| Basic Information | |
|---|---|
| Family ID | F021830 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 217 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RLSRFLGLSTRYHEIVMVIAIGKKSPAYVEPPQWRRPLDATVTVL |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 217 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.84 % |
| % of genes near scaffold ends (potentially truncated) | 98.16 % |
| % of genes from short scaffolds (< 2000 bps) | 90.78 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.539 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.120 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.954 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.829 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.96% β-sheet: 0.00% Coil/Unstructured: 89.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 217 Family Scaffolds |
|---|---|---|
| PF13463 | HTH_27 | 47.47 |
| PF12802 | MarR_2 | 16.13 |
| PF13412 | HTH_24 | 8.76 |
| PF00392 | GntR | 3.23 |
| PF00881 | Nitroreductase | 1.84 |
| PF04551 | GcpE | 1.38 |
| PF12704 | MacB_PCD | 1.38 |
| PF06202 | GDE_C | 0.92 |
| PF08327 | AHSA1 | 0.92 |
| PF02687 | FtsX | 0.92 |
| PF12867 | DinB_2 | 0.92 |
| PF03625 | DUF302 | 0.92 |
| PF10067 | DUF2306 | 0.46 |
| PF04952 | AstE_AspA | 0.46 |
| PF07077 | DUF1345 | 0.46 |
| PF00990 | GGDEF | 0.46 |
| PF12840 | HTH_20 | 0.46 |
| PF09339 | HTH_IclR | 0.46 |
| PF02518 | HATPase_c | 0.46 |
| PF01663 | Phosphodiest | 0.46 |
| PF01132 | EFP | 0.46 |
| PF16217 | M64_N | 0.46 |
| PF01814 | Hemerythrin | 0.46 |
| PF13411 | MerR_1 | 0.46 |
| PF00290 | Trp_syntA | 0.46 |
| PF00266 | Aminotran_5 | 0.46 |
| PF08669 | GCV_T_C | 0.46 |
| PF13545 | HTH_Crp_2 | 0.46 |
| PF01209 | Ubie_methyltran | 0.46 |
| PF13602 | ADH_zinc_N_2 | 0.46 |
| PF00107 | ADH_zinc_N | 0.46 |
| PF07228 | SpoIIE | 0.46 |
| PF08281 | Sigma70_r4_2 | 0.46 |
| PF13489 | Methyltransf_23 | 0.46 |
| PF01979 | Amidohydro_1 | 0.46 |
| PF00294 | PfkB | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 217 Family Scaffolds |
|---|---|---|---|
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 1.38 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.92 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.92 |
| COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 0.46 |
| COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 0.46 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.46 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.46 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.54 % |
| Unclassified | root | N/A | 0.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02IV9XA | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300000567|JGI12270J11330_10103138 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300001159|JGI12650J13346_1006903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300003370|JGI26337J50220_1031938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300004080|Ga0062385_10014940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2769 | Open in IMG/M |
| 3300004082|Ga0062384_100061349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1868 | Open in IMG/M |
| 3300004091|Ga0062387_100060075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1870 | Open in IMG/M |
| 3300004091|Ga0062387_101666265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300004092|Ga0062389_100232269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1850 | Open in IMG/M |
| 3300004092|Ga0062389_101942640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300004092|Ga0062389_102166868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300004092|Ga0062389_103702205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300004152|Ga0062386_100761155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300004633|Ga0066395_10652134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300005175|Ga0066673_10005298 | All Organisms → cellular organisms → Bacteria | 5146 | Open in IMG/M |
| 3300005332|Ga0066388_100142425 | All Organisms → cellular organisms → Bacteria | 2964 | Open in IMG/M |
| 3300005332|Ga0066388_101770369 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005332|Ga0066388_106351857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300005332|Ga0066388_107932639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005439|Ga0070711_101117477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300005529|Ga0070741_11283398 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005532|Ga0070739_10127437 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300005538|Ga0070731_10352093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300005541|Ga0070733_10156797 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300005541|Ga0070733_11184368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300005564|Ga0070664_101274471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300005602|Ga0070762_10144950 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300005712|Ga0070764_10358360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300005764|Ga0066903_101494781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300005764|Ga0066903_108481228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300005843|Ga0068860_101189743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300006050|Ga0075028_100879687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300006052|Ga0075029_100114415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1632 | Open in IMG/M |
