Ga0137435_1036137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1437Open in IMG/M
3300012356|Ga0137371_10971078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300012356|Ga0137371_11238112All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300012361|Ga0137360_11573668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21562Open in IMG/M
3300012685|Ga0137397_11191947Not Available549Open in IMG/M
3300012922|Ga0137394_10104223All Organisms → cellular organisms → Bacteria2391Open in IMG/M
3300012930|Ga0137407_12313811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300012931|Ga0153915_13547284All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300013297|Ga0157378_12050061All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300014166|Ga0134079_10248100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300014325|Ga0163163_10866452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium967Open in IMG/M
3300014325|Ga0163163_13228990All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300014326|Ga0157380_12942541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300014872|Ga0180087_1029295All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300015245|Ga0137409_10094273All Organisms → cellular organisms → Bacteria2783Open in IMG/M
3300015258|Ga0180093_1005380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2349Open in IMG/M
3300015262|Ga0182007_10351044All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300015357|Ga0134072_10400548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18541Open in IMG/M
3300015373|Ga0132257_100033057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5627Open in IMG/M
3300015373|Ga0132257_104244776All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300017656|Ga0134112_10173076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium837Open in IMG/M
3300018000|Ga0184604_10301808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300018027|Ga0184605_10391636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300018052|Ga0184638_1003329All Organisms → cellular organisms → Bacteria5076Open in IMG/M
3300018052|Ga0184638_1282681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300018053|Ga0184626_10172010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18920Open in IMG/M
3300018055|Ga0184616_10355874All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300018056|Ga0184623_10355067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300018063|Ga0184637_10369668All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300018063|Ga0184637_10730289Not Available537Open in IMG/M
3300018075|Ga0184632_10482087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300018076|Ga0184609_10181856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium976Open in IMG/M
3300018078|Ga0184612_10065940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1886Open in IMG/M
3300018079|Ga0184627_10102938All Organisms → cellular organisms → Bacteria → Acidobacteria1507Open in IMG/M
3300018079|Ga0184627_10242896All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300018082|Ga0184639_10081445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1701Open in IMG/M
3300018082|Ga0184639_10246937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18944Open in IMG/M
3300018422|Ga0190265_10338848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1587Open in IMG/M
3300018422|Ga0190265_10345041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1574Open in IMG/M
3300018422|Ga0190265_10836816Not Available1043Open in IMG/M
3300018422|Ga0190265_11712501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium738Open in IMG/M
3300018422|Ga0190265_11826191All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300018422|Ga0190265_12156936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300018422|Ga0190265_13018439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300018429|Ga0190272_10807582All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300018429|Ga0190272_10954919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300018429|Ga0190272_11810644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300018429|Ga0190272_12298581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18581Open in IMG/M
