| Basic Information | |
|---|---|
| Family ID | F021630 |
| Family Type | Metagenome |
| Number of Sequences | 218 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAA |
| Number of Associated Samples | 171 |
| Number of Associated Scaffolds | 218 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.17 % |
| % of genes near scaffold ends (potentially truncated) | 99.54 % |
| % of genes from short scaffolds (< 2000 bps) | 86.24 % |
| Associated GOLD sequencing projects | 164 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.743 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.018 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.771 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.587 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 218 Family Scaffolds |
|---|---|---|
| PF00459 | Inositol_P | 74.77 |
| PF04343 | DUF488 | 7.34 |
| PF13714 | PEP_mutase | 4.59 |
| PF03167 | UDG | 3.21 |
| PF00072 | Response_reg | 0.46 |
| PF00218 | IGPS | 0.46 |
| PF03806 | ABG_transport | 0.46 |
| PF00158 | Sigma54_activat | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 218 Family Scaffolds |
|---|---|---|---|
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 7.34 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 3.21 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 3.21 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 3.21 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.46 |
| COG1288 | Predicted membrane transporter YfcC, affects glyoxylate shunt | General function prediction only [R] | 0.46 |
| COG2978 | p-Aminobenzoyl-glutamate transporter AbgT | Coenzyme transport and metabolism [H] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.74 % |
| Unclassified | root | N/A | 8.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1164231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300000731|JGI12381J11899_1009464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300001137|JGI12637J13337_1013131 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300001180|JGI12695J13573_1007945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300001593|JGI12635J15846_10519156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300001593|JGI12635J15846_10904953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300001686|C688J18823_10152526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1583 | Open in IMG/M |
| 3300004635|Ga0062388_102154840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300005181|Ga0066678_10070649 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300005181|Ga0066678_10596833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300005434|Ga0070709_10101061 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300005437|Ga0070710_11395122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005555|Ga0066692_10063002 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300005557|Ga0066704_10040881 | All Organisms → cellular organisms → Bacteria | 2886 | Open in IMG/M |
| 3300005560|Ga0066670_10310466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300005560|Ga0066670_10344661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300005764|Ga0066903_106640718 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005921|Ga0070766_10572192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300006028|Ga0070717_10684687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300006162|Ga0075030_100410739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300006172|Ga0075018_10603074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300006806|Ga0079220_10184006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300006806|Ga0079220_10536446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300006854|Ga0075425_100188668 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300006914|Ga0075436_100356988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
| 3300006954|Ga0079219_10580393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300007258|Ga0099793_10477974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300007265|Ga0099794_10234537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300007788|Ga0099795_10557030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300009012|Ga0066710_100217490 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
| 3300009012|Ga0066710_102106270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300009038|Ga0099829_10095234 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
| 3300009088|Ga0099830_10081698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2371 | Open in IMG/M |
| 3300009088|Ga0099830_10198425 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300009088|Ga0099830_10301586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
| 3300009088|Ga0099830_10748081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300009088|Ga0099830_11325216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300009137|Ga0066709_100313292 | Not Available | 2138 | Open in IMG/M |
| 3300009174|Ga0105241_11174569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300009444|Ga0114945_10243968 | Not Available | 1049 | Open in IMG/M |
| 3300009553|Ga0105249_13415657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300009634|Ga0116124_1006397 | All Organisms → cellular organisms → Bacteria | 5054 | Open in IMG/M |