| 3300006052|Ga0075029_101282827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300006059|Ga0075017_100684137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300006162|Ga0075030_101141031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300006173|Ga0070716_101724995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300006796|Ga0066665_11131082 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006804|Ga0079221_10075493 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300006806|Ga0079220_10029786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2405 | Open in IMG/M |
| 3300009098|Ga0105245_11692624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300009522|Ga0116218_1076993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1520 | Open in IMG/M |
| 3300009523|Ga0116221_1340401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300009638|Ga0116113_1024783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
| 3300009759|Ga0116101_1068958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300009792|Ga0126374_10078451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300009824|Ga0116219_10455789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300010047|Ga0126382_11814431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300010048|Ga0126373_11060356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300010048|Ga0126373_11270808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300010048|Ga0126373_13207540 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 509 | Open in IMG/M |
| 3300010343|Ga0074044_10417315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300010343|Ga0074044_11077242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300010359|Ga0126376_13216507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010361|Ga0126378_10145203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2408 | Open in IMG/M |
| 3300010361|Ga0126378_10153248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2349 | Open in IMG/M |
| 3300010376|Ga0126381_100597145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1570 | Open in IMG/M |
| 3300010376|Ga0126381_104911386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300010379|Ga0136449_103297972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300011271|Ga0137393_10407247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
| 3300011411|Ga0153933_1096192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012096|Ga0137389_10159219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1855 | Open in IMG/M |
| 3300012198|Ga0137364_11066070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012200|Ga0137382_11299980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300012202|Ga0137363_11824053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012208|Ga0137376_10301827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1390 | Open in IMG/M |
| 3300012210|Ga0137378_10292419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1516 | Open in IMG/M |
| 3300012285|Ga0137370_10812560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300012357|Ga0137384_11059402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300012683|Ga0137398_10396320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300012917|Ga0137395_10630705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300012918|Ga0137396_10141486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
| 3300012918|Ga0137396_10579558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300012923|Ga0137359_10070398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3058 | Open in IMG/M |
| 3300012986|Ga0164304_10855332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300013296|Ga0157374_10811435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300013296|Ga0157374_12552532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300014657|Ga0181522_10266087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300015052|Ga0137411_1372906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300015054|Ga0137420_1292951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300015371|Ga0132258_13675566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300016357|Ga0182032_10430532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300016422|Ga0182039_11254898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300017822|Ga0187802_10106292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300017955|Ga0187817_11100640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300017961|Ga0187778_11110554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300017975|Ga0187782_11115848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300018007|Ga0187805_10603636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300018009|Ga0187884_10427498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300018038|Ga0187855_10376060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300018047|Ga0187859_10766556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300018062|Ga0187784_10778832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300018085|Ga0187772_10937134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300019240|Ga0181510_1188714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
| 3300019787|Ga0182031_1066484 | Not Available | 1682 | Open in IMG/M |
| 3300019787|Ga0182031_1208364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2080 | Open in IMG/M |