3300018429|Ga0190272_12313951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300018429|Ga0190272_12948049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300018429|Ga0190272_13048828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300018429|Ga0190272_13287603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300018432|Ga0190275_11799706Not Available691Open in IMG/M
3300018466|Ga0190268_10172174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1140Open in IMG/M
3300018466|Ga0190268_10207444All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300018466|Ga0190268_10458101All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium847Open in IMG/M
3300018466|Ga0190268_11095021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300018466|Ga0190268_12257649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300018469|Ga0190270_10231667All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300018469|Ga0190270_10697161All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300018469|Ga0190270_11307340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18768Open in IMG/M
3300018469|Ga0190270_11521266Not Available719Open in IMG/M
3300018469|Ga0190270_11566382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300018469|Ga0190270_11884220All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300018469|Ga0190270_13138104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300018469|Ga0190270_13256689All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300018469|Ga0190270_13374230All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300019259|Ga0184646_1401633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_181340Open in IMG/M
3300019263|Ga0184647_1460377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300019882|Ga0193713_1080870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium914Open in IMG/M
3300019888|Ga0193751_1139582Not Available882Open in IMG/M
3300020005|Ga0193697_1048764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_181054Open in IMG/M
3300020065|Ga0180113_1327928All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300021073|Ga0210378_10405442All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300021078|Ga0210381_10217573All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium671Open in IMG/M
3300021078|Ga0210381_10228585All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300021080|Ga0210382_10163345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18958Open in IMG/M
3300021363|Ga0193699_10063364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1449Open in IMG/M
3300023072|Ga0247799_1072379All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300025315|Ga0207697_10561287All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025910|Ga0207684_10978890Not Available708Open in IMG/M
3300025923|Ga0207681_11827190Not Available507Open in IMG/M
3300025934|Ga0207686_10847632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300026023|Ga0207677_10845069All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300026035|Ga0207703_11786990All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300026075|Ga0207708_10378920All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300026116|Ga0207674_10669247All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300026118|Ga0207675_102272893Not Available556Open in IMG/M
3300027880|Ga0209481_10419895All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300027886|Ga0209486_11013946Not Available558Open in IMG/M
3300027907|Ga0207428_11076056All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18563Open in IMG/M
3300028380|Ga0268265_12352711All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300028381|Ga0268264_11539209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18676Open in IMG/M
3300028792|Ga0307504_10224457All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300028828|Ga0307312_10973123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300031152|Ga0307501_10126833All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300031720|Ga0307469_10658975All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Sulfuricaulis → Sulfuricaulis limicola944Open in IMG/M