| 3300010043|Ga0126380_10031867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2672 | Open in IMG/M |
| 3300010043|Ga0126380_11716149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300010048|Ga0126373_10977433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300010159|Ga0099796_10450213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300010321|Ga0134067_10010749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2598 | Open in IMG/M |
| 3300010358|Ga0126370_10608694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300010358|Ga0126370_12370942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300010358|Ga0126370_12475015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010359|Ga0126376_10414593 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300010360|Ga0126372_10205369 | Not Available | 1645 | Open in IMG/M |
| 3300010360|Ga0126372_11661321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300010360|Ga0126372_12339345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300010360|Ga0126372_12807358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300010361|Ga0126378_10011269 | All Organisms → cellular organisms → Bacteria | 7331 | Open in IMG/M |
| 3300010361|Ga0126378_10660018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300010361|Ga0126378_12897796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300010362|Ga0126377_10563534 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300010366|Ga0126379_10505128 | Not Available | 1281 | Open in IMG/M |
| 3300010366|Ga0126379_12755512 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300010376|Ga0126381_102808816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300010376|Ga0126381_103724400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300010396|Ga0134126_10187425 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
| 3300011270|Ga0137391_10071758 | All Organisms → cellular organisms → Bacteria | 2977 | Open in IMG/M |
| 3300012189|Ga0137388_10138164 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300012199|Ga0137383_10290337 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012200|Ga0137382_10154347 | Not Available | 1558 | Open in IMG/M |
| 3300012200|Ga0137382_10969031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300012202|Ga0137363_10200754 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300012202|Ga0137363_10303694 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300012203|Ga0137399_10173241 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300012203|Ga0137399_10191870 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300012206|Ga0137380_10384681 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300012206|Ga0137380_11492525 | Not Available | 560 | Open in IMG/M |
| 3300012207|Ga0137381_11358665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300012285|Ga0137370_10525083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300012350|Ga0137372_11062361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300012351|Ga0137386_10165077 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300012363|Ga0137390_10255048 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300012685|Ga0137397_10305300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300012918|Ga0137396_11021464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300012922|Ga0137394_10914016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012923|Ga0137359_11113863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012927|Ga0137416_11012670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012927|Ga0137416_11782372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300012929|Ga0137404_11034753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300012930|Ga0137407_11194793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300012930|Ga0137407_11565876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300012957|Ga0164303_11265255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300012971|Ga0126369_11399025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300012984|Ga0164309_11133055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300012989|Ga0164305_10865199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300014168|Ga0181534_10150242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
| 3300015051|Ga0137414_1027935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300015053|Ga0137405_1268353 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300015054|Ga0137420_1059136 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300015054|Ga0137420_1059137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300015054|Ga0137420_1155665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300015054|Ga0137420_1422792 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300015264|Ga0137403_10450377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300016341|Ga0182035_10320230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1279 | Open in IMG/M |
| 3300017656|Ga0134112_10093435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300017822|Ga0187802_10012615 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
| 3300017822|Ga0187802_10018904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2346 | Open in IMG/M |
