NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F021836

Metagenome / Metatranscriptome Family F021836

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F021836
Family Type Metagenome / Metatranscriptome
Number of Sequences 217
Average Sequence Length 45 residues
Representative Sequence MSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALR
Number of Associated Samples 157
Number of Associated Scaffolds 217

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.70 %
% of genes from short scaffolds (< 2000 bps) 93.55 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.931 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(39.171 % of family members)
Environment Ontology (ENVO) Unclassified
(36.406 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(37.327 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.56%    β-sheet: 0.00%    Coil/Unstructured: 44.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 217 Family Scaffolds
PF00881Nitroreductase 7.37
PF13671AAA_33 5.07
PF06210DUF1003 2.30
PF07969Amidohydro_3 2.30
PF00903Glyoxalase 1.84
PF13520AA_permease_2 1.84
PF00196GerE 1.38
PF00696AA_kinase 1.38
PF02720DUF222 1.38
PF13546DDE_5 1.38
PF12161HsdM_N 1.38
PF00069Pkinase 1.38
PF07690MFS_1 0.92
PF00126HTH_1 0.92
PF01068DNA_ligase_A_M 0.92
PF01872RibD_C 0.92
PF01726LexA_DNA_bind 0.92
PF00717Peptidase_S24 0.46
PF01230HIT 0.46
PF13185GAF_2 0.46
PF03959FSH1 0.46
PF00226DnaJ 0.46
PF03109ABC1 0.46
PF05960DUF885 0.46
PF08734GYD 0.46
PF00441Acyl-CoA_dh_1 0.46
PF11706zf-CGNR 0.46
PF00690Cation_ATPase_N 0.46
PF13424TPR_12 0.46
PF13613HTH_Tnp_4 0.46
PF00872Transposase_mut 0.46
PF00378ECH_1 0.46
PF04072LCM 0.46
PF02371Transposase_20 0.46
PF00561Abhydrolase_1 0.46
PF02566OsmC 0.46
PF03729DUF308 0.46
PF06527TniQ 0.46
PF04954SIP 0.46
PF06053DUF929 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 217 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 5.53
COG4420Uncharacterized membrane proteinFunction unknown [S] 2.30
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.92
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.92
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.92
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.92
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.46
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.46
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.46
COG3547TransposaseMobilome: prophages, transposons [X] 0.46
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.46
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.46
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.46
COG2375NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domainsInorganic ion transport and metabolism [P] 0.46
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.46
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.46
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.46
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.46
COG0400Predicted esteraseGeneral function prediction only [R] 0.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.93 %
UnclassifiedrootN/A5.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0586936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1499Open in IMG/M
3300003368|JGI26340J50214_10140069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300003505|JGIcombinedJ51221_10146786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii952Open in IMG/M
3300005332|Ga0066388_108345102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300005434|Ga0070709_11107428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus634Open in IMG/M
3300005435|Ga0070714_100458620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1211Open in IMG/M
3300005435|Ga0070714_100634650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1027Open in IMG/M
3300005435|Ga0070714_101619364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300005436|Ga0070713_100886785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia858Open in IMG/M
3300005436|Ga0070713_102243864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii529Open in IMG/M
3300005437|Ga0070710_10099628All Organisms → cellular organisms → Bacteria1728Open in IMG/M
3300005437|Ga0070710_10264906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1109Open in IMG/M
3300005437|Ga0070710_10628232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii750Open in IMG/M
3300005439|Ga0070711_100896456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300005445|Ga0070708_100598533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1039Open in IMG/M
3300005467|Ga0070706_100029354All Organisms → cellular organisms → Bacteria5067Open in IMG/M
3300005841|Ga0068863_102385998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300006028|Ga0070717_10023566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae4879Open in IMG/M
3300006028|Ga0070717_10557946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1037Open in IMG/M
3300006059|Ga0075017_100862773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii702Open in IMG/M
3300006173|Ga0070716_100696945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii775Open in IMG/M
3300006175|Ga0070712_100557009All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300006237|Ga0097621_102301695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii515Open in IMG/M
3300006804|Ga0079221_10306659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus935Open in IMG/M
3300006806|Ga0079220_11515473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii576Open in IMG/M
3300006806|Ga0079220_11661353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii556Open in IMG/M