3300031720|Ga0307469_10786051All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300031740|Ga0307468_100840188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium788Open in IMG/M
3300031740|Ga0307468_101538000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300031820|Ga0307473_11380606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300031892|Ga0310893_10130131Not Available957Open in IMG/M
3300031943|Ga0310885_10137760All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D051154Open in IMG/M
3300031943|Ga0310885_10510758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18656Open in IMG/M
3300032000|Ga0310903_10048872All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300032157|Ga0315912_10883068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18711Open in IMG/M
3300032180|Ga0307471_100778546All Organisms → cellular organisms → Bacteria → Acidobacteria1123Open in IMG/M
3300032180|Ga0307471_102600016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300032180|Ga0307471_104142830All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300032211|Ga0310896_10574289All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300032421|Ga0310812_10239831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales795Open in IMG/M
3300033407|Ga0214472_11386675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300033551|Ga0247830_11371283All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300033812|Ga0364926_017127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1273Open in IMG/M
3300034147|Ga0364925_0015564All Organisms → cellular organisms → Bacteria2363Open in IMG/M
3300034149|Ga0364929_0364680All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300034150|Ga0364933_032246All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300034150|Ga0364933_046398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300034176|Ga0364931_0109080All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300034176|Ga0364931_0130911All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium804Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.97%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.37%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.69%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.23%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.23%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.84%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.46%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.46%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.46%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.46%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.46%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.46%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.46%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011395Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2ZMR_021100802170459016Switchgrass, Maize And Mischanthus LitterAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF
ICChiseqgaiiDRAFT_057944313300000033SoilTKFFGLGGERRIGVFVEAFNLLNNANFGGGYVGNGRSVLFREPSGSFIPGIGYPRQVQLGARFLF*
F14TC_10385365623300000559SoilEFFNLFNTVNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF*
Ga0066678_1013799313300005181SoilVEFFNLFNTANFGAQYQGNGRSATFQQPNGYIPGIGYPRQVQLGARFLF*
Ga0065705_1048182113300005294Switchgrass RhizosphereFFNVFNTANFGSSFTGNSRSATFRQPTGFIPGIGYPRQAQLGVRLLF*
Ga0065707_1069223913300005295Switchgrass RhizosphereFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF*
Ga0070690_10171364923300005330Switchgrass RhizosphereFNLGNADRKIGVFVEFFNLFNTANFGSQYTGNGRSATFRQPNGYIPGIGYPRQVQLGARFLF*
Ga0070661_10007306713300005344Corn RhizosphereAFNLFNTANFGGSYSGNSRRTNFRQPTDFVPGIGYARQVQLGGRFLF*
Ga0070661_10126156013300005344Corn RhizosphereDRKVGLFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGMRFLF*
Ga0070669_10140425723300005353Switchgrass RhizosphereVVLDLRGTKFFALWAERRLAVFAEIFNVLDNANFGGSYTGNGRSVLFRQPSGGFIPGIGYPRQLQLGARFLF*
Ga0070675_10072159423300005354Miscanthus RhizosphereTDRKVGLFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGMRFLF*