| 3300017936|Ga0187821_10376880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300017943|Ga0187819_10537031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300017944|Ga0187786_10064442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300017947|Ga0187785_10173302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300017961|Ga0187778_10118394 | Not Available | 1655 | Open in IMG/M |
| 3300017972|Ga0187781_11370654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300017973|Ga0187780_11306975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300017973|Ga0187780_11360031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300018005|Ga0187878_1033503 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300018058|Ga0187766_10366774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300018058|Ga0187766_11289970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300018062|Ga0187784_10046306 | All Organisms → cellular organisms → Bacteria | 3517 | Open in IMG/M |
| 3300018085|Ga0187772_11165248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300018086|Ga0187769_10119127 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300018431|Ga0066655_11281606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300020021|Ga0193726_1281708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300020170|Ga0179594_10212236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300020199|Ga0179592_10031742 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300020579|Ga0210407_11300769 | Not Available | 543 | Open in IMG/M |
| 3300020579|Ga0210407_11412180 | Not Available | 516 | Open in IMG/M |
| 3300020583|Ga0210401_10419362 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300020583|Ga0210401_10818991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300021088|Ga0210404_10620514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300021168|Ga0210406_10800367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300021178|Ga0210408_10018782 | All Organisms → cellular organisms → Bacteria | 5544 | Open in IMG/M |
| 3300021178|Ga0210408_10214096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1533 | Open in IMG/M |
| 3300021180|Ga0210396_10156117 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300021405|Ga0210387_10208398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
| 3300021406|Ga0210386_10379678 | Not Available | 1217 | Open in IMG/M |
| 3300021407|Ga0210383_11738742 | Not Available | 510 | Open in IMG/M |
| 3300021432|Ga0210384_11512516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300021475|Ga0210392_10029107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3229 | Open in IMG/M |
| 3300021475|Ga0210392_10957897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300021476|Ga0187846_10127326 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300021478|Ga0210402_10673977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300021478|Ga0210402_11371516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300021478|Ga0210402_11770823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300021478|Ga0210402_11779417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300022557|Ga0212123_10133336 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300022840|Ga0224549_1047025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300024186|Ga0247688_1060153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300024227|Ga0228598_1043419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300024330|Ga0137417_1236385 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300025439|Ga0208323_1053347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300025905|Ga0207685_10852015 | Not Available | 505 | Open in IMG/M |
| 3300025922|Ga0207646_10740246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300026215|Ga0209849_1052162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300026304|Ga0209240_1219034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300026309|Ga0209055_1173114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300026310|Ga0209239_1267744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300026312|Ga0209153_1212937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300026327|Ga0209266_1227963 | Not Available | 625 | Open in IMG/M |
| 3300026361|Ga0257176_1017798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300026508|Ga0257161_1121692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300026524|Ga0209690_1089898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
| 3300026528|Ga0209378_1243202 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026536|Ga0209058_1228884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300026548|Ga0209161_10023045 | All Organisms → cellular organisms → Bacteria | 4430 | Open in IMG/M |
| 3300026910|Ga0207840_1014761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300026990|Ga0207824_1018823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300027070|Ga0208365_1060904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300027535|Ga0209734_1041719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300027603|Ga0209331_1140859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300027610|Ga0209528_1050183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300027643|Ga0209076_1074158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300027727|Ga0209328_10205711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300027767|Ga0209655_10237817 | Not Available | 595 | Open in IMG/M |