3300006854|Ga0075425_100188343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2370Open in IMG/M
3300006903|Ga0075426_10528460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales878Open in IMG/M
3300006914|Ga0075436_100977556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii635Open in IMG/M
3300007076|Ga0075435_100614527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii943Open in IMG/M
3300007788|Ga0099795_10435286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300009012|Ga0066710_102783050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia693Open in IMG/M
3300009093|Ga0105240_11337412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii755Open in IMG/M
3300009101|Ga0105247_10109766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1774Open in IMG/M
3300010048|Ga0126373_11621658All Organisms → cellular organisms → Bacteria → Terrabacteria group711Open in IMG/M
3300010360|Ga0126372_10757719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii956Open in IMG/M
3300010361|Ga0126378_12361318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii607Open in IMG/M
3300010371|Ga0134125_11815298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii663Open in IMG/M
3300010375|Ga0105239_10442314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1474Open in IMG/M
3300010376|Ga0126381_101453631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii991Open in IMG/M
3300010376|Ga0126381_102352989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii765Open in IMG/M
3300010376|Ga0126381_102514573All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300010398|Ga0126383_12183437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii640Open in IMG/M
3300010401|Ga0134121_10908745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia856Open in IMG/M
3300010937|Ga0137776_1785543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1171Open in IMG/M
3300011119|Ga0105246_12086197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii549Open in IMG/M
3300012198|Ga0137364_10201505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1458Open in IMG/M
3300012199|Ga0137383_10126174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1868Open in IMG/M
3300012200|Ga0137382_10561517Not Available813Open in IMG/M
3300012354|Ga0137366_10514092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii864Open in IMG/M
3300012356|Ga0137371_10081510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2511Open in IMG/M
3300012362|Ga0137361_11457956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii607Open in IMG/M
3300012493|Ga0157355_1044626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii508Open in IMG/M
3300012930|Ga0137407_11241193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii708Open in IMG/M
3300012971|Ga0126369_12335246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii621Open in IMG/M
3300012985|Ga0164308_11552061Not Available610Open in IMG/M
3300012986|Ga0164304_11170049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii619Open in IMG/M
3300013296|Ga0157374_12029391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii601Open in IMG/M
3300013307|Ga0157372_10234896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2126Open in IMG/M
3300013307|Ga0157372_10355101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1708Open in IMG/M
3300013307|Ga0157372_11600931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii750Open in IMG/M
3300013308|Ga0157375_12307916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii641Open in IMG/M
3300015245|Ga0137409_10081338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3025Open in IMG/M
3300015371|Ga0132258_12381783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1326Open in IMG/M
3300015372|Ga0132256_100409554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1459Open in IMG/M
3300016294|Ga0182041_10605984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii963Open in IMG/M
3300016341|Ga0182035_11125836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium699Open in IMG/M
3300016341|Ga0182035_11446091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300016341|Ga0182035_11981290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii529Open in IMG/M
3300016357|Ga0182032_10616029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium904Open in IMG/M
3300016387|Ga0182040_10447109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia → unclassified Yinghuangia → Yinghuangia sp. KLBMP89221023Open in IMG/M
3300016404|Ga0182037_10345441All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300016404|Ga0182037_10639406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium906Open in IMG/M
3300016422|Ga0182039_12186763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii510Open in IMG/M
3300017821|Ga0187812_1188000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii661Open in IMG/M
3300017928|Ga0187806_1051886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1249Open in IMG/M
3300017928|Ga0187806_1293092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii572Open in IMG/M
3300017937|Ga0187809_10247357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii644Open in IMG/M
3300017942|Ga0187808_10290578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii736Open in IMG/M
3300017942|Ga0187808_10407253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii622Open in IMG/M
3300017959|Ga0187779_11280116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii518Open in IMG/M
3300017975|Ga0187782_10558508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria878Open in IMG/M
3300020580|Ga0210403_10224894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1540Open in IMG/M