Ga0070674_10207543023300005356Miscanthus RhizosphereLFNAFNTANFGASYSGNASSVNFRQPTGFIPGVGYPRQVQIGSRFLF*
Ga0070667_10183504723300005367Switchgrass RhizosphereAFNIFNTANFGASYGGNASSTTFRQPTGFIPGIGYPRQVQLGARFQF*
Ga0070701_1115257413300005438Corn, Switchgrass And Miscanthus RhizosphereKIGAFVEFFNLFNTANFGAQYQGNGRSATFRQPNGYIPGIGYPRQVQLGARFLF*
Ga0070700_10031477813300005441Corn, Switchgrass And Miscanthus RhizosphereEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF*
Ga0070707_10158496823300005468Corn, Switchgrass And Miscanthus RhizosphereNFGANYSGNASSVNFRQPTGFIPGIGYPRQVQIGSRFLF*
Ga0070698_10002943413300005471Corn, Switchgrass And Miscanthus RhizosphereGGDRKIGVFAEAFNLFNTSNFGNSYTGNGRSASSFKQPSGFIPGIGYARQLQLGARFLF*
Ga0070698_10040336423300005471Corn, Switchgrass And Miscanthus RhizosphereVNFGAEYQGNGRSASFRQPNAYIPGIGYPRQAQLGMRFLF*
Ga0070698_10166609213300005471Corn, Switchgrass And Miscanthus RhizosphereGIFVETFNVFNTANFGGAYGGNARSTTFRQATGFIPGIGGPRQVQLGARFLF*
Ga0070697_10122712123300005536Corn, Switchgrass And Miscanthus RhizosphereLGGDRKIGVFAEAFNLFNTLNFGNSYTGNGRSASFRQPTGFIPGIGYPRQLQLGARFLF*
Ga0070697_10123535713300005536Corn, Switchgrass And Miscanthus RhizosphereKIGVFAEAFNLFNAVNFGNSFTGNGRSATFKQPTGVIPGIGYPRQLQLGARFLF*
Ga0070672_10083512613300005543Miscanthus RhizosphereRKVGVFVEAFNLFNTANFGGSYSGNSRSTNFRQPTDFVPGIGYARQVQLGGRFLF*
Ga0070704_10007323533300005549Corn, Switchgrass And Miscanthus RhizosphereFNLFNTANFGNSYTSNARSTAFNQPNGFVSGMGYPRQMQLGLRFLF*
Ga0070704_10126416713300005549Corn, Switchgrass And Miscanthus RhizosphereTANFGANYSGNASSVNFRQPTGFIPGIGYPRQVQIGSRFLF*
Ga0070704_10170222723300005549Corn, Switchgrass And Miscanthus RhizosphereFNLFNTSNFGASYTGNARSASFRQPTGFIPGIGYPRQLQLGARFLF*
Ga0066701_1004451713300005552SoilIFVEFFNLFNTANFGQTYNGNGRSATFKQPNGFIPGSGYPFQVQLGGRFEF*
Ga0066707_1011570013300005556SoilTNFGAAYGGNARSATFRTPTGYIPSIGYPRQVQLGARFLF*
Ga0070664_10093360423300005564Corn RhizosphereVEAFNIFNTANFGSLSSNGQSNARSTTFRQATAFIPGIGYPRQVQLGARFQF*
Ga0070664_10094811623300005564Corn RhizosphereGSNRKVGVFVEAFNLFNTANFGGSYSGNSRSTNFRQPTDFVPGIGYARQVQLGGRFLF*
Ga0068857_10070952613300005577Corn RhizosphereFFNLGNSTRKIGAFVEAFNLFNTANFGAQYTANGRSAVFRQPNGYIPGIGYPRQVQLGARFLF*
Ga0068857_10167418613300005577Corn RhizosphereRKLGVFVEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF*
Ga0070702_10065412613300005615Corn, Switchgrass And Miscanthus RhizosphereFVEFFNLFNTANFGAQYTGNGRSSSFRQPNGYIPGIGYPRQVQLGARFLF*
Ga0070702_10109827423300005615Corn, Switchgrass And Miscanthus RhizosphereRGDATVVMDLRATKFFALGGERRVATFVEVFNVLNNVNFGGSYTGNGRSVVFRQPSGGFIPGIGYPRQLQLGARFLF*
Ga0070702_10146632123300005615Corn, Switchgrass And Miscanthus RhizosphereFNTTNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGMRFLF*
Ga0066903_10876791613300005764Tropical Forest SoilGGTGSRKLGVFVEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARLLF
Ga0068863_10030173113300005841Switchgrass RhizosphereGIFAETFNVFNTANFGGQYGGNVRGTTFLQPTGFIPGIGGPRQMQLGVRFLF*
Ga0068858_10033273113300005842Switchgrass RhizosphereVEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF*
Ga0068858_10161401023300005842Switchgrass RhizosphereYGGNARSATFRRPTGYIPSIGYPRQVQLGMRFLF*
Ga0068860_10156853813300005843Switchgrass RhizosphereFNLFNTANFGNSYTGNGRSATFRQPTGFIPGIGYARQLQLGARFLF*
Ga0066651_1023390513300006031SoilTANFGAAYNGNGRSTLFKQPIGFIPGSGYPFQVQLGARFTF*
Ga0066652_10121973623300006046SoilFNLFNTANFGNNYTGNARSTAFRQPNGFVPGIGYPRQLQLGLRFLF*
Ga0075417_1023423353300006049Populus RhizosphereFNTTNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRYLF*
Ga0082029_142510323300006169Termite NestDLRTTKFFVLGGDRRLGLFAELFNVLNTVNFGNNYGGNARGSTFRQPTAFMPVIGYPRQLQLGARFLF*
Ga0097621_10153779613300006237Miscanthus RhizosphereVGAFVEAFNIFNTANFGASYGGNASSTTFRQPTGFIPGIGYPRQVQLGARFQF*
Ga0075428_10121627413300006844Populus RhizosphereNFGGSYTGNGRSVLFRQPSGGFIPAIGYPRQLQLGARFLF*
Ga0075421_10067210513300006845Populus RhizosphereGLFAEFFNIFNTANFGNSYQGNGRSVEFRQANGYIPSIFYPRQAQVGARFLF*
Ga0075433_1030004613300006852Populus RhizosphereYSGNASSVNFRQPTGFIPGIGYPRQVQIGSRLLF*
Ga0075425_10237373523300006854Populus RhizosphereRKIGVFVETFNVFNTANFGGAYGGNARSTTFRQATGFIPGIGGPRQVQLGARFLF*
Ga0073934_1080653413300006865Hot Spring SedimentTVNHGNLYNGNARSTNFQKPTGYIQGIGYPRQVQLGARFLF*