| 3300020579|Ga0210407_10557249 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300020579|Ga0210407_11143251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300020580|Ga0210403_10219342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300020580|Ga0210403_10311193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1290 | Open in IMG/M |
| 3300020580|Ga0210403_10842590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300020581|Ga0210399_10455362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300020581|Ga0210399_10751421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300020581|Ga0210399_11356455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300020582|Ga0210395_10844604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300020582|Ga0210395_11410307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300020583|Ga0210401_11062644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300021168|Ga0210406_10085445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2694 | Open in IMG/M |
| 3300021168|Ga0210406_10970734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300021171|Ga0210405_10603519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300021180|Ga0210396_11369153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300021401|Ga0210393_10299703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300021401|Ga0210393_11285365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021405|Ga0210387_10135971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2090 | Open in IMG/M |
| 3300021405|Ga0210387_10923184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300021407|Ga0210383_10254153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300021420|Ga0210394_10750204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300021420|Ga0210394_11599523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300021420|Ga0210394_11683302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300021432|Ga0210384_10449887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300021432|Ga0210384_11896701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021433|Ga0210391_10653217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300021433|Ga0210391_11559903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300021474|Ga0210390_10416390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300021474|Ga0210390_10529632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300021474|Ga0210390_10696097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300021474|Ga0210390_10831024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300021475|Ga0210392_11070302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300021478|Ga0210402_10281003 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300021559|Ga0210409_10802194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300022509|Ga0242649_1049175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300022521|Ga0224541_1009114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300024251|Ga0247679_1022815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300025134|Ga0207416_1100414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300025320|Ga0209171_10222153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300025921|Ga0207652_11670174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300025929|Ga0207664_10625709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300025939|Ga0207665_10546085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300026109|Ga0208774_1020603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300026326|Ga0209801_1197175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300026551|Ga0209648_10108399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 2263 | Open in IMG/M |
| 3300026869|Ga0207821_1013285 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300026879|Ga0207763_1029418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300027011|Ga0207740_1003283 | All Organisms → cellular organisms → Bacteria | 2674 | Open in IMG/M |
| 3300027024|Ga0207819_1038397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300027370|Ga0209010_1046199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300027439|Ga0209332_1008488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2076 | Open in IMG/M |
| 3300027497|Ga0208199_1101587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300027545|Ga0209008_1063206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300027575|Ga0209525_1096096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300027575|Ga0209525_1158258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300027660|Ga0209736_1076359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300027676|Ga0209333_1107178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300027701|Ga0209447_10163638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300027729|Ga0209248_10080849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300027825|Ga0209039_10138448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300027842|Ga0209580_10185050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300027842|Ga0209580_10576520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300027846|Ga0209180_10418237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300027867|Ga0209167_10128332 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300027867|Ga0209167_10173493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300027875|Ga0209283_10465174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300027879|Ga0209169_10012702 | All Organisms → cellular organisms → Bacteria | 4664 | Open in IMG/M |