3300020580|Ga0210403_10279575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1369Open in IMG/M
3300020583|Ga0210401_10593302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii969Open in IMG/M
3300020583|Ga0210401_10648252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii917Open in IMG/M
3300021171|Ga0210405_10426624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1043Open in IMG/M
3300021178|Ga0210408_10203989Not Available1572Open in IMG/M
3300021178|Ga0210408_10396188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1100Open in IMG/M
3300021180|Ga0210396_10623842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii936Open in IMG/M
3300021180|Ga0210396_11558015All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300021403|Ga0210397_11242059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii579Open in IMG/M
3300021406|Ga0210386_10594086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii956Open in IMG/M
3300021407|Ga0210383_11565620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii543Open in IMG/M
3300021420|Ga0210394_10428692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1164Open in IMG/M
3300021432|Ga0210384_10636663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora soyae956Open in IMG/M
3300021432|Ga0210384_11432514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300021432|Ga0210384_11538035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii571Open in IMG/M
3300021474|Ga0210390_11158154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii626Open in IMG/M
3300021475|Ga0210392_10135491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1666Open in IMG/M
3300021478|Ga0210402_11071274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii733Open in IMG/M
3300021559|Ga0210409_10078040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3072Open in IMG/M
3300021560|Ga0126371_11870200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acidicola720Open in IMG/M
3300022467|Ga0224712_10298062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii753Open in IMG/M
3300024251|Ga0247679_1081505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii545Open in IMG/M
3300025898|Ga0207692_10137693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1385Open in IMG/M
3300025898|Ga0207692_10265137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300025906|Ga0207699_10560482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii829Open in IMG/M
3300025909|Ga0207705_11016699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii640Open in IMG/M
3300025911|Ga0207654_11161246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300025913|Ga0207695_11659253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii520Open in IMG/M
3300025915|Ga0207693_10374197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1114Open in IMG/M
3300025916|Ga0207663_10396922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1054Open in IMG/M
3300025916|Ga0207663_10420534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1026Open in IMG/M
3300025916|Ga0207663_11075727Not Available646Open in IMG/M
3300025922|Ga0207646_10310090Not Available1426Open in IMG/M
3300025922|Ga0207646_10396167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1247Open in IMG/M
3300025928|Ga0207700_10123511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2102Open in IMG/M
3300025928|Ga0207700_10388027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1222Open in IMG/M
3300025928|Ga0207700_11043627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii731Open in IMG/M
3300025928|Ga0207700_11144486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii695Open in IMG/M
3300025928|Ga0207700_11386384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii625Open in IMG/M
3300025928|Ga0207700_11541546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii589Open in IMG/M
3300025929|Ga0207664_10143998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2019Open in IMG/M
3300025929|Ga0207664_10580959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1006Open in IMG/M
3300025929|Ga0207664_11079048Not Available718Open in IMG/M
3300025935|Ga0207709_10776987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii772Open in IMG/M
3300026318|Ga0209471_1320027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300026320|Ga0209131_1410714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii507Open in IMG/M
3300027100|Ga0208862_101486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300029636|Ga0222749_10824625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii507Open in IMG/M
3300031543|Ga0318516_10115851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Smaragdicoccus → Smaragdicoccus niigatensis1525Open in IMG/M
3300031544|Ga0318534_10487746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces705Open in IMG/M
3300031544|Ga0318534_10497232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300031545|Ga0318541_10267240All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300031545|Ga0318541_10547180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii648Open in IMG/M
3300031549|Ga0318571_10003315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3191Open in IMG/M
3300031549|Ga0318571_10419372All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031561|Ga0318528_10287468All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300031561|Ga0318528_10645014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii567Open in IMG/M
3300031561|Ga0318528_10795796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii506Open in IMG/M
3300031572|Ga0318515_10285214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii885Open in IMG/M