Ga0075434_10032787813300006871Populus RhizosphereFGAQYQGNGRSATFRQPNGYIPGIGYPRQVQLGARFQF*
Ga0075434_10062432723300006871Populus RhizosphereLGGDRKIGVFAEAFNLFNTSNFGASYTGNARSASFRQPTGFIPGIGYPRQLQLGARFLF*
Ga0079215_1037193723300006894Agricultural SoilDLRTTKFFGLGGERRIGVFVEAFNLLNNANFGGGYVGNGRSVLFREPSGSFIPGIGYPRQVQLGARFLF*
Ga0075426_1068428413300006903Populus RhizosphereRKIGVFVETFNVFNTANFGGAYGGNARSTTFRQPTGFIPGIGGPRQVQLGARFLF*
Ga0079216_1050766723300006918Agricultural SoilGGQYNGNGRSSAFRQPTGFIPGIGYPRQVQLGARFLF*
Ga0079218_1050657413300007004Agricultural SoilNSYNGNGRSATFRTPTGYIAGIGYPRQVQLGARFLF*
Ga0079218_1226289813300007004Agricultural SoilNFGNAYTGNARSVLFGQPTGTLIPGIGYPRTLQLGARLLF*
Ga0075435_10156353433300007076Populus RhizosphereSLGSTDRKVGLFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQVQLGMRILF*
Ga0066710_10469392213300009012Grasslands SoilGRETRRVGVFAEFFNLFNTANFGQVYNGNARSALFKQPIGFIPGSGYPFQVQVGARFEF
Ga0099827_1200018013300009090Vadose Zone SoilTKFFALTAERKIGVFAELFNALNNANFGGAYTGNARSVTFRQPSGTLIPGIGYPRTLQLGARFLF*
Ga0111539_1158016313300009094Populus RhizosphereVFVEAFNLFNTANFGGSFSGNSRSTNFRQPTDFVPGIGYARQVQLGARLLF*
Ga0105245_1262993623300009098Miscanthus RhizosphereGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF*
Ga0075418_1091512923300009100Populus RhizosphereTNFGGQYSGNGRAVNFRQPTGFIPGIGYPRQVQLGMRYQF*
Ga0105243_1068243213300009148Miscanthus RhizosphereTVNFGAEYQGNGRSATFRQPNGYIPSIGYPRQVQLGARFLF*
Ga0111538_1043712913300009156Populus RhizosphereNRRVGVFVEAFNLFNTANFGGSYSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF*
Ga0075423_1316338913300009162Populus RhizosphereVFNTANFGQNYQGNARSTLFRQPIGFIPGSGYPFQVQLGARFEF*
Ga0105242_1220095223300009176Miscanthus RhizosphereNVFNTANFGGTYGGNARSTTFRQATGFIPGIGGPRQVQLGARFLF*
Ga0105340_123052123300009610SoilGTKFFALGGERRIGVFAEAFNLLNNANFGGGYTGNGRSVLFREPSGSLIPGIGYPRTLQLGARFLF*
Ga0105063_106630923300009804Groundwater SandFNLFDTVNFGSQYQGNGRSATFRQPNGYIPSIGYPRQVQLGARFLF*
Ga0105081_107127823300009806Groundwater SandGEKKIGFFAEVFNLFDTANFGERYQGNGRSTAFRQPNNFVAGIGYPRQAQIGVRFLF*
Ga0105087_107564023300009819Groundwater SandLGVLVDLFNTANFGQVYQGNGLSTSFKQPSGFMPGSGYPFQIQLGARFDF*
Ga0105058_115198713300009837Groundwater SandAEFFNLFNTANFGQSYQGNALSAASFRQPSAFIPGSGYPFQVQLGARFDF*
Ga0126308_1126234313300010040Serpentine SoilVGLFVELFNALNTDNFGGSYGGNARATTFRQPTGFIPGIGNPRQVQLGARFLF*
Ga0126310_1186177113300010044Serpentine SoilEFFNLFNTANFGANYTGNARSSSFRQPNGFVSGIGYPRQVQLGLRFLF*
Ga0126384_1107139613300010046Tropical Forest SoilFGQVYNGNGRSVNFKQPVGLMPGAGYPFQIQLGARFDF*
Ga0134080_1063973113300010333Grasslands SoilVFAEFFNLFNTANFGQNYNGNALSAVFRQPVGFIPSIGYPRQLQLGTRLLF*
Ga0126372_1205430723300010360Tropical Forest SoilMEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQLQLGARFLF*
Ga0136847_1032631023300010391Freshwater SedimentLFNTANFGGQYSGNARSVNFQQPTGFIPSIGYPRQVQLGARFLF*
Ga0134127_1320139723300010399Terrestrial SoilERRIGVFAEIFNVLNNVNLGGDYVGNGRSALFGEPTGGFIPGIGYPRQLQLGARFLF*
Ga0134123_1298242423300010403Terrestrial SoilVEAFNLFNTNNFGASYTGNASSATFRQPTGFIPGIGYPRQVQLGARLTF*
Ga0105246_1252718613300011119Miscanthus RhizosphereFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF*
Ga0137315_100700613300011395SoilVEVFNVFNTANFGGSYNGNSRSAAFRQPTGFIPGIGYPRQVQLGARFLF*
Ga0137348_109931713300011398SoilRRLAVFAEVFNVLDNANFGGSYTGNGRSVLFRQPSGGFIPGIGYPRQLQLGARFLF*
Ga0137313_100888213300011403SoilLFAEFFNVFNTTNFGGSYTGNARSATFRQPTGFIPSIGYPRQAQLGVRFLF*
Ga0137313_104143023300011403SoilGIFVETFNVFNTANFGGSYGGNARATTFRQPTGFIPGIGNPRQVQLGARFLF*
Ga0137455_101267733300011429SoilAEFFNVFNTTNFGGSYTGNARSATFRQPTGFIPSIGYPRQAQLGVRFLF*
Ga0137464_104296433300011434SoilIAVFAEIFNVLDNVNLGGDFTGNARSALFRQPTGGFIPGIGYPRQLQLGARFLF*
Ga0137464_114089023300011434SoilDRKLGIFVELFNMFNTANFGANYSGNASSVNFRQPTGFIPSIGYPRQVQIGSRFLF*
Ga0137458_127352413300011436SoilDKKIGLFAEFFNLFNTYNFGGQYGGNARATTFRLPTGYIPGIGNPRQVQLGARFLF*
Ga0137432_100529843300011439SoilEAFNLFNTANFGGAFSGNSRSTNFRQPTDYVPGIGYARQLQLGARFTF*
Ga0137432_103358733300011439SoilLDLRGTKFISLGGDRRIAVFGEVFNVLNNANFGGSYTGNGRSVLFGQPSGGFIPAIGYPRQLQLGARFLF*
Ga0137452_129915823300011441SoilIFAEVFNVFNTDNFGGSYGGNARGTTFRQPTGFISGIGGPRQLQLGARFLF*
Ga0137354_107492913300012143SoilTVVLDLRGTKFFPLGGERRIGVLVEIFNVFDNVNLGGDFNGNARSALFGQPTGGFIPGIGYPRQLQLGARFLF*