| 3300027775|Ga0209177_10291484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300027812|Ga0209656_10190506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300027846|Ga0209180_10286297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300027867|Ga0209167_10201836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300027867|Ga0209167_10458236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300027875|Ga0209283_10224218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1248 | Open in IMG/M |
| 3300028047|Ga0209526_10031870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3704 | Open in IMG/M |
| 3300028047|Ga0209526_10875118 | Not Available | 549 | Open in IMG/M |
| 3300028759|Ga0302224_10156255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300028792|Ga0307504_10249752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300029944|Ga0311352_11267109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300030906|Ga0302314_10448816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1408 | Open in IMG/M |
| 3300031231|Ga0170824_105596332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300031231|Ga0170824_122931481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300031231|Ga0170824_127659220 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300031240|Ga0265320_10199418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300031249|Ga0265339_10533791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300031446|Ga0170820_17465772 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300031446|Ga0170820_17798708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031544|Ga0318534_10610595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031572|Ga0318515_10410212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300031668|Ga0318542_10137549 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300031680|Ga0318574_10792404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300031708|Ga0310686_110758265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300031715|Ga0307476_10562863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300031720|Ga0307469_10084010 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300031754|Ga0307475_10832906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300031754|Ga0307475_11521176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300031823|Ga0307478_10555230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300031890|Ga0306925_11468190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300031890|Ga0306925_11803410 | Not Available | 586 | Open in IMG/M |
| 3300031910|Ga0306923_12410521 | Not Available | 521 | Open in IMG/M |
| 3300031912|Ga0306921_12084685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300031942|Ga0310916_11628453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031945|Ga0310913_10288503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300031947|Ga0310909_11224257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300032001|Ga0306922_10161275 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300032001|Ga0306922_10547958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300032064|Ga0318510_10490768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300032067|Ga0318524_10578241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300032091|Ga0318577_10142456 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300032173|Ga0315268_11111393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300032180|Ga0307471_100086081 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300032180|Ga0307471_101287995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300032893|Ga0335069_10606277 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300033405|Ga0326727_10230097 | Not Available | 1957 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.46% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.46% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.46% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.46% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.46% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_11642312 | 2228664022 | Soil | MQTPSPTGTVLDRILEARRAEVEHRKKVLPLTALKYGVKAATPLRDSFRRSL |
| JGI12381J11899_10094641 | 3300000731 | Tropical Forest Soil | MNASSNTGAVLDRILEARRAEVDHRKRVLPETALK |
| JGI12637J13337_10131311 | 3300001137 | Forest Soil | MGAHANTGTVLDRILEARRAEVARRKSVLPEPALKYGAAAALPLRDFPAALTRGALN |
| JGI12695J13573_10079452 | 3300001180 | Forest Soil | VLDRILESRRAEVEHRKCVLPETALKYGAKAASPVRDFFSALS |
| JGI12635J15846_105191561 | 3300001593 | Forest Soil | LSAQTNSGTVLDRILESRRAEVEHRKCVLPETALKYGAKAASPVRDFF |
| JGI12635J15846_109049531 | 3300001593 | Forest Soil | MPAQANTGTVLDRILDARRASVDHRKKVLPETALKYG |
| C688J18823_101525263 | 3300001686 | Soil | MSAEANTGTVLDRILEARRAAVDHRKRVLPQTALK |
| Ga0062388_1021548401 | 3300004635 | Bog Forest Soil | MSAHANTGTVLDRILDARRAAVDHRKRVLPETALKYGAKAATPL |
| Ga0066678_100706491 | 3300005181 | Soil | LSAQVKTGTALDRILEARRAAVEHRKKVLPETALRYGVKAATPLRDFSAAL |
| Ga0066678_105968331 | 3300005181 | Soil | MHTPPYTGTVLDRILEARLLEVEHRKKVLPQTALKYGVKAASSLR |