3300031572|Ga0318515_10673911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300031679|Ga0318561_10783168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii524Open in IMG/M
3300031681|Ga0318572_10465741All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300031681|Ga0318572_10479029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii741Open in IMG/M
3300031681|Ga0318572_10527509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii704Open in IMG/M
3300031681|Ga0318572_10611368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300031681|Ga0318572_10811526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii556Open in IMG/M
3300031713|Ga0318496_10121183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1416Open in IMG/M
3300031713|Ga0318496_10457959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii705Open in IMG/M
3300031718|Ga0307474_11588609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300031736|Ga0318501_10848095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii507Open in IMG/M
3300031744|Ga0306918_10674256All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300031748|Ga0318492_10480825All Organisms → cellular organisms → Bacteria → Terrabacteria group658Open in IMG/M
3300031751|Ga0318494_10314579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii904Open in IMG/M
3300031751|Ga0318494_10941222Not Available507Open in IMG/M
3300031771|Ga0318546_11188151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii536Open in IMG/M
3300031771|Ga0318546_11301938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii510Open in IMG/M
3300031779|Ga0318566_10230108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii920Open in IMG/M
3300031781|Ga0318547_10047071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae2306Open in IMG/M
3300031781|Ga0318547_10504889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii747Open in IMG/M
3300031781|Ga0318547_10978893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii528Open in IMG/M
3300031798|Ga0318523_10087746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1514Open in IMG/M
3300031799|Ga0318565_10374233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii691Open in IMG/M
3300031805|Ga0318497_10425749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii743Open in IMG/M
3300031805|Ga0318497_10496680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii683Open in IMG/M
3300031821|Ga0318567_10158088All Organisms → cellular organisms → Bacteria → Terrabacteria group1256Open in IMG/M
3300031821|Ga0318567_10470588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii713Open in IMG/M
3300031821|Ga0318567_10890816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii504Open in IMG/M
3300031823|Ga0307478_10646354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii885Open in IMG/M
3300031831|Ga0318564_10340631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii659Open in IMG/M
3300031845|Ga0318511_10633802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii500Open in IMG/M
3300031846|Ga0318512_10312709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii782Open in IMG/M
3300031859|Ga0318527_10187244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300031879|Ga0306919_10092964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2105Open in IMG/M
3300031890|Ga0306925_12026332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii542Open in IMG/M
3300031893|Ga0318536_10594142All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300031897|Ga0318520_10861854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii569Open in IMG/M
3300031912|Ga0306921_11136398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia873Open in IMG/M
3300031942|Ga0310916_10778131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii807Open in IMG/M
3300031945|Ga0310913_10163389All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300031947|Ga0310909_10401064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1152Open in IMG/M
3300031959|Ga0318530_10192345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii836Open in IMG/M
3300031962|Ga0307479_11791125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300032001|Ga0306922_12336383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300032008|Ga0318562_10323198Not Available897Open in IMG/M
3300032025|Ga0318507_10175951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium920Open in IMG/M
3300032039|Ga0318559_10424357Not Available620Open in IMG/M
3300032041|Ga0318549_10182022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium941Open in IMG/M
3300032043|Ga0318556_10477470All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300032043|Ga0318556_10483094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii648Open in IMG/M
3300032044|Ga0318558_10338396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii746Open in IMG/M
3300032054|Ga0318570_10463846All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300032066|Ga0318514_10134521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1275Open in IMG/M
3300032068|Ga0318553_10407834All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300032089|Ga0318525_10157468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1166Open in IMG/M
3300032089|Ga0318525_10212248Not Available995Open in IMG/M
3300032089|Ga0318525_10703325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii514Open in IMG/M
3300032090|Ga0318518_10250902All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300032091|Ga0318577_10580643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii533Open in IMG/M