Ga0137327_107931713300012173SoilTVVLDLRGTKFFALGSERRLAVFAEVFNVLDNANFGGSYTGNGRSVLFRQPSGSLIPGIGYPRTLQLGARFLF*
Ga0137364_1140947123300012198Vadose Zone SoilGIFVELFNMFNTANFGASYSGNASSVNFRQPTGFIPGIGYPRQVQLGSRFLF*
Ga0137376_1046848313300012208Vadose Zone SoilQVLDVRSTKFFALGAERKVGVFAELFNALNNANFGGAYTGNARSVTFRQPSGTLIPGIGYPRTLQLGARFLF*
Ga0137447_101868623300012226SoilFGGSYNGNSRSAAFRQPTGFIPGIGYPRQVQLGARFLF*
Ga0137435_101593863300012232SoilGGEKKVGIFAEVFNVFNTDNFGGSYGGNARGTTFRQPTGFITGIGGPRQLQLGARFLF*
Ga0137435_103613743300012232SoilGGEKKVGIFAEVFNVFNTDNFGGSYGGNARGTTFRQPTGFISGIGGPRQLQLGARFLF*
Ga0137371_1097107823300012356Vadose Zone SoilFGGQYQGNGRSATFRQPNAFVPGIGYSRQLQLGARFLF*
Ga0137371_1123811223300012356Vadose Zone SoilWVTKFFTFWETRRLGVFAEFFNLFNTANFGQNYNGNALSAVFRQPVGFIPSIGYPRQLQLGTRLLF*
Ga0137360_1157366813300012361Vadose Zone SoilNTANFGQSFNGNGRSVAFNQPVGFIPGGVPFQAQLGVRFQF*
Ga0137397_1119194723300012685Vadose Zone SoilGIFAEFFNLFNTANFGQSYNGNGRSTSFRQPTGFIPGSGYPFQVQVGVRFDF*
Ga0137394_1010422333300012922Vadose Zone SoilALDLRATKFFPLGGERRIAVFAEIFNVLDNVNLGGDFTGNARSALFRQPTGGFIPGIGYPRQLQLGARFLF*
Ga0137407_1231381113300012930Vadose Zone SoilVEAFNLFNRANFGAAYGGNARSATFQIPTGFVPGIGYPRQVQLGMRFLF*
Ga0153915_1354728413300012931Freshwater WetlandsEFFNLFNTVNLGNAYIGNGRSASFMKPSGAYMPSIGYPRQVQLGARFLF*
Ga0157378_1205006123300013297Miscanthus RhizosphereVFVEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF*
Ga0134079_1024810013300014166Grasslands SoilTTNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF*
Ga0163163_1086645213300014325Switchgrass RhizosphereEFFNIFNTNNFGGSYQGNARATDFGQPTGFIPGIGIPRQVQLGARFLF*
Ga0163163_1322899023300014325Switchgrass RhizosphereEAFNIFNTANFGASYGGNASSTTFRQPTGFIPGIGYPRQVQLGARFQF*
Ga0157380_1294254113300014326Switchgrass RhizosphereKFFDLGSERRIATFVEVFNVLNNVNFGGSYTGNSRSVLFRQPSGGFIPGIGYPRQVQLGARFIF*
Ga0180087_102929513300014872SoilAFNLLNNANFGGGYTGNGRSVLFRQPSGSLIPGIGYPRTLQLGARFLF*
Ga0137409_1009427313300015245Vadose Zone SoilDRRIGVFAEAFNLFNTSNFGNSYTGNGRSASSFRQPTGFIPGIGYARQLQLGARFLF*
Ga0180093_100538013300015258SoilGRGDSTVVLDLRGTKFFALGSERRLAVFAEVFNVLDNANFGGSYTGNGRSVLFRQPSGGFIPGIGYPRQLQLGARFLF*
Ga0182007_1035104423300015262RhizosphereFVEAFNIFNTANFGASYGGNASSTTFRQPTGFIPGIGYPRQVQLGARFQF*
Ga0134072_1040054813300015357Grasslands SoilRKIGAFVKFFNLFNTANFGAQYQGNGRSATFRQPNGYIPGIGYPRQVQLGARFLF*
Ga0132257_10003305763300015373Arabidopsis RhizosphereFAEFFNLLNTVNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF*
Ga0132257_10424477613300015373Arabidopsis RhizosphereRKVGLFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRVLF*
Ga0134112_1017307623300017656Grasslands SoilERRLATFVEVFNVMNTVNFGGQYQGNGRSATFRQPNAFVPGVGYSRQLQLGARFLF
Ga0184604_1030180813300018000Groundwater SedimentFFNVFNTTNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF
Ga0184605_1039163623300018027Groundwater SedimentFNTVNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF
Ga0184638_100332913300018052Groundwater SedimentRKIGVFAEAFNLLNNANFGGGYTGNSRSVLFRQPFGSLIPGIGYPRTLQLGARFLF
Ga0184638_128268123300018052Groundwater SedimentLDNVNLGGDFTGNARSALFRQPTGGFIPGIGYPRQLQLGARFLF
Ga0184626_1017201013300018053Groundwater SedimentKEYGGNARSATFRQPMGFIPGIGYPRQLQLGARFLF
Ga0184616_1035587423300018055Groundwater SedimentPLGGERRLGVYAEIFNVLNNVNLGGDYVGNGRSALFGEPTGGFIPGIGYPRQLQLGARFL
Ga0184623_1035506723300018056Groundwater SedimentAEVFNVFNTVNFGREYSRNARSVNFRQPMGFVPGIGYPRQLQLGARFLF
Ga0184637_1036966823300018063Groundwater SedimentFFPLGGERRIAMFAEIFNVLDNVNLGGDFVGNGRSALFREPTGGFIPGIGYPRQLQLGARFLF
Ga0184637_1073028913300018063Groundwater SedimentFNTANFGASYQENSRSAQFKQPIGFLPSIGIPRQVQLGARFQF
Ga0184632_1048208723300018075Groundwater SedimentPLGGERRIAVFAEVFNVLNTVNFGGNYSGNSRSVLFRQPTELMAGIGYPRQLQLGARFLF
Ga0184609_1018185613300018076Groundwater SedimentLFAEFFNLFNPVNFGGQYASNGRATTFRQPTGFVPGIGIPRQAQFGARFTF
Ga0184612_1006594013300018078Groundwater SedimentGLFAEFFNLFDTDNFGGAYGGNARATTFRQPTGFIPGIGNPRQVQLGARFLF
Ga0184627_1010293823300018079Groundwater SedimentPLGGERRIAVFAEVFNVLNTANFGGSYIGNGRSVVFRQPNEVIPGIGYPRQLQLGARFLF
Ga0184627_1024289613300018079Groundwater SedimentEFFNLFNTANFGASYSGNASSVNFRRPTGFIPSIGYPRQIQLGSRFLF