| Ga0070709_101010611 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAQTPANTGTVLDRILDSRRAAVEHRKKVLPETALKYGVAAAT |
| Ga0070710_113951222 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAHSNTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAPP |
| Ga0066692_100630024 | 3300005555 | Soil | MSAQANTGTVLGRILEARRAEVDHRKRVLPETALKYGVKAATP |
| Ga0066704_100408811 | 3300005557 | Soil | LSAQVKTGTVLDRILEARRAAVEHRKKVLPETALRYGVKAATPLRDFSAAL |
| Ga0066670_103104662 | 3300005560 | Soil | MCAQANTGTVLDRILESRRAEVEHRKKVLPETALKYGV |
| Ga0066670_103446611 | 3300005560 | Soil | MCAQANTGTLLDRILESRRAEVQLRKKVLPETALKYGVQAAS |
| Ga0066903_1066407182 | 3300005764 | Tropical Forest Soil | MTTPTPTGTVLDRILEARIREVEHRKKVLPETALKYGVKAATPLRDFSAALGKQG |
| Ga0070766_105721922 | 3300005921 | Soil | MSAHADSGTVLDRILYARRLEVDHRKRVLPEAALRY |
| Ga0070717_106846871 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAQTHTTGSVLDRIMESRRAAVDHRKRVLPETALKYGVAAATPLRD |
| Ga0075030_1004107392 | 3300006162 | Watersheds | MPAHANPGTVLDRILGARRAEVEHRKKVLPETALKYGVKAATPLRDFSA |
| Ga0075018_106030741 | 3300006172 | Watersheds | MSAHANTGTVLDRILEARRAEVEHRKHVLPETALKYGAAAA |
| Ga0079220_101840061 | 3300006806 | Agricultural Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKY |
| Ga0079220_105364461 | 3300006806 | Agricultural Soil | MATSAHLDEGTILGRILHARRLEVDHRKRVLPEAALRYGVN |
| Ga0075425_1001886683 | 3300006854 | Populus Rhizosphere | MCAQANTGTVLDRILESRRVEVEHRKKVLPETALKYGVQAASPLRDFVGALSR |
| Ga0075436_1003569882 | 3300006914 | Populus Rhizosphere | MSTPTPTGTVLDRILEARIREVEHRKKVLPETALKYGVKAAT |
| Ga0079219_105803932 | 3300006954 | Agricultural Soil | MRTPSPTGTVLDRILEARRAEVEHRKKVLPETALKYGVKAATPLRDFRA |
| Ga0099793_104779742 | 3300007258 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPETALKYGAKAA |
| Ga0099794_102345372 | 3300007265 | Vadose Zone Soil | MSAHANTGTVLDRILEARRAEVDHRKRVLPETALKYGV |
| Ga0099795_105570302 | 3300007788 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPEAALKYGAKAATP |
| Ga0066710_1002174905 | 3300009012 | Grasslands Soil | MCAQANTGTVLDRILESRRAEVEHRTKVLPEPALKY |
| Ga0066710_1021062701 | 3300009012 | Grasslands Soil | MCAQANSGTILGRILESRRAEVEHRKKVLPETALKYGVQAAAPL |
| Ga0099829_100952343 | 3300009038 | Vadose Zone Soil | MSAQANTGTVLDRILDARRSSVDHRKKVLPETALKYGAKAAT |
| Ga0099830_100816983 | 3300009088 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPETALKYGAKAAT |
| Ga0099830_101984253 | 3300009088 | Vadose Zone Soil | MSAHANTGTVLDRILDARRASVDHRKKVLPETALKYGAKAATPLRDFA |
| Ga0099830_103015861 | 3300009088 | Vadose Zone Soil | MFAHANTGNVLERILEARRAEVDHRKRVLPETALKYGVKA |
| Ga0099830_107480812 | 3300009088 | Vadose Zone Soil | MCAEANTGTVLGRILESRRAEIEHRKKVLPETALKYGVQAASPLRDFMGAL |
| Ga0099830_113252161 | 3300009088 | Vadose Zone Soil | MSAHANAGTVLDRILEARRAEVDHRKRVLPETALKYGVKAATP |
| Ga0066709_1003132921 | 3300009137 | Grasslands Soil | MRGGARLSAQVKTGTVLDRILEARRAAVEHRKKVLPETALRYGVKAATPLRDF |
| Ga0105241_111745691 | 3300009174 | Corn Rhizosphere | MQTPSPTGTVLDRILEARRAEVEHRKKVLPLTALKYGVKAATPLRSLSAALS |
| Ga0114945_102439681 | 3300009444 | Thermal Springs | MNTPTLEGTILGRILEARRAAVEHRKRTLPLAVLK |
| Ga0105249_134156571 | 3300009553 | Switchgrass Rhizosphere | MSAEANTGTVLDRILEARRAAVDHRKRVLPETALKY |
| Ga0116124_10063976 | 3300009634 | Peatland | MSVHANTGTVLDRILESRRAWVEHRKRVLPETVLKYGVKA |
| Ga0126380_100318675 | 3300010043 | Tropical Forest Soil | MNASFNTGTVLDRILQSRRAEVDHRKRVLPEAALKYGAKAAEPVRDFAV |
| Ga0126380_117161491 | 3300010043 | Tropical Forest Soil | MHTPVPTGTVLDRILESRRTEVEHRKKVLPETALKY |
| Ga0126373_109774332 | 3300010048 | Tropical Forest Soil | MNAHANKGTVLDRILEARRAEVERRKSVLPEMALKYGVAAASPV |
| Ga0099796_104502132 | 3300010159 | Vadose Zone Soil | MHTPVPTGTVLDRILEARRAEVEHRKQVLPETAHKYGVAAATPLRDFSAALT |
| Ga0134067_100107491 | 3300010321 | Grasslands Soil | MCAQANSGTILGRILESRRAEVEHRKKVLPETALKYGVQAAAPLRDFMG |
| Ga0126370_106086941 | 3300010358 | Tropical Forest Soil | MQPPSSTGTVLDRILEARRAEVEHRKKVLPLTALKY |
| Ga0126370_123709421 | 3300010358 | Tropical Forest Soil | MSAQANTGTILERILESRRAEVERRKKVLPETALKYGVAAASPVRDFAGALS |
| Ga0126370_124750152 | 3300010358 | Tropical Forest Soil | MCAQANNGTVLDRILESRRAEVEHRKKVLPETALRYGVQAASPLRDFASALS |
| Ga0126376_104145933 | 3300010359 | Tropical Forest Soil | MHTPVPTGTVLDRILEARRAEVEHRKKVLPETALK |
| Ga0126372_102053691 | 3300010360 | Tropical Forest Soil | MNAHANTGTVLDRILEARRAEVERRKSVLPETALKYGVAAASPVRDFVAAL |
| Ga0126372_116613211 | 3300010360 | Tropical Forest Soil | VTAHSNTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAPPVRD |
| Ga0126372_123393451 | 3300010360 | Tropical Forest Soil | MHTPVPPGTILDRILEARRAEVEHRKRVLPQTALKYGVAAATPLRDFSG |
| Ga0126372_128073582 | 3300010360 | Tropical Forest Soil | MCAQANAGTVLDRILESRRAEVEHRKKVLPETALKYGVQAASALRDFVGALSGPGINIMA |
| Ga0126378_100112698 | 3300010361 | Tropical Forest Soil | MSAHANTGTVLDRILESRRAEVDHRKRVLPETALKY |
| Ga0126378_106600182 | 3300010361 | Tropical Forest Soil | VTAHSNTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAP |
| Ga0126378_128977961 | 3300010361 | Tropical Forest Soil | MCAHANTGTLLDRILESRRAQVEHRKKVLPETALRYGVKAASPLRDIPGALRRTGLNVM |
| Ga0126377_105635341 | 3300010362 | Tropical Forest Soil | MHTPVPTGTVLDRILEARRAEVEHRKKILPETALK |
| Ga0126379_105051283 | 3300010366 | Tropical Forest Soil | MSAQANTGTILERILESRRAEVERRKKVLPETALKYGVAAASPVRDFAGALSRPGLNVV |