3300032261|Ga0306920_100540607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1727Open in IMG/M
3300032261|Ga0306920_103626995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300032782|Ga0335082_10551347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1015Open in IMG/M
3300032782|Ga0335082_10885601Not Available755Open in IMG/M
3300032805|Ga0335078_11100095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300032828|Ga0335080_10675570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1079Open in IMG/M
3300032828|Ga0335080_11473117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300032829|Ga0335070_10709100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria940Open in IMG/M
3300032892|Ga0335081_10370684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1855Open in IMG/M
3300032892|Ga0335081_12589179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii521Open in IMG/M
3300032893|Ga0335069_10010842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia12895Open in IMG/M
3300032893|Ga0335069_10205536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2396Open in IMG/M
3300032893|Ga0335069_11887444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300032954|Ga0335083_10548577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii960Open in IMG/M
3300033004|Ga0335084_12018647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii562Open in IMG/M
3300033289|Ga0310914_11423652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil39.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.37%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.99%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.15%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.46%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.46%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.46%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.46%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027100Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF025 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_058693623300000156Sugar Cane Bagasse Incubating BioreactorMSTMDERTDIGSRTRAGLARLAGPWWLFLLTGIAXXXXPVSESG*
JGI26340J50214_1014006923300003368Bog Forest SoilMSTMEERTDIGSRTRAGLSRLAGPWWLFLLTGIAWLILAWI
JGIcombinedJ51221_1014678613300003505Forest SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFAPAS
Ga0066388_10834510213300005332Tropical Forest SoilVSTTHERATFGSRTRAGLWRLAGPWWMFLITGIAWLIIAWI
Ga0070709_1110742813300005434Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTAIRSRTRAGLARLAGPWWMFLLTGIAWLILAW
Ga0070714_10045862013300005435Agricultural SoilMSAMDERTALRSRTRAGLARLAGPWWMFLLTGIAWLILSW
Ga0070714_10063465013300005435Agricultural SoilMSTMDGRTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIA
Ga0070714_10161936413300005435Agricultural SoilMSAMDERADVRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPASIPTVGVL
Ga0070713_10088678523300005436Corn, Switchgrass And Miscanthus RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFNPASIPT
Ga0070713_10224386423300005436Corn, Switchgrass And Miscanthus RhizosphereMSAMDETTAIRSRPRAGLWRLAGPWWMFLLTGIAWLILSWVALRFTPASVPTVGALL
Ga0070710_1009962833300005437Corn, Switchgrass And Miscanthus RhizosphereMSTMDDRTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFNPASI
Ga0070710_1026490613300005437Corn, Switchgrass And Miscanthus RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIAL
Ga0070710_1062823223300005437Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTALRSRTRAALWRLAGPWWMFLLTGIAWLLVSVFILRITTASV
Ga0070711_10089645623300005439Corn, Switchgrass And Miscanthus RhizosphereMSVMDERTAGRSRARATLWRLAGPWWMFLLTGIAWLLVSVFILRITT
Ga0070708_10059853333300005445Corn, Switchgrass And Miscanthus RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIA
Ga0070706_10002935413300005467Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIAL
Ga0068863_10238599813300005841Switchgrass RhizosphereMSAMDERTAIRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPASIPTV
Ga0070717_1002356693300006028Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIA
Ga0070717_1055794623300006028Corn, Switchgrass And Miscanthus RhizosphereMSTMDGRTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRF
Ga0075017_10086277313300006059WatershedsMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFTPASIP
Ga0070716_10069694513300006173Corn, Switchgrass And Miscanthus RhizosphereMSAMDEPTALRSRTRSALWRLAGPWWMFLLTGIAWLLVSVFILRITTASVATVGVLM
Ga0070712_10055700923300006175Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLI
Ga0097621_10230169533300006237Miscanthus RhizosphereMSTMDGRTDVRSRTRAGLARLAGPWWIFLLTGIGW
Ga0079221_1030665913300006804Agricultural SoilMSAMDERTAIRSRTRAGLAQLAGPWWMFLLTGIAWLILAWIA
Ga0079220_1151547323300006806Agricultural SoilMSAMDERAAIRSRTRAGLARLAGPWWMFLLTGIAWLILAWI
Ga0079220_1166135323300006806Agricultural SoilMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLIL
Ga0075425_10018834343300006854Populus RhizosphereMSTMDEGTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAW
Ga0075426_1052846023300006903Populus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILAW
Ga0075436_10097755623300006914Populus RhizosphereMSAMDERTAIRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAP
Ga0075435_10061452723300007076Populus RhizosphereMSAMDERTAIRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPAS
Ga0099795_1043528623300007788Vadose Zone SoilMSAMDERTDIRSRTRAGLSRLAGPWWIFLLTGIAWLIIAWVVLRFTP
Ga0066710_10278305023300009012Grasslands SoilMSTMDERTDVQSRTRAGLARLAGPWWMFLLTGIGWLILAWIALRF
Ga0105240_1133741223300009093Corn RhizosphereMSTMDDRTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAW
Ga0105247_1010976613300009101Switchgrass RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAW
Ga0126373_1162165823300010048Tropical Forest SoilMSTMDESTAIRSGPRAGLARLAGPWWIFLLTGIAWLI
Ga0126372_1075771913300010360Tropical Forest SoilMDERTAMRSRSLAGLSRLAGPWWIFLLTGIAWLVLAW
Ga0126378_1236131823300010361Tropical Forest SoilMSAMDERTAIRSRTRAGLWRLAGPWWVFLVTGIAWLIISVMVLRF
Ga0134125_1181529813300010371Terrestrial SoilMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAW
Ga0105239_1044231413300010375Corn RhizosphereMDDRTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALR
Ga0126381_10145363113300010376Tropical Forest SoilMDERTAIRSRTRAGLWRLAGPWWLFLVTGIAWLIISVMVLRFNPASIA
Ga0126381_10235298913300010376Tropical Forest SoilMSAMDERTDIGSRARAGLWRLAGPWWMFLVTGIAWLIISVMVLRFTPAS
Ga0126381_10251457313300010376Tropical Forest SoilMSTTDERAAMGRRARAGLWRLAGPWWMFLVTGIAWLIIAWVVLRFTPAS
Ga0126383_1218343713300010398Tropical Forest SoilMSTMDERTDIGSRTRAGLARLAGPWWLFLLTGIAWLILAWIALRF
Ga0134121_1090874513300010401Terrestrial SoilMSTMDGRTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPASIPTVGVL
Ga0137776_178554323300010937SedimentMSTMEERTDIGSRSRAGLARLAGPWWLFLLTGIAWLILAWIALRFN
Ga0105246_1208619713300011119Miscanthus RhizosphereMSTMDGRTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAW
Ga0137364_1020150513300012198Vadose Zone SoilMSATDEPTAIRSRTRAGLWRLAGPWWMFLLTGVAWLILSWVALTL*
Ga0137383_1012617413300012199Vadose Zone SoilMSAMDERTDIGSRTRAGLSRLAGPWWMFLLTGIAWLIIAWVVLRFTPASVAT
Ga0137382_1056151723300012200Vadose Zone SoilMSAMDERTDVRSRTRAGLARLAGPWWVFLLTGIGWLILAWIA
Ga0137366_1051409223300012354Vadose Zone SoilMSAMDERTAIRSRTRAGLWRLAGPWWMFLLTGIAWLILSWVALR
Ga0137371_1008151043300012356Vadose Zone SoilMSATDEPTAIRSRTRAGLWRLAGPWWMFLLTGVAWLILSWVALTIC*
Ga0137361_1145795613300012362Vadose Zone SoilMSAMDERADVRSRTRAGLARLAGPWWIFLLTGIGWL
Ga0157355_104462613300012493Unplanted SoilMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPASIPTVGVLL
Ga0137407_1124119313300012930Vadose Zone SoilMSAMDERTDIGSRTRAGLARLAGPWWVFLLTGIGWLILSWI
Ga0126369_1233524623300012971Tropical Forest SoilMSAMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLIL
Ga0164308_1155206123300012985SoilMSTMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLI
Ga0164304_1117004923300012986SoilMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPASIPTV
Ga0157374_1202939113300013296Miscanthus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILS
Ga0157372_1023489643300013307Corn RhizosphereMDERTDIASRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFN
Ga0157372_1035510133300013307Corn RhizosphereMSTMDDRTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFNPA
Ga0157372_1160093113300013307Corn RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWL
Ga0157375_1230791613300013308Miscanthus RhizosphereMSTMDDRTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFNP
Ga0137409_1008133823300015245Vadose Zone SoilMSAMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPASI
Ga0132258_1238178313300015371Arabidopsis RhizosphereMSAMDDRTAIRSRTRAGLARLAGPWWMFLLTGIGWLILSWIALR
Ga0132256_10040955433300015372Arabidopsis RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLIFAWIALRFT
Ga0182041_1060598413300016294SoilMSAMDDRTAIQTRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPASIPTVGVLL
Ga0182035_1112583623300016341SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLIIAWVTLRFAPA
Ga0182035_1144609123300016341SoilMSTMDERAAALRSRTRAGLWRLAGPWWVFLVTGIAWLIIAWVVL
Ga0182035_1198129013300016341SoilMSAMDERTDVGSRTRAGLARLAGPWWMFLLTGIGWLILAWIALRFNPASIPT
Ga0182032_1061602913300016357SoilMSTMDERAAALRSRTRAGLWRLAGPWWLFLVTGIAWLIIAWV
Ga0182040_1044710913300016387SoilMNATHERTDIGSRTRAGLARLAGPWWMFLLTGIAWLILAW
Ga0182037_1034544123300016404SoilMSATDERTAFGSRARAGLWRMAGPWWVFLLTGIAWLIISVMVLRF
Ga0182037_1063940623300016404SoilMANTAERHVGSSVRAGLWRLAGPWWLFLATGIAWLIIAW
Ga0182039_1218676313300016422SoilMNATDERTAIPSRTRARLWQLAGPWWTFLLTGLAWLILAWIV
Ga0187812_118800013300017821Freshwater SedimentMSAMDETTAIRSRTRAGLWRLAGPWWMFLLTGIAWLILSWVALRFTPASVPTVG
Ga0187806_105188613300017928Freshwater SedimentMSAMDETTAIRSRTRAGLWRLAGPWWMFLLTGIAWLILSWVALRFTPASVPTVGALLGGILARTILNR
Ga0187806_129309213300017928Freshwater SedimentMSAMNEPTAIRSRTRAGLAQLAGPWWMFLLTGIAWLILAWIALRFNPASIPTVG
Ga0187809_1024735713300017937Freshwater SedimentMSAMDERTAIGSRTRAGLARLAGPWWMFLLTGIGWLILAWIALRLT
Ga0187808_1029057813300017942Freshwater SedimentMSAMDETTAIRSRTRAGLWRLAGPWWMFLLTGIAWLILSWVALRFTPASVPTVGALL
Ga0187808_1040725313300017942Freshwater SedimentMSAMDEHADIQSRARAGLARLAGPWWIFLLTGIGWL
Ga0187779_1128011613300017959Tropical PeatlandMSAMDERTDVGSRTRAGLARLAGPWWLFLLTGIAWLILAWI
Ga0187782_1055850813300017975Tropical PeatlandMSTMDERTTIGSRTRAGLWRLAGPWWVFLLTGIAWLIIGWIALRF
Ga0210403_1022489413300020580SoilMSAMDERTDVQSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFTPASIPTV
Ga0210403_1027957513300020580SoilMSAMDERTDIQSGARAGLARLAGPWWIFLLTGIGWLILAWIALR
Ga0210401_1059330213300020583SoilMSAMDERTDIQSRTRAGLARLAGPWWIFLLTGLGWLILAWIALRFA
Ga0210401_1064825223300020583SoilMSTMDERAAVGSRTRAGLARLAGPWWIFLLTGIAWLILAWIALRFTPAS
Ga0210405_1042662413300021171SoilMSAMDERTDIQSGARAGLARLAGPWWIFLLTGIGWLILAWIALRFAPA
Ga0210408_1020398913300021178SoilMSTMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFTP
Ga0210408_1039618813300021178SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFA
Ga0210396_1062384213300021180SoilMSAMDERTDIQSRTRAGLARLAGPWWIFLLTGIGWLILA
Ga0210396_1155801513300021180SoilMSTMDEAIGSRTRSGLARLAGPWWIFLLTGIAWLILA
Ga0210397_1124205913300021403SoilMSAMDERTDIQSRTRAGLARLAGPWWIFLLTGIGWLIIAWIALR
Ga0210386_1059408613300021406SoilMSAMDERTDIQSRTRAGLARLAGPWWIFLLTGLGWLILAWIALRFAPA
Ga0210383_1156562013300021407SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLIL
Ga0210394_1042869213300021420SoilMSTMDERAAVGSRTRAGLARLAGPWWIFLLTGIAWLILAWIALRFSPASIPT
Ga0210384_1063666313300021432SoilMSTMDERTDVRSRTRAGLARLAGPWWVFLLTGIGWLILAWIALRFAPASIPTV
Ga0210384_1143251413300021432SoilMSAMDERTDIQSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPAS
Ga0210384_1153803513300021432SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFAP
Ga0210390_1115815413300021474SoilMSAMDERTDIQSRTRAGLARLAGPWWIFLLTGLGWL
Ga0210392_1013549143300021475SoilMSAMDERTDVQSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFTPASIPTVGVL
Ga0210402_1107127423300021478SoilMSAMDERTAIRSRTRAGLARLAGPWWMFLLTGIAWLILSWVALR
Ga0210409_1007804013300021559SoilMSTMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILS
Ga0126371_1187020013300021560Tropical Forest SoilMSAMDERTAVRSRTRAGLARLAGPWWMFLLTGIAWLILA
Ga0224712_1029806213300022467Corn, Switchgrass And Miscanthus RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPASIPTVGVL
Ga0247679_108150513300024251SoilMSTMDERTPVGSRTRAGLWRLAGPWWMFLLTGIAWLIIGWIAL
Ga0207692_1013769313300025898Corn, Switchgrass And Miscanthus RhizosphereMSTMDDRTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIA
Ga0207692_1026513733300025898Corn, Switchgrass And Miscanthus RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWVFLLTGIGWLILSW
Ga0207699_1056048223300025906Corn, Switchgrass And Miscanthus RhizosphereMSAMGETTAIRSRPRAGLWRLAGPWWMFLLTGIAWLILSWVALRFT
Ga0207705_1101669923300025909Corn RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAP
Ga0207654_1116124623300025911Corn RhizosphereMSTMDGRTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAP
Ga0207695_1165925313300025913Corn RhizosphereMSAMDERTDIASRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFN
Ga0207693_1037419713300025915Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIGWLILSWIALRFAPAS
Ga0207663_1039692223300025916Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPASIPTVGVL
Ga0207663_1042053413300025916Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTAIRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPASIPTVG
Ga0207663_1107572723300025916Corn, Switchgrass And Miscanthus RhizosphereMSAMDERADVRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPASIP
Ga0207646_1031009033300025922Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTAIRSRTRAGLWRLAGPWWMFLLTGIAWFIIAW
Ga0207646_1039616723300025922Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILA
Ga0207700_1012351133300025928Corn, Switchgrass And Miscanthus RhizosphereMSTMDEGTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPA
Ga0207700_1038802723300025928Corn, Switchgrass And Miscanthus RhizosphereMSTMDDRTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFNPASIP
Ga0207700_1104362723300025928Corn, Switchgrass And Miscanthus RhizosphereMSAMDEQTAIRSRTRAGLARLAGPWWMFLLTGIAWLILAWI
Ga0207700_1114448623300025928Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTALRSRTRAALWRLAGPWWMFLLTGIAWLLV
Ga0207700_1138638423300025928Corn, Switchgrass And Miscanthus RhizosphereMSAMDERTAIRSRTRAGLWRLAGPWWMFLVTGIAWLIIAVMVLR
Ga0207700_1154154613300025928Corn, Switchgrass And Miscanthus RhizosphereMSTMDERAAVGSRTRAGLARLAGPWWVFLLTGIAWLILAWIA
Ga0207664_1014399813300025929Agricultural SoilMSAMDERTRIRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPASIPTVGVL
Ga0207664_1058095923300025929Agricultural SoilMSTMDGRTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWI
Ga0207664_1107904823300025929Agricultural SoilMSTMDERTDVRSRTRAGLARLAGPWWVFLLTGIGWLILAWIALR
Ga0207709_1077698713300025935Miscanthus RhizosphereMSTMDERTDVRSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPA
Ga0209471_132002723300026318SoilMSTMDERTDVRSRTRAGLARLAGPWWVFLLTGIGWL
Ga0209131_141071413300026320Grasslands SoilMSAMDERTALRSRTRAALWRLAGPWWMFLVTGTAWLIASVLVLRITTASVATVGV
Ga0208862_10148613300027100Forest SoilMSAMDERTALRSRTRAGLARLAGPWWMFLLTGIAWLILSWIA
Ga0222749_1082462513300029636SoilMSAMDERTDVGSRTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPASIPTVGVLL
Ga0318516_1011585113300031543SoilMSAMDDRTAIQTRTRAGLARLAGPWWMFLLTGIAW
Ga0318534_1048774623300031544SoilMNATHERTDIGSRTRAGLARLAGPWWMFLLTGIAWL
Ga0318534_1049723213300031544SoilMSAMDERTDIQSRARAGLARLAGPWWMFLLTGIGWLI
Ga0318541_1026724033300031545SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLIIAWVTLRFAPPR
Ga0318541_1054718013300031545SoilMSAMDERTPIQSRTRAGLARLAGPWWMFLLTGIGWLILAWIALRFT
Ga0318571_1000331523300031549SoilMSTMDDTSIGSRTRAGLWRLAGPWWIFLLTGIAWLIIGWIVLRFNPA
Ga0318571_1041937223300031549SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLIIA
Ga0318528_1028746833300031561SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLI
Ga0318528_1064501413300031561SoilMSAMHERTDVGSRTRAGLARLAGPWWIFLLTGIGWLILAWIA
Ga0318528_1079579623300031561SoilMSTMDEVHSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPASIPTVGVLL
Ga0318515_1028521423300031572SoilMSAMDDRTAIQTRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPASIPTV
Ga0318515_1067391113300031572SoilMSAMDERTDVRSRTRAGLAHLAGPWWIFLLTGIGWLILAWIALR
Ga0318561_1078316813300031679SoilMSTIDEGTDIRSRSRAGLARLAGPWWMFLLTGIAWLILAW
Ga0318572_1046574123300031681SoilMSTTHERTTMGRRARAGLWRLAGPWWLFLVTGIAWLII
Ga0318572_1047902913300031681SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWL
Ga0318572_1052750913300031681SoilMSAMDERTAIPSRTRARLSQLAGPWWTFLLTGLAWLILAWIVL
Ga0318572_1061136813300031681SoilMSAMDERTDIRSRTRAGLSRLAGPWWIFLLTGIAW
Ga0318572_1081152613300031681SoilMANTAERHVGSSVRAGLWRLAGPWWLFLATGIAWLI
Ga0318496_1012118323300031713SoilMNATHERTDIGSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPASIPTV
Ga0318496_1045795923300031713SoilMNATDERTAIPSRTRARLWQLAGPWWTFLLTGLAWLILAW