| 3300027884|Ga0209275_10190789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300027884|Ga0209275_10252297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300027986|Ga0209168_10166275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300028146|Ga0247682_1052501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300028806|Ga0302221_10134716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300029910|Ga0311369_10987433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300029944|Ga0311352_10749087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300029954|Ga0311331_10932922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300030020|Ga0311344_10896497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300031231|Ga0170824_119568916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300031249|Ga0265339_10402179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300031544|Ga0318534_10641374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300031561|Ga0318528_10312378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300031708|Ga0310686_104372213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300031708|Ga0310686_104915343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300031708|Ga0310686_114187691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2018 | Open in IMG/M |
| 3300031715|Ga0307476_10167056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
| 3300031715|Ga0307476_10866539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031718|Ga0307474_10380306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300031723|Ga0318493_10901023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031770|Ga0318521_10479358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300031819|Ga0318568_10329590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300031879|Ga0306919_10361338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300031896|Ga0318551_10241198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300031945|Ga0310913_10005940 | All Organisms → cellular organisms → Bacteria | 7032 | Open in IMG/M |
| 3300031947|Ga0310909_10292810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300031947|Ga0310909_11048163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300031954|Ga0306926_12977107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300031959|Ga0318530_10291590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300031959|Ga0318530_10386834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300031962|Ga0307479_10174593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2112 | Open in IMG/M |
| 3300032001|Ga0306922_10778241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300032076|Ga0306924_12494551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300032160|Ga0311301_12261037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300032174|Ga0307470_11189614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300032515|Ga0348332_11324357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300032782|Ga0335082_10770321 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300032783|Ga0335079_10345266 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300032828|Ga0335080_11256799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300032892|Ga0335081_10556875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300032892|Ga0335081_10832320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300032893|Ga0335069_10657617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300032898|Ga0335072_10406463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1458 | Open in IMG/M |
| 3300032898|Ga0335072_11343452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300032954|Ga0335083_10158164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2129 | Open in IMG/M |
| 3300032955|Ga0335076_10081298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3179 | Open in IMG/M |
| 3300032955|Ga0335076_10339164 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300033158|Ga0335077_11137406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300033158|Ga0335077_11739660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300033405|Ga0326727_10446698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300033412|Ga0310810_10263115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1886 | Open in IMG/M |
| 3300033544|Ga0316215_1037973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300033887|Ga0334790_029249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2312 | Open in IMG/M |
| 3300034282|Ga0370492_0345727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.29% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.30% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.30% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.46% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.46% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.46% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.46% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.46% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.46% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.46% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026109 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_06745590 | 2170459013 | Grass Soil | LPSPSFASHEIVMVIAIGKKSPGHIDHQWRRPLEPTVTIL |