Ga0184639_1008144513300018082Groundwater SedimentNFGNAYGGNARSTTFRQPMGFIPAIGYPRQVQLGARFLF
Ga0184639_1024693713300018082Groundwater SedimentHGAAYTGNGRSATFRQPTGYVPGIGYPRSAQLGVRFLF
Ga0190265_1033884813300018422SoilRLGVFAEVFNVFNTVNFGGEYNGNSRSAVFEQPTGFVPGIGYTRQLQLGARFLF
Ga0190265_1034504113300018422SoilEHRIGLFAEFFNLFNTANFGGTYQTNARAVNFQQPTGFIPGIGYPRQVQLGLRYQF
Ga0190265_1083681613300018422SoilTKFLSLGSDRRIALFAEVFNAFNNANFGGSYTGNARSVLFRQPSGGFIPGIGYPRQLQLGARFLF
Ga0190265_1171250113300018422SoilLRSTKFFPLGGERRIAVFAEIFNVLDNVNFGGNYTGNGRSVLFGQPSGGFIPGIGYPRQVQLGARFLF
Ga0190265_1182619123300018422SoilKFFPLGGDQRIALFAEVFNMFNTSNFGGSYTGNGRSVVFRQPSGVIPGIGYPRQLQLGARFLF
Ga0190265_1215693613300018422SoilTTKFFGLGGERRIGVFAEFFNLLNTVNFGNEYTGNGRSATFQQPTALIPGIGYPRQVQLGARFLF
Ga0190265_1301843923300018422SoilGGERRLGLFAEFFNLFNTANFGERYQGNGRSATFQQPNNYVAGIGYPRQAQLGVRFLF
Ga0190272_1080758223300018429SoilPFGGDRRLGLFVEFFNLFNTVNHGSEFNGNGRSSAFRNATGYIPSIGYPRQVQLGARFLF
Ga0190272_1095491913300018429SoilLRTTKFFGLGGERRIGVFAEFFNLLNTVNFGNTHTGNGRSATFQQPTGFIPGIGYPRQVQLGARFLF
Ga0190272_1181064413300018429SoilVVDLRGTKFFPLGGERRLGVLVEVFNLLDNVNLGGDFTGNARSALFRQPTGGFIPGIGYPRQLQLGARFLF
Ga0190272_1229858113300018429SoilFGGEYNGNGRAVTFREPTGFVPGIGYPRQVQLGARFLF
Ga0190272_1231395113300018429SoilLFVEFFNLFDTVNHGAEFQGNGRSATFQQPNGYIPGIGYPRQMQLGARFLF
Ga0190272_1294804913300018429SoilFFPLGGERRIGVFAEIFNVLDNVNLGGDFVGNGRSALFGEPTGGFIPGIGYPRQLQLGARFLF
Ga0190272_1304882823300018429SoilFFNLLNTVNFGNSYTGNGRSATFQQPTGFIPGIGYPRQVQLGARFLF
Ga0190272_1328760313300018429SoilVNFGGSYTGNGRSVLFGEPSGGFIPGIGYPRQLQLGARFLF
Ga0190275_1179970623300018432SoilDVTVVLDLRGTKFFALGSDRRIAVFAEVFNAFNNVNFGGSYTGNGRSVLFREPSGGFIPGIGYPRQLQLGARFLF
Ga0190268_1017217423300018466SoilFVEGFNLFNTANFGERYQGNGRSSAFRQPNNFVAGVGYPRQAQIGVRFLF
Ga0190268_1020744433300018466SoilDLRTTKFFPFGGERRIGVFAEVFNMLNTSNFGGSYTGNGRSVVFRQPSGVIPGIGYPRQLQLGARFLF
Ga0190268_1045810113300018466SoilGERRIGVFAEFFNLFNTVNFGNSYTGNGRSATFQQPTALIPGIGYPRQVQLGARFLF
Ga0190268_1109502123300018466SoilDLRTTKFFALGGEQRIGVFAELFNVLNNANFGGSYTSSARSVLFRQPTGTLIPGIGYPRTLQLGARFLF
Ga0190268_1225764923300018466SoilFNTANFGGQYNGNARAVTFQQPTGFVPGIGYPRQLQLGARFLF
Ga0190270_1023166713300018469SoilNVFNTVNFGGQYNGNSRSAVFQQPTGFVPGIGYTRQLQLGARFLF
Ga0190270_1069716123300018469SoilGDFTGNARSALFRQPTGGFIPGIGYPRQLQLGARFLF
Ga0190270_1130734013300018469SoilLGLFAEFFNLFDTVNLGSSFNGNGSSATFHQPSGGFVPGIGYPRQAQLGVRFLF
Ga0190270_1152126613300018469SoilKFFALGGARRLGVFAEVFNIFNTVNFGNNYTGNARSATFREPTAFIASIGYTRQLQLGARFLF
Ga0190270_1156638213300018469SoilDPTVALDLRATKFFALGGERRIGVFAEIFNVLNNVNLGGEFVGNGRSVLFGEPTGGFIPGIGYPRQLQLGARFLF
Ga0190270_1188422023300018469SoilVVLDLRTTKFFPLGGERRLGVYAEIFNVLNNVNLGGDYVGNGRSALFGEPTGGFIPGIGYPRQLQLGARFLF
Ga0190270_1313810413300018469SoilSQQRIGVFAEVFNMFNTSNFGGSYTGNGRSVVFRQPSGVIPGIGYPRQLQLGARFLF
Ga0190270_1325668913300018469SoilRRLGLFLELFNVFDNVNFGSAYNGNGRSSAFRTPTGFMPRLGIPRQAQVGARFLF
Ga0190270_1337423023300018469SoilVLFVEFFNVFNTVNFGAEYQGNGRSATFQQPNGYIPSIGYPRQVQLGARFLF
Ga0184646_140163323300019259Groundwater SedimentFNIANFGREYGGNARSTTFRQPMGFIPGIGYPRQLQLGARFLF
Ga0184647_146037713300019263Groundwater SedimentEFFNVFNTTNFGGSYTGNARSATFRQPTGFIPSIGYPRQAQLGVRFLF
Ga0193713_108087023300019882SoilSERKIGVFVEAFNLLNNVNFGGSYTGAATSTNFRQPSGGFIPGIGYPRQVQLGARFIF
Ga0193751_113958223300019888SoilYFGIGRDRKIGIFLEAFNLTNTANFGAAYGGKANGPSTFLQPTGYIPSIGYPRQVQLGARFLF
Ga0193697_104876413300020005SoilTTKFFALGGDRRIGVFAEAFNLFNTSNFGNSYTGNGRSATFKQPTGFIPGIGYARQLQLGARFLF
Ga0180113_132792813300020065Groundwater SedimentAFNLLNNANFGGGYTGNGRSVLFRQPSGSLIPGIGYPRTLQLGARFLF
Ga0210378_1040544213300021073Groundwater SedimentVSRIFGISYNGLATSAAFRQPTALIPSIGYPRQLQFGARFRF
Ga0210381_1021757313300021078Groundwater SedimentSYSGNASSVNFRQPTGFIPGIGYPRQVQIGSRFLF
Ga0210381_1022858523300021078Groundwater SedimentEVFNVFNTANFGASYQENSRSAQFKQPIGFLPSIGIPRQVQFGARFQF
Ga0210382_1016334523300021080Groundwater SedimentVEAFNLFNRANFGAAYGGNARSATFQIPTGFVPGIGYPRQVQLGMRFLF
Ga0193699_1006336433300021363SoilNLMNNVNFGGSYTGAATSTNFRQPSGGFIPGIGYPRQVQLGARFIF
Ga0247799_107237923300023072SoilKVGLFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGMRVLF
Ga0207697_1056128723300025315Corn, Switchgrass And Miscanthus RhizosphereFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF
Ga0207684_1097889023300025910Corn, Switchgrass And Miscanthus RhizosphereLGQERKIGVFAEAFNLFNAVNFGNSFTGNGRSATFKQPTGVIPGIGYPRQLQLGARFLF
Ga0207681_1182719023300025923Switchgrass RhizosphereAVFAEIFNVLDNANFGGSYTGNGRSVLFRQPSGGFIPGIGYPRQPMRPCGPK
Ga0207686_1084763223300025934Miscanthus RhizosphereAARGDNTVVLDLRATKFFDLGSDRRIATFVEVFNALNNVNFGGSYTGNGRSVLFRQPSGGFIPGIGYPRQLQLGARFLF
Ga0207677_1084506923300026023Miscanthus RhizosphereFLSLGTTDRKVGLFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGMRFLF
Ga0207703_1178699023300026035Switchgrass RhizosphereLFNTANFGNAYGGNARSATFRRPTGYIPSIGYPRQVQLGMRFLF
Ga0207708_1037892013300026075Corn, Switchgrass And Miscanthus RhizosphereRVGLFAEFFNLFNTANFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF
Ga0207674_1066924723300026116Corn RhizosphereFFNLGNSTRKIGAFVEAFNLFNTANFGAQYTANGRSAVFRQPNGYIPGIGYPRQVQLGARFLF
Ga0207675_10227289313300026118Switchgrass RhizosphereGVFVEAFNLFNTANFGGSFSGNSRSTNFRQPTDFVPGIGYARQVQLGARLLF
Ga0209481_1041989513300027880Populus RhizosphereEFFNLFNTANFGGSYTGNARSATFRQPTGFVPGIGYPRQAQWGVRYLF
Ga0209486_1101394623300027886Agricultural SoilNFGNAYTGNARSVLFGQPTGTLIPGIGYPRTLQLGARLLF
Ga0207428_1107605623300027907Populus RhizosphereKFFNLGGGGERKIGIFAETFNIFNTANFGGQYGGNVRGTTFLQPTGFIPGIGGPRQVQLGARFLF
Ga0268265_1235271113300028380Switchgrass RhizosphereVVLDPRSTECFSLSGGRKIWVFTEAFNLLNDVNFGGSYTGATTSTNFRQPSGRFISGIGYPRQVQLGARFIL
Ga0268264_1153920923300028381Switchgrass RhizosphereIRTTKFFNLGGGGERKIGIFAETFNIFNTANFGGQYGGNVRGTTFLQPTGFIPGIGGPRQLQLGARFLF
Ga0307504_1022445723300028792SoilKFIALGGEKKLGIFVELFNMFNTANFGASYSGNASSVNFRQPTGFIPGIGYPRQVQLGSRFLF
Ga0307312_1097312323300028828SoilAEFFNLFDTVNFGGSFTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF
Ga0307501_1012683313300031152SoilALGAERKVGVFAELFNALNNANFGGAYTGNARSVTFRQPSGTLIPGIGYPRTLQLGARFL
Ga0307469_1065897513300031720Hardwood Forest SoilFNTVNFGGSYTGNARSATFRQPTGIIPGIGYPRQAQLGVRFLF
Ga0307469_1078605113300031720Hardwood Forest SoilAEFFNLFNTANFGQNYTGNARSSAFRQPNNFVAGIGYPRQAQLGLRFVF
Ga0307468_10084018813300031740Hardwood Forest SoilFNAFNTANFGANYSGNASSVNFRQPTGFIPGIGYPRQVQIGSRFLF
Ga0307468_10153800023300031740Hardwood Forest SoilVNFGGSFTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF
Ga0307473_1138060613300031820Hardwood Forest SoilFAEAFNLFNTSNFGASYTGNARSASFRQPTGFIPGIGYPRQLQLGARFLF
Ga0310893_1013013123300031892SoilGLFAEVFNVFNTANFGASYQENSRSAQFKQPIGFLPSIGIPRQVQFGARYQF
Ga0310885_1013776013300031943SoilKLGVFVEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF
Ga0310885_1051075823300031943SoilTANFGERYQGNGRSTAFRQPNNFVAGVGYPRQAQIGVRFLF
Ga0310903_1004887213300032000SoilDRRIAVFGEVFNVLNNANFGGSYTGNGRSVLFRQPSGGFIPAIGYPRQLQLGARFLF
Ga0315912_1088306813300032157SoilKFVELGGARRLGLFAEFFNLFDTVNLGSSFNGNGSSATFRQASGGFVPGIGYARQAQLGVRFLF
Ga0307471_10077854623300032180Hardwood Forest SoilVNFGGSYTGNARSATFRQPTGFIPGIGYPRQAQLGVRFLF
Ga0307471_10260001623300032180Hardwood Forest SoilKFFALSGERKVGIFVELFNMFNTANFGGSYTGNARSSNFQLPSGSFIPGIGYARQVQLGARLLF
Ga0307471_10414283013300032180Hardwood Forest SoilDRRIATFVELFNALNNVNFGGSYTGNGRSVLFRQPSGGFIPGIGYPRQVQLGARFLF
Ga0310896_1057428923300032211SoilLGGAGGRKLGVFVEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFL
Ga0310812_1023983123300032421SoilFFDLGGAGSRKLGVFVEAFNLFNTANFGGSFSGNARSTNFRQPTDFVPGIGYARQVQLGARFLF
Ga0214472_1138667513300033407SoilTTKFLELGGDRRLGLFAEVFNVFNIVNFGASYTGNGRSATFRQPTGFVPGIGYPRQLQLGARFLF
Ga0247830_1137128313300033551SoilIDLGGERRVGVFVEVFNVFNTVNFGGQYNGNGRSSAFQQPTGFIPGIGYPRQVQLGARFL
Ga0364926_017127_1166_12733300033812SedimentSYIGNGRSVVFRQPNEVIPGIGYPRQLQLGARFLF
Ga0364925_0015564_3_1823300034147SedimentGSDRRIATFVELFNALNNVNFGGSYTGNGRSVLFRQPSGGFIPGIGYPRQVQLGARFLF
Ga0364929_0364680_2_1783300034149SedimentGGEKKVGIFAEVFNVFNTDNFGGSYGGNARGTTFRQPTGFITGIGGPRQLQLGARFLF
Ga0364933_032246_1_1473300034150SedimentIFNVLDNVNLGGDFTGNARSALFRQPTGGFIPGIGYPRQLQLGARFLF
Ga0364933_046398_947_10723300034150SedimentTANFGANYSGNASSVNFRQPTGFIPSIGYPRQVQIGSRFLF
Ga0364931_0109080_8_1423300034176SedimentMFNTANFGANYSGNASSVNFRQPTGFIPSIGYPRQVQIGSRFLF
Ga0364931_0130911_599_8023300034176SedimentRATKFFPLGGERRLGVLVEVFNALDNVNLGGDFTGNARSALFRQPTGGFIPGIGYPRQLQLGARFLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.