Ga0307474_1158860923300031718Hardwood Forest SoilMSTMEERTDIGSRTRAGLSRLAGPWWLFLLTGIAWLI
Ga0318501_1084809513300031736SoilMNATDERTAIPSRTRARLWQLAGPWWTFLLTGLAWLILAWIVLRFTPASVPTVGV
Ga0306918_1067425623300031744SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLIIAWVTL
Ga0318492_1048082513300031748SoilMSAMDERTAIRSRTRAGLWRLAGPWWLFLVTGIAWLIISVMV
Ga0318494_1031457923300031751SoilMSAMDERTANPSRTRARLWQLAGPWWTFLLTGLAWLILAWIVLRFTPASVPT
Ga0318494_1094122223300031751SoilMLMNAMDERAAIRSRTRAGLARLAGPWWMFLLTGIAWLILA
Ga0318546_1118815123300031771SoilMSAMDERTANPSRTRARLWQLAGPWWTFLLTGLAWLILA
Ga0318546_1130193813300031771SoilMNATHERTDIGSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNP
Ga0318566_1023010813300031779SoilMSAMDDRTAIQTRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPASIPTVGV
Ga0318547_1004707113300031781SoilMSTMDDTSIGSRTRAGLWRLAGPWWIFLLTGIAWLIIGWIVLRFNPAS
Ga0318547_1050488913300031781SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFTPA
Ga0318547_1097889313300031781SoilMSTIDEGTDIRSRSRAGLARLAGPWWMFLLTGGAWLILAWIALRFNPA
Ga0318523_1008774633300031798SoilMSAMDERTDVRSRTLAGLARLAGPWWIFLLTGIGWL
Ga0318565_1037423313300031799SoilMSAMDERTTLGSRTRAGLWRLAGPWWLFLLTGIAW
Ga0318497_1042574913300031805SoilMSAMDERTAIRSRTRAGLARLAGPWWIFLLTGIGWLIL
Ga0318497_1049668023300031805SoilMSAMDDRTAIQTRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPASIPTVGVL
Ga0318567_1015808813300031821SoilMNAMDERTDVGSRTRAGLARLAGPWWLFLLTGIAWLILAWIA
Ga0318567_1047058813300031821SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFTPASIPTV
Ga0318567_1089081613300031821SoilMSTMDDRTANHARTRAGLARLAGPWWIFLLTGIGWLILAWIALRF
Ga0307478_1064635423300031823Hardwood Forest SoilMSTMDEGTAIGSRSRAGLARLAGPWWMFLLTGIAWLILA
Ga0318564_1034063113300031831SoilMSTIDEGTDIRSRSRAGLARLAGPWWMFLLTGIAWLILAWIALR
Ga0318511_1063380213300031845SoilMSAMDERTAIPSRTRARLWQLAGPWWTFLLTGLAWLILAWIVLRFTPASVP
Ga0318512_1031270913300031846SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRFTPASI
Ga0318527_1018724413300031859SoilMSTMDERAAALRSRTRAGLWRLAGPWWVFLVTGIAWLIIAWVVLRFTPASIT
Ga0306919_1009296413300031879SoilMSAMDERTDVRSRTRAGLAHLAGPWWIFLLTGIGWLILAWIALRFTP
Ga0306925_1202633213300031890SoilMSTMDDRTANHARTRAGLARLAGPWWIFLLTGIGWLILAWIALRFAPASIPTVGVLL
Ga0318536_1059414213300031893SoilMSTTDERTTMGRRARAGLWRLAGPWWLFLVTGIAWL
Ga0318520_1086185413300031897SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAW
Ga0306921_1113639813300031912SoilMSAMDERTDIRSRTRAGLSRLAGPWWIFLLTGIAWLIIAWVVLRF
Ga0310916_1077813133300031942SoilMSGMDERTAIPSRTRARLWQLAGPWWTFLLTGLAWLILAWIVL
Ga0310913_1016338913300031945SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLIIAWVTLRF
Ga0310909_1040106413300031947SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLIIAWVTLRFTPASLTTVGV
Ga0318530_1019234523300031959SoilMNATDERTAIPSRTRARLWQLAGPWWTFLLTGLAWLILA
Ga0307479_1179112513300031962Hardwood Forest SoilMSAMDERTDIQSRTRTGLARLAGPWWIFLLTGIGWLIL
Ga0306922_1233638313300032001SoilMSAMDERTDIQSRARAGLARLAGPWWIFLLTGIGWLILAWIALRF
Ga0318562_1032319813300032008SoilMLMNAMDERAAIRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRF
Ga0318507_1017595123300032025SoilMSTMDERAAALRSRTRAGLWRLAGPWWLFLVTGIAWLIIAWVVLRFTPASITT
Ga0318559_1042435713300032039SoilMSAMDESTAVRSRTRAGLARLAGPWWMFLLTGIAWLI
Ga0318549_1018202213300032041SoilMSTMDERAAALRSRTRAGLWRLAGPWWLFLVTGIAWLIIAWVVLRFTPASIT
Ga0318556_1047747023300032043SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLIIAWVTLRFAPASPTT
Ga0318556_1048309413300032043SoilMSTIDEGTDIRSRSRAGLARLAGPWWMFLLTGIAWLILAWIALRF
Ga0318558_1033839613300032044SoilMSAMDERTAIPSRTRARLSQLAGPWWTFLLTGLAWLILAW
Ga0318570_1046384623300032054SoilMSTTDERTTMGRRARAGLWRLAGPWWLFLVTGIAWLIIAWVTLRFT
Ga0318514_1013452113300032066SoilMSTTDERTTMGRRARAGLWRLAGPWWLFLVTGIAWLIIAWV
Ga0318553_1040783423300032068SoilMTVSTTHERATFGSRTRAGLWRLAGPWWMFLVTGIAWLII
Ga0318525_1015746823300032089SoilMNATDERTAIPSRTRARLWQLAGPWWTFLLTGLAWLI
Ga0318525_1021224823300032089SoilMSAMDESTAVRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPASIPTVG
Ga0318525_1070332523300032089SoilMSAMDDRTAIQTRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFNPAS
Ga0318518_1025090213300032090SoilMSTTHERTTMGRRARAGLWRLAGPWWLFLLTGIAWLIIAWVTLRF
Ga0318577_1058064313300032091SoilMSAMDERTDVRSRTRAGLAHLAGPWWIFLLTGIGWLILAWIALRFTPASIPTVGV
Ga0306920_10054060733300032261SoilMSTTDERTTMGRRARAGLWRLAGPWWLFLVTGIAWLIIAWVTLRFTPASLTTVGVL
Ga0306920_10362699523300032261SoilMSAMDDRTAIQTRTRAGLARLAGPWWMFLLTGIAWLILAWIALR
Ga0335082_1055134723300032782SoilMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALR
Ga0335082_1088560123300032782SoilMSAMDERTAIRSRTRAGLWRLAGPWWMFLLTGIAWLILSWVAL
Ga0335078_1110009513300032805SoilMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALR
Ga0335080_1067557013300032828SoilMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFNPA
Ga0335080_1147311713300032828SoilMSTMDERTDIGSRTRAGLARLAGPWWMFLLTGIAWL
Ga0335070_1070910033300032829SoilMSAMDERTALRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALR
Ga0335081_1037068413300032892SoilMSAMDERTDIGSRTRAGLARLAGPWWMFLLTGIAWLIFSWIALRFNPASI
Ga0335081_1258917913300032892SoilMSAMDEGTHIRSRTRAGLARLAGPWWMFLLTGIAWLILAWIALRFAPASIPTV
Ga0335069_10010842203300032893SoilMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILA
Ga0335069_1020553643300032893SoilMSAMDERTDVRSRTRAGLARLAGPWWMFLLTGIAWLILSWIAL
Ga0335069_1188744423300032893SoilMSAMDERTPIASRTRAGLWRLAGPWWMFLLTGIAWLIIGW
Ga0335083_1054857713300032954SoilMSTMDERTDIRSRTRAGLARLAGPWWMFLLTGIAWLILSWIALRFNPASIPTVGV
Ga0335084_1201864713300033004SoilMSAMDERADVRSRTRAGLARLAGPWWMFLLTGIGWLILSWIALRFNPASIPTVG
Ga0310914_1142365223300033289SoilMSAMDERTDIRSRTRAGLSRLAGPWWIFLLTGIAWLIIAWVVLRFT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.