| JGI12270J11330_101031383 | 3300000567 | Peatlands Soil | GRRLSRFLGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRPLDATVTVL* |
| JGI12650J13346_10069031 | 3300001159 | Forest Soil | RRLSKYLGLSARYHEIVMVIAIGKKSHAYVEPPQWRRPLEATVTIL* |
| JGI26337J50220_10319381 | 3300003370 | Bog Forest Soil | DGRRLGKLLGLSGKDHEIVMVIAIGKKSARHVDQXQWRRPLEETVRIV* |
| Ga0062385_100149404 | 3300004080 | Bog Forest Soil | SRFLRLSPRYHEIVMVIAIGKKSRSYVEPPQWRRHLEETVTIL* |
| Ga0062384_1000613493 | 3300004082 | Bog Forest Soil | EGFDDIRLSKFLGLSRRKHEIMMVIAVGKKSAQHVDRPQWRRPLESTVTVL* |
| Ga0062387_1000600751 | 3300004091 | Bog Forest Soil | GRRLSKFLGLSPRHHEIVMVIAVGKKSSSYTEPPQWRRSLDATVTVL* |
| Ga0062387_1016662652 | 3300004091 | Bog Forest Soil | KLLGLRRRYHEIVMVIAVGKKSDDHMADPQWRRPLGATVTIL* |
| Ga0062389_1002322693 | 3300004092 | Bog Forest Soil | RLSKFLGLSRRKHEIMMVIAVGKKSAQHVDRPQWRRPLESTVTVL* |
| Ga0062389_1019426402 | 3300004092 | Bog Forest Soil | MEGFDGRRLSKFLGLSPRHHEIVMVIAVGKKSSSYTEPPQWRRSLDATVTVL* |
| Ga0062389_1021668681 | 3300004092 | Bog Forest Soil | LSKFLGLSAAHHEIVMVIAIGKRSPEHKDPPQWRRTLDATVTLL* |
| Ga0062389_1037022052 | 3300004092 | Bog Forest Soil | LGLSGRHHEIVMVIAIGKKSCAHNEPPQWRRPLDATVTVL* |
| Ga0062386_1007611553 | 3300004152 | Bog Forest Soil | GLCGRYHEIVMVIAIGKKSHAYIEPPQWRRPLEATVTFL* |
| Ga0066395_106521341 | 3300004633 | Tropical Forest Soil | EGFDGRRLSKHLGLSARYHEVVLVIAMGKKSPSYVEAPQWRRPIHVTVSIL* |
| Ga0066673_100052987 | 3300005175 | Soil | LGLSSQFHEIVMVIALGKKSARHADSPQWRRPLEATVRFL* |
| Ga0066388_1001424255 | 3300005332 | Tropical Forest Soil | EGFDGVRLARFLGVSRRTQEIVMVIAIGKKSAKHVDQPQWRRPLEETVTVL* |
| Ga0066388_1017703691 | 3300005332 | Tropical Forest Soil | YLGLSRRYHEIVMVIAVGKKSHAYVEPPQWRRPLQTTVTVL* |
| Ga0066388_1063518571 | 3300005332 | Tropical Forest Soil | QRLVDYLGLSRKHHEIVMVIAIGKKSPDYIEQPQWRRPLEATVTLL* |
| Ga0066388_1079326392 | 3300005332 | Tropical Forest Soil | RRLCKFLGLSARHHEIVMVIAIGKKSASYVGPPQWRRPLEATVTVL* |
| Ga0070711_1011174772 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ELSGRHHEIVMVIAIGERSHAYVEPPQWRRPLDATATIL* |
| Ga0070741_112833981 | 3300005529 | Surface Soil | AEVVGLSTCPMEGFDGPRLARYLRLSQRHQEIVMIIALGKKSPAHIAQRQWRRPLETTVSIL* |
| Ga0070739_101274371 | 3300005532 | Surface Soil | NTCPMEGFDAQRLARYLGLSQKHQEIVLVIAIGKKSSRYIAQPQWRRPLETTVTFL* |
| Ga0070731_103520931 | 3300005538 | Surface Soil | YHEIVMVIAIGKKSAAYAEPPQWRRPLDATVTVL* |
| Ga0070733_101567971 | 3300005541 | Surface Soil | RLSRLLGLSSRYHEIIMVIAVGKKSQQHIDHPQWRRPLENTVTVL* |
| Ga0070733_111843682 | 3300005541 | Surface Soil | LGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRPLDATVTVL* |
| Ga0070664_1012744711 | 3300005564 | Corn Rhizosphere | PMEGFDGRRLSRFLGLSARYHEIVMVIAIGKKSPAYAGPPQWRRPLDATVTVL* |
| Ga0070762_101449501 | 3300005602 | Soil | RYHEIVMVIAIGKKSSAYAEPPQWRRPLDATVTVL* |
| Ga0070764_103583603 | 3300005712 | Soil | QLVGLSPKNHEILMVIAIGKKSAEHLDRPQWRRPLESTVTVL* |
| Ga0066903_1014947811 | 3300005764 | Tropical Forest Soil | ARYHEIVMVIATGKKSQTYVESPQWRRPLHATVTIL* |
| Ga0066903_1084812282 | 3300005764 | Tropical Forest Soil | FDGRRLSKLLKLSPRWHDIVMVIAIGKKSPLNNDVPQWRRPLEATVQTL* |
| Ga0068860_1011897431 | 3300005843 | Switchgrass Rhizosphere | CPMEGFDGRRLSKYLGLSRRFHEIVMVIAIGKKSDAYIEQPQWRRPLDATVTVL* |
| Ga0075028_1008796872 | 3300006050 | Watersheds | RHHEIVMVIALGKKSRAHNEPPQWRRPLEATVTIL* |
| Ga0075029_1001144153 | 3300006052 | Watersheds | MEGFDGRRLSQYLGLSGRHHEIVMVIAIGKKSRTYNEPPQWRRPLDATVTVL* |
| Ga0075029_1012828271 | 3300006052 | Watersheds | SARYHEIVMVIAIGKKSHSYVAPPQWRRPLEATVTIL* |
| Ga0075017_1006841373 | 3300006059 | Watersheds | TCPMEGFDGRRLSKFLALSPRTHDIVMVIAIGKKSARHVDQPQWRRPLEATVKFL* |
| Ga0075030_1011410311 | 3300006162 | Watersheds | PMEGFDGRRLSQYLGLSGRHHEIVMVIAIGKKSRTYNEPPQWRRPLDATVTVL* |
| Ga0070716_1017249952 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PKCQEITMVIAVGKKSSKHVEQPQWRRPLEMTVTFL* |
| Ga0066665_111310822 | 3300006796 | Soil | EALGVNTCPMECFDGRRLSKYLGLSNRYHEIVMVIAVGRKSQTYVEPPQWRRPLHATVSIL* |
| Ga0079221_100754933 | 3300006804 | Agricultural Soil | DGRRLCKFLGLSTRHHEIVMVIAIGKKSRAYVGPPQWRRSLDATVTVL* |
| Ga0079220_100297864 | 3300006806 | Agricultural Soil | RLCKFLGLSTRHHEIVMVIAIGKKSRAYVGPPQWRRSLDATVTVL* |
| Ga0105245_116926241 | 3300009098 | Miscanthus Rhizosphere | RFLGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRPLDATVTVL* |
| Ga0116218_10769931 | 3300009522 | Peatlands Soil | GMNTCPMEGFDGRRLSRYLGLCGRHHEIVMVIAIGKKSRTHSEPPQWRRSLDATVTVL* |
| Ga0116221_13404012 | 3300009523 | Peatlands Soil | AEALGMNTCPMEGFDGRRLSQYLRLSARHHDIVMVIAIGKKSRGYNEPPQWRRHLDATVTVL* |
| Ga0116113_10247831 | 3300009638 | Peatland | GKLLRLSGKDHEIVMVIAIGKKSARHVDHPRWRRPLEETVRIV* |
| Ga0116101_10689582 | 3300009759 | Peatland | SRFLGLSTRYHEIVMVIAIGKKSPTYAEPPQWRRPLDATVTVL* |
| Ga0126374_100784511 | 3300009792 | Tropical Forest Soil | GFDGRRLSKFLGLSPRYHEIVMVIAIGKKSARHSDQPQWRRPLESTVQFL* |
| Ga0116219_104557892 | 3300009824 | Peatlands Soil | DGRRLSQYLRLSARHPDIVMVIAIGKKSRGYNEAPQWRRQLDATVTVL* |
| Ga0126382_118144311 | 3300010047 | Tropical Forest Soil | LCKFLGLSTRYHEIVMVIAIGKKSASYVGPPQWRRPLEATVTVL* |
| Ga0126373_110603561 | 3300010048 | Tropical Forest Soil | ARYLNLQGKNHEIVMVIAIGKRSTSYLEPPQWRRPLESTVTIL* |
| Ga0126373_112708081 | 3300010048 | Tropical Forest Soil | RRLLKHLGLSARYHEIVMVIAMGKKAQTYVEPPQWRRPLHATVSIL* |
| Ga0126373_132075402 | 3300010048 | Tropical Forest Soil | RLSKLLGLSARYHEIIMVIAIGKKSSRHEDQRQWRRPIEQTVTIL* |
| Ga0074044_104173153 | 3300010343 | Bog Forest Soil | KYLRLSGRHHEIVMVIAIGKKSCAHNEPPQWRRPLEATVTVL* |