| Ga0126379_127555121 | 3300010366 | Tropical Forest Soil | MSAHANTGTVLERILEARRAEVEHRKKVLPETALKYGVAAASPVRDFVGALTGPGLYVVAELKPAS |
| Ga0126381_1028088162 | 3300010376 | Tropical Forest Soil | MCAQANTGTVLDRILESRRAEGEHRKKVLAETALKDGVLAASPLRDFVGVLSGPGI |
| Ga0126381_1037244002 | 3300010376 | Tropical Forest Soil | MNAHANTGTVLDRILESRRAEVERRKAVLPETALKYGVAAASPVRDFA |
| Ga0134126_101874251 | 3300010396 | Terrestrial Soil | MAMSAYADSGTVLDHILHARRLEVDHRKRVLPEAALRYG |
| Ga0137391_100717584 | 3300011270 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPETALKYGAKAATPLRDFAA |
| Ga0137388_101381641 | 3300012189 | Vadose Zone Soil | MSAQANTGTVLDRILDARRAAVDHRKKVLPETALKYGVKAATPLRDFA |
| Ga0137383_102903373 | 3300012199 | Vadose Zone Soil | VSAHANAGTVLDRILEARRAEVDHRKRVLPETALKYGVRAATP |
| Ga0137382_101543473 | 3300012200 | Vadose Zone Soil | MCAQANTGTVLDRILESRRAEVEHRKKVLPETALKYGVKA |
| Ga0137382_109690312 | 3300012200 | Vadose Zone Soil | MSAQTNTGAVLDRILEARRAEVDHRKRVLPETALRYGVKAA |
| Ga0137363_102007541 | 3300012202 | Vadose Zone Soil | MSAQANTGTVLDRILDARRAAVDHRKKVLPETALKYGVKAATPLRDFAAA |
| Ga0137363_103036943 | 3300012202 | Vadose Zone Soil | MNAHANTGTVLDRILEARRAEVDHRKKVLPETALKYGVKAAPPVR |
| Ga0137399_101732413 | 3300012203 | Vadose Zone Soil | MSAQTNTGTVLDRILEARRAEVEHRKRVLPETALKYGVKAATQLRDFSV |
| Ga0137399_101918704 | 3300012203 | Vadose Zone Soil | MSAHANAGTVLDRILEARRTEVDHRKRVLPEAALKYGAKAA |
| Ga0137380_103846811 | 3300012206 | Vadose Zone Soil | MSAHANTGTVLDRILEARRTEVDHRKRVLPETALKYG |
| Ga0137380_114925251 | 3300012206 | Vadose Zone Soil | MLGGARLSAQVKTGTVLDRILEARRAAVEHRKKVLP |
| Ga0137381_113586652 | 3300012207 | Vadose Zone Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAIPLRNFSAA |
| Ga0137370_105250831 | 3300012285 | Vadose Zone Soil | MQTPPQTGTVLDRILEARLLEVEHRKKVLPETALKYGVKAATQLRDFSSALCKHAIN |
| Ga0137372_110623612 | 3300012350 | Vadose Zone Soil | VSAHANAGTVLDRILEARRAEVDHRKRVLPETALKYGV |
| Ga0137386_101650771 | 3300012351 | Vadose Zone Soil | MSAHANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAA |
| Ga0137390_102550483 | 3300012363 | Vadose Zone Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAATPLRDFS |
| Ga0137397_103053001 | 3300012685 | Vadose Zone Soil | METPPYTGTVLDQILEARLLEVEHRKKVLPETALKYG |
| Ga0137396_110214642 | 3300012918 | Vadose Zone Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETVLKYGVKAAT |
| Ga0137394_109140162 | 3300012922 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPEVALKYGAKAATPLRAFG |
| Ga0137359_111138632 | 3300012923 | Vadose Zone Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGV |
| Ga0137416_110126701 | 3300012927 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPETALKYGAKAATPLRAFG |
| Ga0137416_117823721 | 3300012927 | Vadose Zone Soil | MSPQANTGTVLDRILDARRAAVDHRKKVLPEAALK |
| Ga0137404_110347532 | 3300012929 | Vadose Zone Soil | MSAQTNTGTVLDRILDARRASVAHRKKVLPEAALK |
| Ga0137407_111947931 | 3300012930 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKILPETALKYGAKAATPLRAFG |
| Ga0137407_115658761 | 3300012930 | Vadose Zone Soil | MSAHANTGTVLDRILDACRAAVDHRKRVLPETALKYGVK |
| Ga0164303_112652552 | 3300012957 | Soil | MSAQANTGTVLDRILEARRAEVDHRKRPLREAALRYGVKAATPVRCFSAAL |
| Ga0126369_113990251 | 3300012971 | Tropical Forest Soil | MCAHANTGTLLDRILESRRAQVEHRKKVLPETALRYGVQAASPPRDFPVALARPGLNVMGELKP |
| Ga0164309_111330551 | 3300012984 | Soil | MQTPSPTSTVLDRILEARRAEVEHRKKVLPLTALKYGVKAATPLR |
| Ga0164305_108651991 | 3300012989 | Soil | MSAQANTGTVLDRILEARRAAVDHRKRVLPETALKFGVAAASP |
| Ga0181534_101502421 | 3300014168 | Bog | MNARPNTGTVLDRILEARRAEVDRRKSVLPETALKYGVAAASPARDFIAALSVDA |
| Ga0137414_10279351 | 3300015051 | Vadose Zone Soil | MSAQANTGTVLDRILDARRAEVEHRKKVLPETALKYGVKAATKRRL |
| Ga0137405_12683533 | 3300015053 | Vadose Zone Soil | MHTPVPTGTVLDRILEARRAEVEHRKQVLPETALKYG |
| Ga0137420_10591363 | 3300015054 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPETALKYGAKAATPLRAFGAALSR |
| Ga0137420_10591371 | 3300015054 | Vadose Zone Soil | MSAQANTGTVLDRILDARRAASVDHRKKVLPETALKYGAKAATPLR |
| Ga0137420_11556652 | 3300015054 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVDHRKKVLPETALKYGAKAATPLRAFGAALSRD |
| Ga0137420_14227921 | 3300015054 | Vadose Zone Soil | MSAQANTGTVLDRILDARRASVGHRKKVLPEAALKYGAKAATPCVLLGR |
| Ga0137403_104503772 | 3300015264 | Vadose Zone Soil | METPPYTGTVLDQILEARLLEVEHRKKVLPETALKYGV |
| Ga0182035_103202301 | 3300016341 | Soil | MNAHANTGTVLDRILEARRAEVERRKNVLPETALKYG |
| Ga0134112_100934352 | 3300017656 | Grasslands Soil | MHTPPYTGTVLDRILEARLLEVEHRKKVLPQTALKYGVKAASSLRDFSAALT |
| Ga0187802_100126155 | 3300017822 | Freshwater Sediment | MNAQSNTGTVLDRILESRRAEVDHRKRVLPETALK |
| Ga0187802_100189041 | 3300017822 | Freshwater Sediment | MHSNTGTVLDRILEARRAEVEHRKCVLPETALKYGVKAVAPVRDF |
| Ga0187821_103768801 | 3300017936 | Freshwater Sediment | MSAQANTGTVLDRILESRRAEVEHRKKVLPETALKYGVKAATPLRNFCAALEHDA |
| Ga0187819_105370312 | 3300017943 | Freshwater Sediment | MSAHANTGTVLDRILESRRAWVEHRKRVLPETALKY |
| Ga0187786_100644423 | 3300017944 | Tropical Peatland | MNASFNTGTVLDRILESRRAEVDHRKRVLPETALKY |
| Ga0187785_101733022 | 3300017947 | Tropical Peatland | MNAHANTGTVLDRILEARRAEVERRKSVLPETALKYGVAAAS |
| Ga0187778_101183941 | 3300017961 | Tropical Peatland | MSAHANTGTVLDRILESRRAWVEHRKRVMPETVLKFGVQAASPVRDFAAAL |
| Ga0187781_113706542 | 3300017972 | Tropical Peatland | MNAQSNTGTVLDQILEARRAEVAHRKKVLPETALKYGVKAAAPVRDFAA |
| Ga0187780_113069751 | 3300017973 | Tropical Peatland | MSAHANTGTVLDRILESRRAWVEHRKRVLPVTVLKYGVQDAPPVR |
| Ga0187780_113600312 | 3300017973 | Tropical Peatland | MNTSSNIGTVLERILESRRVEVQRRKSVLPETALKYGVKAASPVRDFASALS |
| Ga0187878_10335035 | 3300018005 | Peatland | MSAHANTGTVLDRILESRRAWVEHRKRVLPETVLKYGVQAAPPVRDFP |
| Ga0187766_103667742 | 3300018058 | Tropical Peatland | MNAHSNTGTILDRILEARRAEVDHRKRVLPETALKYGV |
| Ga0187766_112899701 | 3300018058 | Tropical Peatland | MSAHANMGTVLDRILESRRAEVDHRKRVLPETALRYGVKAATPLRNF |
| Ga0187784_100463066 | 3300018062 | Tropical Peatland | MNAQSNTGTVLDQILEARRAEVAHRKKVLPETALK |
| Ga0187772_111652482 | 3300018085 | Tropical Peatland | MSVHPNTGTVLDRILESRRAEVEHRKRVLPETALKYGVKAAP |
| Ga0187769_101191274 | 3300018086 | Tropical Peatland | MNAQSNTGTVLDQILEARRAEVAHRKKVLPETALKYGVKAAAP |
| Ga0066655_112816062 | 3300018431 | Grasslands Soil | MCAQDNAGPVLGRILEARRAEVEHRKKVLPETALKYGVQAASPLR |
| Ga0193726_12817081 | 3300020021 | Soil | MSAQTPANTGTVLDRILESRRAAVDHRKKVLPETALKYGVAAATPL |
| Ga0179594_102122362 | 3300020170 | Vadose Zone Soil | MSAQANTGTVLGRILEARRAEVDHRKRVLPETALK |
| Ga0179592_100317421 | 3300020199 | Vadose Zone Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAATPLRNLARSPVR |
| Ga0210407_113007692 | 3300020579 | Soil | MTGHANTGTVLDRILEARRAEVEHRKHVLPQTALKYGAKVASPVRNFVEAL |
| Ga0210407_114121802 | 3300020579 | Soil | VATYLPSGTVLDRILEARRADVAHRKSVLPEAALKYGAK |
| Ga0210401_104193623 | 3300020583 | Soil | MNAHANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAPP |
| Ga0210401_108189911 | 3300020583 | Soil | MAAYINTGTVLDRILEARRAEVEHRKRVLPEAALKYGVKAATP |
| Ga0210404_106205142 | 3300021088 | Soil | MNAHANTGTVLDRILEARRAEVDHRKQVLPETALKY |
| Ga0210406_108003671 | 3300021168 | Soil | MSAQANTGTVLDRILDARRAAVDHRKKVLPETALKYGAKAAT |
| Ga0210408_100187827 | 3300021178 | Soil | MSAHANTGTVLDRILDARRAEVEHRKHVLPETALKYGAAAA |
| Ga0210408_102140961 | 3300021178 | Soil | MSAEANTGTVLDRILEARRAAVDHRKRVLPETALKYGVAAA |
| Ga0210396_101561171 | 3300021180 | Soil | MSAHANTGTVLDRILDARRAAVDHRKRVLPETALKYGVKAASPLRD |
| Ga0210387_102083981 | 3300021405 | Soil | MNAHANTGTVLDRILEARRAEVDHRQRVLPETALKYG |
| Ga0210386_103796781 | 3300021406 | Soil | MSAHADSGTVLDRILHARRLEVDHRKRVLPEAALRYGVNAATPL |
| Ga0210383_117387421 | 3300021407 | Soil | MSAQTPANTGTVLDRILESRRAAVEHRKRVLPETALKY |
| Ga0210384_115125162 | 3300021432 | Soil | MAAHANTGTVLDRILESRRAAVDHRKSVLPETALKY |
| Ga0210392_100291076 | 3300021475 | Soil | MNAHANTGTVLDRILEARRAEVDHRKQVLPETALKYGVK |
| Ga0210392_109578971 | 3300021475 | Soil | VATYLPSGTVLDRILEARRADVAHRKSVLPEAALKYGAKA |
| Ga0187846_101273261 | 3300021476 | Biofilm | MSAPSNAGTILDRILESRRAEVEHRKKVLPTTALKYG |
| Ga0210402_106739772 | 3300021478 | Soil | MSAQANTGSVLDRILEARRAEVDHRKRVLPETALKYGVKAATPLRDFS |
| Ga0210402_113715162 | 3300021478 | Soil | MSAEANTGTVLDRILEARRAAVDHRKRVLPETALKYGVAAASP |
| Ga0210402_117708231 | 3300021478 | Soil | MSAQANTGTVLDRILEARRASVDHRKKVLPEAALKYGAKAATPLRAF |
| Ga0210402_117794171 | 3300021478 | Soil | MNAHANTGTVLDRILEARRAEVDHRKRVLPETALKY |
| Ga0212123_101333363 | 3300022557 | Iron-Sulfur Acid Spring | MSAHANTGTVLDRILESRRAAVDHRKRVLPETALKYGAK |
| Ga0224549_10470251 | 3300022840 | Soil | MSAQANTGTVLDRILDARRAAVDHRKRVLPETALKYGVKAASP |
| Ga0247688_10601531 | 3300024186 | Soil | MNAHANTGTVLDRILEARRAEVDHRKRVLPETALK |
| Ga0228598_10434192 | 3300024227 | Rhizosphere | MSAQADSGTVLDRILHARRLEVDHRKRVLPEAALRYGVNAATPLR |
| Ga0137417_12363854 | 3300024330 | Vadose Zone Soil | MSAHANTGTVLDRILEARRAEVDHRKRVLPETALKYG |
| Ga0208323_10533471 | 3300025439 | Peatland | MSAHANTGTVLDRILESRRAWVEHRKRVLPETVLKYGVQA |
| Ga0207685_108520152 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAHANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAP |
| Ga0207646_107402461 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTPVPTGTVLDRILEARRVEVEHRKKVLPETALKYGVAAATPLRDFSAAL |
| Ga0209849_10521622 | 3300026215 | Soil | MSAHANTGTVLDRILQSRRAAVEHRKSVLPETALKYGAKAASP |
| Ga0209240_12190342 | 3300026304 | Grasslands Soil | MHTPVPTGTVLDRILEARRAEVEHRKQVLPETALKYGV |
| Ga0209055_11731142 | 3300026309 | Soil | MCAQANTGTVLDRILESRRAEVEHRKKVLPETALKYGVQAASPLRDFA |
| Ga0209239_12677441 | 3300026310 | Grasslands Soil | MCAQANTGTLLDRILESRRAEVQLRKKVLPETALKYGVQAASPLRDFPGALTRPGINVMAEL |
| Ga0209153_12129371 | 3300026312 | Soil | MCAQANTGTVLDRILESRRAEVEHRKKVLPETALKYGVQAAS |
| Ga0209266_12279632 | 3300026327 | Soil | MDDAGRGRLSAQVKTGTVLDRILESRRAAVEHRKKVLPETALRYGVKAATP |
| Ga0257176_10177982 | 3300026361 | Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAATPL |
| Ga0257161_11216922 | 3300026508 | Soil | MSAHANAGTVLDRILEARRAEVDHRKRVLPETALKYGAKA |
| Ga0209690_10898981 | 3300026524 | Soil | MHTPPYTGTVLDRILEARLLEVEHRKKVLPQTALKYGVKAAS |
| Ga0209378_12432021 | 3300026528 | Soil | LSAQVKTGTVLDRILEARRAAVEHRKKVLPETALRYGV |
| Ga0209058_12288841 | 3300026536 | Soil | MSAHANTGTVLDRILEARRTEVDHRKRVLPETALKYGVKAATPL |
| Ga0209161_100230456 | 3300026548 | Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGVK |
| Ga0207840_10147611 | 3300026910 | Tropical Forest Soil | MSASSNTRTILDRILESRRAEVEHRKRVLPETALKYGVK |
| Ga0207824_10188231 | 3300026990 | Tropical Forest Soil | MNASSNTGAVLDRILEARRAEVDHRKRVLPETALKYGVKAAEPVR |