| Ga0074044_110772422 | 3300010343 | Bog Forest Soil | KDHEIVMVIAIGKKSARHVDQPQWRRPLEATVRIV* |
| Ga0126376_132165071 | 3300010359 | Tropical Forest Soil | PRHHEIVMVIAIGKKSVNHREQPQWRRPLESTVQFL* |
| Ga0126378_101452033 | 3300010361 | Tropical Forest Soil | CPMEGFDGRRLSKFLGLSTRYHEIVMVIAIGKKSPSYMLPPQWRRPLDATVTVL* |
| Ga0126378_101532481 | 3300010361 | Tropical Forest Soil | MEGFDNRRLARYLNLEGKHHEIVMVIAIGKRSTSYLEPPQWRRPLESTVTIL* |
| Ga0126381_1005971451 | 3300010376 | Tropical Forest Soil | KRQEVVMVIAIGKKSASYTEQPQWRRPIEATVTVL* |
| Ga0126381_1049113862 | 3300010376 | Tropical Forest Soil | DGRRLSRYLGLSRRYHEIVMVIAIGKKSPAYVQPPQWRRPLDMTVTVL* |
| Ga0136449_1032979722 | 3300010379 | Peatlands Soil | GLSPRIHEIVMVIAIGKKSARHVNQPQWRRPLEATVKFL* |
| Ga0137393_104072473 | 3300011271 | Vadose Zone Soil | FDGRRLSQYLGLSARNHEIVMVIAIGKKAHACVQPPQWRRPLDATVTVL* |
| Ga0153933_10961921 | 3300011411 | Attine Ant Fungus Gardens | RLSRFLGLSTRYHEIVMVIAIGKKSPAYVEPPQWRRPLDATVTVL* |
| Ga0137389_101592191 | 3300012096 | Vadose Zone Soil | RTDEIVMVIAIGKKPARHVDQPQWRRPLEATVKIL* |
| Ga0137364_110660701 | 3300012198 | Vadose Zone Soil | QFHEIVMVIAIGKKSARHVDSPQWRRPLEATVRFL* |
| Ga0137382_112999801 | 3300012200 | Vadose Zone Soil | PMEGFDGRRLGKFLGLSSQFHEIVMVIAIGKKSARHVDSPQWRRPLEATVRFL* |
| Ga0137363_118240531 | 3300012202 | Vadose Zone Soil | RYHEIVMVIAIGKKSAAYAEPPQWRRPLDATVTVL* |
| Ga0137376_103018273 | 3300012208 | Vadose Zone Soil | MEGFDGRRLLQYLGLTGRHHEIVMVIAIGKKSRDHNEPPQWRRRLDA |
| Ga0137378_102924193 | 3300012210 | Vadose Zone Soil | GLSARNHEIVMVIAIGKKSHAYLEPPQWRRPLDATVTVL* |
| Ga0137370_108125601 | 3300012285 | Vadose Zone Soil | TCPMEGFDGRRLGKFLGLSSQFHEIVMVIAIGKKSARHVDSPQWRRPLDATVRFL* |
| Ga0137384_110594021 | 3300012357 | Vadose Zone Soil | LSKYLGLSARNHEIVMVIAMGKKSHAYLEPPQWRRPLDATVTVL* |
| Ga0137398_103963202 | 3300012683 | Vadose Zone Soil | FLGLSARYHEIVMVIAIGKKSPAYAEPPQWRRPLDATVTIL* |
| Ga0137395_106307053 | 3300012917 | Vadose Zone Soil | LGLSARYHEIVLVIAIGKKSSRHVDQPQWRRPLHATVQVL* |
| Ga0137396_101414861 | 3300012918 | Vadose Zone Soil | KFLGLNPRTQEIVMVIAIGKKSARHVEQPQWRRPLEATVKFL* |
| Ga0137396_105795583 | 3300012918 | Vadose Zone Soil | MEGFDGRRLGKFLGLNPRAHEIVMVIAIGKKSAHHVEQPQWRRPLEA |
| Ga0137359_100703981 | 3300012923 | Vadose Zone Soil | GLNPRTHEIVMVIAIGKKSARHVEQPQWRRPLEATVKFL* |
| Ga0164304_108553322 | 3300012986 | Soil | FHEIVMVIAIGKKSSVYIEPPQWRRPLDATVTVL* |
| Ga0157374_108114353 | 3300013296 | Miscanthus Rhizosphere | SLSARHHEIVMVIAIGKKSRARNEPPQWRRPIDATVTVL* |
| Ga0157374_125525321 | 3300013296 | Miscanthus Rhizosphere | HHEIVMVIAIGKKSRAYVETPQWRRPLDRTVTVL* |
| Ga0181522_102660873 | 3300014657 | Bog | GLSTRYHEIVMVIAIGKKSSAYAESPQWRRPLDATVTVL* |
| Ga0137411_13729061 | 3300015052 | Vadose Zone Soil | FLGLNPRTHEIVMVIAIGKKSARHVEQPQWRRPLEATAKFL* |
| Ga0137420_12929511 | 3300015054 | Vadose Zone Soil | LSKFLGLSSRTHEIVMVIAIGKKSAGHIDQPQWRRPLEATVKFL* |
| Ga0132258_136755663 | 3300015371 | Arabidopsis Rhizosphere | LGLSGRHHEIVMVIAIGKKSSALNEPPQWRRPLDATVTVL* |
| Ga0182032_104305321 | 3300016357 | Soil | GFDGRRLSQYLGLSKRYHEIVMVIAIGKKSRNYVEPLQWRRPLGATVTVL |
| Ga0182039_112548982 | 3300016422 | Soil | FDGRRLSKHLGLSARYQESVMVIAMGKKSQTYVEPPQWRRPLHATVSIL |
| Ga0187802_101062921 | 3300017822 | Freshwater Sediment | LSSRYHEIVMVIAIGKKSDADVVEPQWRRPLDATVTVL |
| Ga0187817_111006401 | 3300017955 | Freshwater Sediment | FDGPRLARYLGLSRKHHEIVMVIAIGKKSPSYTDPPQWRRPLEATVTIL |
| Ga0187778_111105542 | 3300017961 | Tropical Peatland | QRLARYLGLSGMHHEIVMVIAIGKKSSSYTAQPQWRRPIETTVTIL |
| Ga0187782_111158482 | 3300017975 | Tropical Peatland | ARLLGLSPQYHEIVMVIALGKKSPAHVDHPQWRRPLEATVTVL |
| Ga0187805_106036361 | 3300018007 | Freshwater Sediment | MEGFDGRRLSKFLGLAPRLHEIVMVIAVGKKSSAHSDQPQWRRSLDATVTIL |
| Ga0187884_104274982 | 3300018009 | Peatland | GKLLRLSGKDHEIVMVIAIGKKSARHVDHPRWRRPLEETVRIV |
| Ga0187855_103760601 | 3300018038 | Peatland | MNTCPMEGFDGRRLSKYLRLSGRRHEIVMVIAIGKKSCTHKEPPQWRRPLEATVTVL |
| Ga0187859_107665562 | 3300018047 | Peatland | PMEGFDGRRLRRFLGLSPRHHEIVMVIAIGKKSPGYVEPPQWRRPLDATVTIL |
| Ga0187784_107788321 | 3300018062 | Tropical Peatland | LSPKYHEIVMVIALGKKSPAHVDQLQWRRPLEATVTVL |
| Ga0187772_109371342 | 3300018085 | Tropical Peatland | MEGFDGRRLSRFLGLSRKYHEIVMVIAIGKKSAVFIQEPQWRRPLEATVTVL |
| Ga0181510_11887141 | 3300019240 | Peatland | LGLSARHREIVMVIAIGKRSHAYVEPPQWRRPLDATVTVL |
| Ga0182031_10664841 | 3300019787 | Bog | ALSIGFDGRRLSRYLGLSGRHHEIVMVIAIGKKSRAHNEPPQWRRPLDATVTIL |
| Ga0182031_12083642 | 3300019787 | Bog | MAAGSLDNLGLSGRHHEIVMVIAIGKKSRAHNEPPQWRRPLDATVTIL |
| Ga0210407_105572493 | 3300020579 | Soil | GKFLGLSGRTQEIVMVIAIGKKSSKHVDQPQWRRPLETTVTIL |
| Ga0210407_111432512 | 3300020579 | Soil | SRYHEIVMVIAIGKKSPAYAEPPQWRRPLDATVTVL |
| Ga0210403_102193421 | 3300020580 | Soil | LSTRYHEIVMVIAIGKKSPAYAEPPQWRRSLDATVTVL |
| Ga0210403_103111933 | 3300020580 | Soil | RFLGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRPLEATVTVL |
| Ga0210403_108425902 | 3300020580 | Soil | TCPMEGFDGRRLSRFLGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRPLEATVTVL |
| Ga0210399_104553623 | 3300020581 | Soil | GKLLGLSGKDHEIVMVIAIGKKSARHVDQPQWRRPLEATVRIV |
| Ga0210399_107514211 | 3300020581 | Soil | EGFDGVRLSKFLGLSRKYHEIVMVIAIGKKSATYKVQSQWRRPLEATVTIL |
| Ga0210399_113564551 | 3300020581 | Soil | TCQMEGFDGARLSKFLGLSRKYHEIVMVIAIGRKSAKHVVQPQWRRPLESTVTIL |
| Ga0210395_108446041 | 3300020582 | Soil | RRLSKFLGLSARYHEIVLVIAIGKKSSRHVDQPQWRRPLRATVQVL |
| Ga0210395_114103072 | 3300020582 | Soil | LSGWRHEIVMVIAIGKKSLIRNEPPQWRRPLDATVTVL |
| Ga0210401_110626442 | 3300020583 | Soil | FDGRRLGKLLGLSGKDHEIVMVIAIGKKSARHVDQPQWRRPLEATVRIV |
| Ga0210406_100854451 | 3300021168 | Soil | KYHEIVMVIAIGKKSATYKEQPQWRRPLETTVTVL |
| Ga0210406_109707341 | 3300021168 | Soil | LGKLLGLSGKDHEIVMVIAIGKKSARHVDQPQWRRPLEATVRIV |
| Ga0210405_106035193 | 3300021171 | Soil | PMEGFDGARLSKFLGLSRKYHEIVMVIAIGRKSAKHVAQPQWRRPLESTVTIL |
| Ga0210396_113691532 | 3300021180 | Soil | LGLSSQYHEVVMVIAIGKKSDADVVEPQWRRPLDATVTVL |
| Ga0210393_102997033 | 3300021401 | Soil | SDRHHEIVMVIALGKKSSDYNEPPQWRRPLDATVTVL |
| Ga0210393_112853652 | 3300021401 | Soil | TCPMEGFDTRRLSQFLGLSSRYHEIIMVIAVGKKSQEHIDHPQWRRPLENTVTVL |
| Ga0210387_101359711 | 3300021405 | Soil | GFDGVRLAKFLGLSRKYHEIVMVIAVGKKPATYQEQPQWRRPVETTVTVL |
| Ga0210387_109231843 | 3300021405 | Soil | CMMEGFDGRRLLKLLGLSGKNHEIVMVIAIGKKSARHMDQPQWRRPLEETVRVL |
| Ga0210383_102541534 | 3300021407 | Soil | MEGFDGRRLSRFLGLSTRYHEIVMVIAIGKKSPAYAQPPQWRRPLEATVTVL |
| Ga0210394_107502043 | 3300021420 | Soil | MEGFDGVRLSKFLGLSRKYHEIVMVIAIGKKSATYKVQSQWRRPLEATVTIL |
| Ga0210394_115995231 | 3300021420 | Soil | GHRLSKFLGLSARYHEIVMVIAIGKKSDAVVIEPQWRRPLDAAVTVL |
| Ga0210394_116833021 | 3300021420 | Soil | LAKFLGLSPRHHEIVLVIAIGKKSTAHIDYPQWRRPLESTVTVL |
| Ga0210384_104498873 | 3300021432 | Soil | EGFDGVRLAKFLGLSRKYHEIVMVIAVGKKPATYQEQPQWRRPLETTVTVL |
| Ga0210384_118967011 | 3300021432 | Soil | PRNHEIVMVIAIGKKSARHVDQPQWRRPLEATVKFL |
| Ga0210391_106532171 | 3300021433 | Soil | RNHEIVMVIAVGKRSRTYDEPPQWRRSLDATVTVL |
| Ga0210391_115599031 | 3300021433 | Soil | LVGLSPKHHEILMVIAIGKKSAEHLDRPQWRRPLESTVTVL |
| Ga0210390_104163901 | 3300021474 | Soil | PMEGFDGRRLSKFLGLSARYHEIVLVIAVGRKSSRHVDQPQWRRPLRATVQVL |
| Ga0210390_105296323 | 3300021474 | Soil | GFDGVRLSKFLGLSRKYHEIVMVIAIGKKSATYKEQPQWRRPLETTVTVL |
| Ga0210390_106960971 | 3300021474 | Soil | EGFDGRRLSKYLGLSGRYHEIVMVIAIGKKSHAYVEPPQWRRPLEATVTIL |
| Ga0210390_108310241 | 3300021474 | Soil | FDGRRLSRFLGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRPLDATVTVL |
| Ga0210392_110703022 | 3300021475 | Soil | KYHEIVMVIAIGRKSAKHVVQPQWRRPLESTVTIL |
| Ga0210402_102810034 | 3300021478 | Soil | KFLGLSRKYHEIVMVIAVGKKPATYQEQPQWRRPLETTVTVL |
| Ga0210409_108021943 | 3300021559 | Soil | RLSKFLGLSRKYHEIVMVIAIGKKSATYKEQPQWRRPVELTVTVL |
| Ga0242649_10491751 | 3300022509 | Soil | TRYHEIVMVIAIGKKSSAYAEPPQWRRPLEATVTVL |
| Ga0224541_10091144 | 3300022521 | Soil | CPMEGFDGRRLSKYLGLSARYHEIVMVIALGKKSHAYVEPPQWRRPLEATVTIL |
| Ga0247679_10228151 | 3300024251 | Soil | LSKFLGLSRRTQEIVMVIAIGKKSAKHVDQPQWRRPLETTVTTL |
| Ga0207416_11004142 | 3300025134 | Iron-Sulfur Acid Spring | MEGFDGRRLSKYLGLSARYHEIVMVIAIGKKSHAYVEPPQWRRPLEATVTIL |
| Ga0209171_102221533 | 3300025320 | Iron-Sulfur Acid Spring | INTCPMEGFDGRRLSKYLGLSGRYHEIVMVIAIGKKSHAYVEPPQWRRPLEATVTIL |
| Ga0207652_116701741 | 3300025921 | Corn Rhizosphere | GLSSRFHEIVMVIAIGKKSNAFIAPPQWRRPLDATVTVL |
| Ga0207664_106257091 | 3300025929 | Agricultural Soil | MEGFDCRRLSKYLGLSARYHEIVMVIAMGKKSRTYVEPPQWRRPLHATVSIL |
| Ga0207665_105460853 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | STRYHEIVMVIAIGKKSPAYAEPPQWRRPLDATVTVL |
| Ga0208774_10206031 | 3300026109 | Rice Paddy Soil | RYHEIVMVIAMGKKSHAYVEPPQWRRPLQATVTIL |
| Ga0209801_11971751 | 3300026326 | Soil | PMEGFDGRRLGKFLGLNPRTHEIVMVIAIGKKSASHVEQPQWRRPLEATVKFL |
| Ga0209648_101083993 | 3300026551 | Grasslands Soil | GFDGRRLLQYLGLSGRHHEIVMVIAIGKKSRDHNEPPQWRRPLDATVTVL |
| Ga0207821_10132853 | 3300026869 | Tropical Forest Soil | LQYLGLSRKHHEIVMVIAIGKKSADYVEQPQWRRPLETTVTVL |
| Ga0207763_10294182 | 3300026879 | Tropical Forest Soil | PMEGFDGRRLTRFLGLSSRYHEIVMVIAIGKKSPAYAQPPQWRRPLDATVTVL |
| Ga0207740_10032831 | 3300027011 | Tropical Forest Soil | LLQYLGLSRKHHEIVMVIAIGKKSADYVEQPQWRRPLETTVTVL |
| Ga0207819_10383971 | 3300027024 | Tropical Forest Soil | LSRYLGLSARYHEIVMVIAIGKKSPAYAQPPQWRRPLDATVTVL |
| Ga0209010_10461992 | 3300027370 | Forest Soil | KDHEIVMVIAIGKKSAQHVDQPQWRRPLEETVRIV |
| Ga0209332_10084884 | 3300027439 | Forest Soil | EGFDGRRLSRFLGLSTRYHEIVMVIAIGKKSPAYADAPQWRRPLDTTVTVL |
| Ga0208199_11015872 | 3300027497 | Peatlands Soil | DGRRLSQYLGLSGRHHEIVMVIAIGKKSRAHNEPPQWRRPLEATVTIL |
| Ga0209008_10632061 | 3300027545 | Forest Soil | LGLSARYHEIVLVIAIGKKSSRHVDQPQWRRPLRATVQVL |
| Ga0209525_10960963 | 3300027575 | Forest Soil | DLRLANLVGLSPKHHEILMVIAIGRKSAEHLDRPQWRRPLESTVTVL |
| Ga0209525_11582582 | 3300027575 | Forest Soil | RLSQYLGLSARYHEIAMVIAMGKKSHSYVEPPQWRRPLEATVTIL |
| Ga0209736_10763593 | 3300027660 | Forest Soil | STRYHEIVMVIAIGKKSAAYVEPPQWRRPLDATVTVL |
| Ga0209333_11071783 | 3300027676 | Forest Soil | PMEGFDGRRLSKYLGLSARYHEIVMVIAMGKKSQAYVEPPQWRRPLHATVAIL |
| Ga0209447_101636381 | 3300027701 | Bog Forest Soil | CPMEGFDARRLSKFLGLSPRFHEIVMVIAIGKKSTAHKDQPQWRRPLGATVTVL |
| Ga0209248_100808493 | 3300027729 | Bog Forest Soil | LSGKDHEIVMVIAIGKKSARHVDQPQWRRPLEETVHIV |
| Ga0209039_101384483 | 3300027825 | Bog Forest Soil | YLGLSGRHHEIVMVIAIGKKSRGHSEPPQWRRPLDATVTVL |
| Ga0209580_101850501 | 3300027842 | Surface Soil | GRRLSRFLGLSTRYHEIVMVIAIGKKSPSYAEPPQWRRPLEATVTVL |
| Ga0209580_105765201 | 3300027842 | Surface Soil | CPMEGFDGRRLCRYLGLSRRYHDIVMVIAVGKRSHAFVEPPQWRRPLHKTVTVL |
| Ga0209180_104182372 | 3300027846 | Vadose Zone Soil | MEGFDSRRLLQYLGLSGRHHEIVMVIAIGKKSRDHNEPPQWRRRLDATVTVL |
| Ga0209167_101283321 | 3300027867 | Surface Soil | RLSRLLGLSSRYHEIIMVIAVGKKSQQHIDHPQWRRPLENTVTVL |