| Ga0208365_10609041 | 3300027070 | Forest Soil | MSAHANTGSVLDRIMEARRAEVDHRKRVLPETALKYGVKAATP |
| Ga0209734_10417191 | 3300027535 | Forest Soil | MPAQANTGTVLDRILEARRAAVDHRKRVLPETALKYGAKAATPLRDFT |
| Ga0209331_11408592 | 3300027603 | Forest Soil | LSAYTNSGTVLDRILEARRAEVEHRKCVLPETALKYGAKAASPVRDFYSALSRD |
| Ga0209528_10501831 | 3300027610 | Forest Soil | MSAHANTGTVLDRILDARRAAVDHRKRVLPETVLKYGVKA |
| Ga0209076_10741582 | 3300027643 | Vadose Zone Soil | MNAHANTGTVLDRILEARRAEVDHRKKVLPETALKYGVKA |
| Ga0209328_102057112 | 3300027727 | Forest Soil | MSAHANTGTVLDRILDARRAAVDHRKRVLPETVLKYGVKAA |
| Ga0209655_102378171 | 3300027767 | Bog Forest Soil | VLDRILEARRAEVQHRKMVLPETALKYGAKAATPLRDFAAALLGKAR |
| Ga0209177_102914841 | 3300027775 | Agricultural Soil | MRTPSPTGTVLDRILEARRAEVEHRKKVLPETALKY |
| Ga0209656_101905061 | 3300027812 | Bog Forest Soil | MTGHANTGTVLDRILEARRAEVRHRKQVLPETALKYGAKAASPVRDFAGA |
| Ga0209180_102862972 | 3300027846 | Vadose Zone Soil | MTTPSPTDSVLDRILEARFREVEHRKKVLPETALKYGVKAATPLRDFSL |
| Ga0209167_102018361 | 3300027867 | Surface Soil | MLPSSSTGTVLDRILEARRAEVDHRKKVLPLTALKYGVKAATPLRDFSAALCKP |
| Ga0209167_104582362 | 3300027867 | Surface Soil | MSTPSPADSVLDRILEARFREVEHRKKVLPETALKYGVKAATPLRDFSAALLKPGLNV |
| Ga0209283_102242181 | 3300027875 | Vadose Zone Soil | MSAHANTGALLDRILEARRAEVDHRKRVLPETALKYGVKAATPL |
| Ga0209526_100318705 | 3300028047 | Forest Soil | LSAYTNTGTVLDRILEARRAEVEHRKCVLPETALKYGAKA |
| Ga0209526_108751181 | 3300028047 | Forest Soil | VATYLPSGTVLDRILEARRADVAHRKSVLPEAALKYGAKAATPLRDFSAALSRPGL |
| Ga0302224_101562551 | 3300028759 | Palsa | MSAYVNTGTVLDRILEARRAEVEHRKRVLPETALRYGVKAAAPVRDLLA |
| Ga0307504_102497521 | 3300028792 | Soil | MSTPSPTDSVLDRILEARFREVEHRKKVLPETALKYGVKAATPLRDFSAALL |
| Ga0311352_112671092 | 3300029944 | Palsa | VLDRILEARRAEVAHRKMVLPETALKYGVAAATPLRDFPAALSR |
| Ga0302314_104488163 | 3300030906 | Palsa | MSAYVNTGTVLDRILEARRAEVEHRKRVLPETALRYGV |
| Ga0170824_1055963322 | 3300031231 | Forest Soil | MTAHSKTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAA |
| Ga0170824_1229314811 | 3300031231 | Forest Soil | METPPYTGTVLDQILEARLLEVEHRKKVLPETALKYGVKAATPLRDF |
| Ga0170824_1276592201 | 3300031231 | Forest Soil | LSAYTNTGTVLDRILEARRTEVEHRKCVLPETALKYGAKA |
| Ga0265320_101994182 | 3300031240 | Rhizosphere | MASSAHADSGTVLDRILEARRLEVDHRKRVLPEAALRY |
| Ga0265339_105337912 | 3300031249 | Rhizosphere | METMSGETMSGDRTILDRIVDARRASVAHRKRVLP |
| Ga0170820_174657721 | 3300031446 | Forest Soil | LSAQTNSGTVLDRILESRRAEVEHRKCVLPETALKYGAKAASPVRDFYSA |
| Ga0170820_177987082 | 3300031446 | Forest Soil | MTAHSKTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAP |
| Ga0318534_106105951 | 3300031544 | Soil | MSAYSNAGTVLDRILESRRAEVEHRKRVLPETALKY |
| Ga0318515_104102123 | 3300031572 | Soil | MCAQANNGILLDRILESRRAEVQLRKRVLPETALKYGVEAASPLRDFPSALTRPG |
| Ga0318542_101375491 | 3300031668 | Soil | MSASSNTRTVLDRILESRRAEVEHRKRVLPETALK |
| Ga0318574_107924041 | 3300031680 | Soil | MSAYSNAGTVLDRILESRRAEVEHRKRVLPETALKYGVKAALP |
| Ga0310686_1107582652 | 3300031708 | Soil | VLDRILEARRAEVQHRKMVLPETALKYGAKAALPLRDFSAALSRNGASDG |
| Ga0307476_105628631 | 3300031715 | Hardwood Forest Soil | MTGHANTGTVLDRILEARRAEVEHRKHVLPQTALKYGAKAASPVRNFVEALSR |
| Ga0307469_100840101 | 3300031720 | Hardwood Forest Soil | MNAHANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAAPPV |
| Ga0307475_108329061 | 3300031754 | Hardwood Forest Soil | MSAHANTGTVLDRILEARRADVEHRKKVVPETVLKYGVKAASPPRGFSSALSR |
| Ga0307475_115211762 | 3300031754 | Hardwood Forest Soil | MSAQANTGTVLDRILEARRAEVDHRKRVLPETALKYGVKAA |
| Ga0307478_105552302 | 3300031823 | Hardwood Forest Soil | METPPYTGTVLDQILEARLLEVEHRKKVLPETALKYGVKAATPLRDFPAAL |
| Ga0306925_114681901 | 3300031890 | Soil | MSAETNIGSVLDRILEARRAAVDHRKRVLPETALKYGVKAARPPRDFA |
| Ga0306925_118034102 | 3300031890 | Soil | MNTQFNTGTVLDRILESRRAEVERRKSVLPETALKYGVKAASPVRDFVAA |
| Ga0306923_124105211 | 3300031910 | Soil | MNTQFNTGTVLDRILESRRAEVERRKSVLPETALKYGVKAASP |
| Ga0306921_120846852 | 3300031912 | Soil | MRTPSPTGTVLDRILEARRAEVEHRKKVLPLTALKYGVRAANPLRD |
| Ga0310916_116284532 | 3300031942 | Soil | MSAYSNAGTVLDRILESRRAEVEHRKRVLPETALKYGVKAALPVRDF |
| Ga0310913_102885032 | 3300031945 | Soil | MRTPSPTGTVLDRILEARRAEVEHRKKVLPLTALKYGVRAATPLR |
| Ga0310909_112242572 | 3300031947 | Soil | MSAHANTGTLLDRILESRRAEVDYRKRVLPETALRYGVAAAMPLRDFPGALTRD |
| Ga0306922_101612754 | 3300032001 | Soil | MRTPSPTGTVLDRILEARRAEVEHRKKVLPLTALKYGVRAATP |
| Ga0306922_105479583 | 3300032001 | Soil | MNAHANTGTVLDRILEARRAEVERRKSVLPETALKYGVAAASPVRDFVA |
| Ga0318510_104907681 | 3300032064 | Soil | MQTPSPTGTILERILEARRAEVEHRKRVLPLTALKYGVNAAAPL |
| Ga0318524_105782412 | 3300032067 | Soil | MNASSNQGTVLDRILEARRAEVEHRKRVLPETALKYG |
| Ga0318577_101424561 | 3300032091 | Soil | MCAHANTGTLLDRILESRRAQVEHRKRVLPETALRYGVQAASP |
| Ga0315268_111113932 | 3300032173 | Sediment | MATHKNTGTVLDKILDAKRAAIEHRKKILPETALKYGV |
| Ga0307471_1000860814 | 3300032180 | Hardwood Forest Soil | MSAQANTGTVLDRILDARRAAVDHRKKVLPETALKYGVKAATPLRDFSAAL |
| Ga0307471_1012879951 | 3300032180 | Hardwood Forest Soil | MHTPVPTGTVLDRILEARRVEVEHRKKVLPETALKY |
| Ga0335069_106062773 | 3300032893 | Soil | MNASSNSGTVLDRILESRRAEVDHRKRVLPETALKYGVQAAEPVR |
| Ga0326727_102300974 | 3300033405 | Peat Soil | MSAHANAGTVLDRILESRRAWVEHRKRVMPETVLKYGVQAAPPVR |
| ⦗Top⦘ |