| Ga0209167_101734935 | 3300027867 | Surface Soil | EGFDGRRLSRFLGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRPLNATVTVL |
| Ga0209283_104651741 | 3300027875 | Vadose Zone Soil | SKFLGLSPRTHEIVMVIAIGKKSARYVEQPQWRRPLEATVKIL |
| Ga0209169_100127025 | 3300027879 | Soil | QLVGLSPKHHDILIVIAVGKKSAEHLDRPQWRRPLESTVTVL |
| Ga0209275_101907891 | 3300027884 | Soil | GFDGRRLSRFLGLSTRYHEIVMVIAIGKKSPAYAEPPQWRRSLDATVTVL |
| Ga0209275_102522973 | 3300027884 | Soil | TCPMEGFDGRRLSKYLGLSGRYHEIVMVIAIGKKSHAYVEPPQWRRPLEATVTIL |
| Ga0209168_101662753 | 3300027986 | Surface Soil | TCPMEGFDGRRLSRFLGLSTRYHEIVMVIAIGKKSHAYAEPPQWRRPLDATVTVL |
| Ga0247682_10525012 | 3300028146 | Soil | LSKLLRLSLRHHEIVMVIAIGKKSANHKESPQWRRPLNATVQFL |
| Ga0302221_101347163 | 3300028806 | Palsa | CPMEGFDGRRLSKFLKLSPHHEIVMVIAIGKKSFKHIDHPQWRRPLCATVTIL |
| Ga0311369_109874331 | 3300029910 | Palsa | TRYHEIVMVIAIGKESPAYAEPPQWRRPLDATVTVL |
| Ga0311352_107490871 | 3300029944 | Palsa | RLREYLGLSGRHHEIVMVIAMGKKSSEYREPPQWRRPLGTTVVDL |
| Ga0311331_109329222 | 3300029954 | Bog | SQYLGLSGQHHEIVMVIAIGKKSRAHNEPPQWRRPLDATVTIL |
| Ga0311344_108964973 | 3300030020 | Bog | MEGFDGARLLKFLELSPKLHEIVMVIAVGRKSAEHIEQPQWRRPLEATVTYL |
| Ga0170824_1195689161 | 3300031231 | Forest Soil | RHHEIVMVIALGKKSSEYCEPPQWRRPLDATVTVL |
| Ga0265339_104021791 | 3300031249 | Rhizosphere | ARHHEIVMVIAIGKKSSAYAETPQWRRPLDATVTIL |
| Ga0318534_106413741 | 3300031544 | Soil | GFDNRRLARYLNLEDKHHEIVMVIAIGKRSTSYLEPPQWRRPLESTVTIL |
| Ga0318528_103123781 | 3300031561 | Soil | RKHQEVVMVIAIGKKSANYAEQPQWRRPIEATVTVL |
| Ga0310686_1043722133 | 3300031708 | Soil | DGRRLGKLLGLSGKDHEIVMVIAIGKKSARHVDQPQWRRPLEETVRIV |
| Ga0310686_1049153433 | 3300031708 | Soil | RFLGLSNRYHEIVMVIAIGKKAATYAEPPQWRRPLDATVTVL |
| Ga0310686_1141876915 | 3300031708 | Soil | MEGFDGRRLSKFLGLSSRYYEIVIVIAIGKKSNADVVEPRWRRPLDATVTVL |
| Ga0307476_101670561 | 3300031715 | Hardwood Forest Soil | GKLLGLSGKDHEIVMVIAIGKKSAQHVDQPQWRRPLEETVRIV |
| Ga0307476_108665392 | 3300031715 | Hardwood Forest Soil | SRYHEIVLVIAIGKKSSRHVDQPQWRRPLRATVQVL |
| Ga0307474_103803063 | 3300031718 | Hardwood Forest Soil | PMEGFDGRRLSKFLGLSSRYHEIVLVIAIGKKSSRHVDQPQWRRPLRATVQVL |
| Ga0318493_109010232 | 3300031723 | Soil | EGFDGRRLARYLGLSRKHQEVVMVIAIGKKSANYAEQPQWRRPIEATVTVL |
| Ga0318521_104793581 | 3300031770 | Soil | RVLMAADSPNFLALSTRYHEIVMVIAIGKKSTSYVGTPQWRRPLDATVTVL |
| Ga0318568_103295903 | 3300031819 | Soil | TCPMEGFDGRRLSQYLGLSSQHHEIVMVIAIGKKSRAYTDPPQWRRPLSATVTVL |
| Ga0306919_103613383 | 3300031879 | Soil | PMEGFDGRRLIQYLGLSCQYHEVVMVIAIGKRSSSYVEPPQWRRPLHWTVTVL |
| Ga0318551_102411983 | 3300031896 | Soil | DGRRLSKFLGLSTRYHEIVMVIAIGKKSRSYVGPPQWRRPLDATVTVL |
| Ga0310913_100059401 | 3300031945 | Soil | GFDGRRLARYLGLSRKHQEVVMVIAIGKKSANYAEQPQWRRPIEATVTVL |
| Ga0310909_102928103 | 3300031947 | Soil | EGFDGRRLASYLGLSRKHQEVVMVIAIGKKSANYAEQPQWRRPIEATVTVL |
| Ga0310909_110481632 | 3300031947 | Soil | RHQEVVMVIAIGKKSANYAEQPQWRRPIEATVTVL |
| Ga0306926_129771072 | 3300031954 | Soil | MEGFDGRRLARYLGLSRKHQEVVMVIAIGKKSANYAEQPQWRRPIEATVTVL |
| Ga0318530_102915902 | 3300031959 | Soil | QYQEVVMVIAIGKRSSSYVEPPQWRRPLHWTVTVL |
| Ga0318530_103868341 | 3300031959 | Soil | LSSQHHEIVMVIAIGKKSRAYTDPPQWRRPLSATVTVL |
| Ga0307479_101745931 | 3300031962 | Hardwood Forest Soil | SARYHEIGLVIAVGKKSARHVDQPQWRRPLDATMHVL |
| Ga0306922_107782411 | 3300032001 | Soil | PMEGFDGRRLLKYLGLSARDHEIVMVIAMGKRSGTYVELPQWRRPLHATVSIL |
| Ga0306924_124945511 | 3300032076 | Soil | DGRRLSKLLGLSARYHEIIMVIAIGKKSSRHEDQRQWRRPIEQTVAVL |
| Ga0311301_122610372 | 3300032160 | Peatlands Soil | GLSPRIHEIVMVIAIGKKSARHVNQPQWRRPLEATVKFL |
| Ga0307470_111896142 | 3300032174 | Hardwood Forest Soil | GLSRRTLEIVMVVAIGKKSAKHVDQPQWRRPLETTVTIL |
| Ga0348332_113243573 | 3300032515 | Plant Litter | RRLSRFLGLRRQYHEIVMVIAIGKRSGDYVSEPQWRRPLDTTVTVL |
| Ga0335082_107703213 | 3300032782 | Soil | RKYHEIVMVIAIGKKSAAHIDQPQWRRPLEQTVTIL |
| Ga0335079_103452661 | 3300032783 | Soil | GLSRRYYEIVMVIAIGKRSRAYIESPQWRRPLEATVTVL |
| Ga0335080_112567991 | 3300032828 | Soil | LGLSGHHEIVMVIAIGKKSRAHDEPPQWRRPLDATVTVL |
| Ga0335081_105568751 | 3300032892 | Soil | RFSKFLGLSPKVHEIVMVIAVGKKAAGHTEQPQWRRPLDATVTVL |
| Ga0335081_108323201 | 3300032892 | Soil | ARYHEIVMVIAIGKKSRAYVEPPQWRRPLDATVTVL |
| Ga0335069_106576173 | 3300032893 | Soil | SRRTQEIVLVVAIGKKSGKHVDHPQWRRPLEETVTVL |
| Ga0335072_104064633 | 3300032898 | Soil | LSRHLGLSRKHQEIVMVIALGKKSSGYAVQPQWRRPLETTVTCL |
| Ga0335072_113434522 | 3300032898 | Soil | LSKFLGLSRRHHEIIMVIAIGKKSPRHDDQPQWRRPLEATVTFL |
| Ga0335083_101581641 | 3300032954 | Soil | RRGLSEFLGLSAKYHEIVLVIAIGKRAAAYVEPPQWRRPLEATVTVL |
| Ga0335076_100812981 | 3300032955 | Soil | LGLSRKRQEIVMVIAIGKKSSSYAAQPQWRRPLESTVTVL |
| Ga0335076_103391643 | 3300032955 | Soil | TCPMEGFDGRRLSRYLGLSSRCHEIVMVIAIGKRSRSYTEPPQWRRPLEATVTVL |
| Ga0335077_111374061 | 3300033158 | Soil | FDRRRLSQYLGLSGRYHEIVMVIAIGRKSPAYRQPPQWRRPLDATVSVL |
| Ga0335077_117396601 | 3300033158 | Soil | DGRRLARYLGLSPKCQEIVMVIAIGKKSSSCKAPPQWRRPIEATVTVL |
| Ga0326727_104466981 | 3300033405 | Peat Soil | RLSQYLGLSGRHHEIVMVIAIGKKSPAHNEPPQWRRPLDATVTIL |
| Ga0310810_102631151 | 3300033412 | Soil | PMEGFDGRRLSNYLGLTGRYHEIVMVIAMGKKSRTYVDSPQWRRPLHATVSIL |
| Ga0316215_10379731 | 3300033544 | Roots | GFDGRRLGKLLGLSAKDHEIVMVIAIGIKSARHVDHPQWRRPLEETVRII |
| Ga0334790_029249_2148_2306 | 3300033887 | Soil | MEGFDGRRLSKFLGLQSRYHEIVMVIAIGKKSGGYEAEPQWRRPLDLTVTFL |
| Ga0370492_0345727_465_602 | 3300034282 | Untreated Peat Soil | RLSRILGLSRRYHEIVMVIAIGKKSSSYVAPPHWRRPLETTVTIL |
| ⦗Top⦘ |