Metagenome / Metatranscriptome Family F021462

Overview

Basic Information

• Family ID: F021462
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 218
• Average Sequence Length: 46 residues
• Representative Sequence: MEKKSEELKMGLDAQKSFAQMHEDRNMNKGIGGQMMQLDPVVAQE
• Number of Associated Samples: 91
• Number of Associated Scaffolds: 218

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 30.05 %
• % of genes near scaffold ends (potentially truncated): 43.12 %
• % of genes from short scaffolds (< 2000 bps): 93.12 %
• Associated GOLD sequencing projects: 90
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (92.202 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (78.440 % of family members)
• Environment Ontology (ENVO): Unclassified (94.037 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (92.661 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 49.32%
  β-sheet: 0.00%
  Coil/Unstructured: 50.68%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 218 Family Scaffolds
PF04195	Transposase_28	10.09

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.20 %
Unclassified	root	N/A	7.80 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.20 %
Unclassified	root	N/A	7.80 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	92.20 %
Unclassified	root	N/A	7.80 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	92.20 %
Unclassified	root	N/A	7.80 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	92.20 %
Unclassified	root	N/A	7.80 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	92.20 %
Unclassified	root	N/A	7.80 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	92.20 %
Unclassified	root	N/A	7.80 %

Level 8

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	92.20 %
Unclassified	root	N/A	7.80 %

Level 9

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	92.20 %
Unclassified	root	N/A	7.80 %

Level 10

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	92.20 %
Unclassified	root	N/A	7.80 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	92.20 %
Unclassified	root	N/A	7.80 %

Level 12

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	92.20 %
Unclassified	root	N/A	7.80 %

Level 13

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	92.20 %
Unclassified	root	N/A	7.80 %

Level 14

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	92.20 %
Unclassified	root	N/A	7.80 %

Level 15

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	92.20 %
Unclassified	root	N/A	7.80 %

Level 16

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	92.20 %
Unclassified	root	N/A	7.80 %

Level 17

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	92.20 %
Unclassified	root	N/A	7.80 %

Level 18

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	77.52 %
Unclassified	root	N/A	7.80 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.46 %

Level 19

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	77.06 %
Unclassified	root	N/A	7.80 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.46 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.46 %

Level 20

Name	Rank	Taxonomy	Distribution
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	76.15 %
Unclassified	root	N/A	7.80 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.46 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.46 %

Level 21

Name	Rank	Taxonomy	Distribution
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	76.15 %
Unclassified	root	N/A	7.80 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.46 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.46 %

Level 22

Name	Rank	Taxonomy	Distribution
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	74.31 %
Unclassified	root	N/A	7.80 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.46 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.46 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.92 %

Level 23

Name	Rank	Taxonomy	Distribution
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	74.31 %
Unclassified	root	N/A	7.80 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.46 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.46 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.92 %

Level 24

Name	Rank	Taxonomy	Distribution
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	43.58 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	14.68 %
Unclassified	root	N/A	7.80 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.46 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.46 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.92 %

Level 25

Name	Rank	Taxonomy	Distribution
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	43.58 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	14.68 %
Unclassified	root	N/A	7.80 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.46 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.46 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.92 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005617|Ga0068859_101091615	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	878
3300005617|Ga0068859_101866100	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	664
3300005841|Ga0068863_102501686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	526
3300009177|Ga0105248_12968512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	540
3300009975|Ga0105129_104610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	781
3300009976|Ga0105128_118886	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	531
3300009977|Ga0105141_111285	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	774
3300009980|Ga0105135_117904	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	606
3300009989|Ga0105131_118421	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	671
3300009989|Ga0105131_122267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	635
3300009989|Ga0105131_133174	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	557
3300009990|Ga0105132_108729	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	819
3300009990|Ga0105132_123294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	625
3300009990|Ga0105132_127475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	596
3300009992|Ga0105120_1014902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	806
3300009992|Ga0105120_1015429	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	797
3300009992|Ga0105120_1032585	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	623
3300009992|Ga0105120_1033503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	617
3300009994|Ga0105126_1016958	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	760
3300009994|Ga0105126_1032312	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	619
3300009994|Ga0105126_1055375	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508
3300009995|Ga0105139_1049793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	734
3300009995|Ga0105139_1095585	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	569
3300010396|Ga0134126_12890334	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	520
3300010399|Ga0134127_11709764	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	704
3300010401|Ga0134121_10848962	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	882
3300013306|Ga0163162_12167490	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	638
3300014325|Ga0163163_12387919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	587
3300014326|Ga0157380_11350581	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	762
3300014968|Ga0157379_10918356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	831
3300014968|Ga0157379_11441441	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	668
3300015270|Ga0182183_1013146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	902
3300015270|Ga0182183_1071223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	553
3300015273|Ga0182102_1004182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	928
3300015278|Ga0182099_1029214	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	653
3300015278|Ga0182099_1033699	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	628
3300015278|Ga0182099_1034315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	625
3300015280|Ga0182100_1026965	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	774
3300015280|Ga0182100_1035306	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	714
3300015284|Ga0182101_1023970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	800
3300015284|Ga0182101_1045570	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	658
3300015284|Ga0182101_1067255	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	579
3300015293|Ga0182103_1022819	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	804
3300015293|Ga0182103_1086658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	536
3300015297|Ga0182104_1010117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	1109
3300015297|Ga0182104_1113814	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	513
3300015297|Ga0182104_1116403	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	509
3300015297|Ga0182104_1117419	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	507
3300015301|Ga0182184_1019863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	861
3300015301|Ga0182184_1058108	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	609
3300015301|Ga0182184_1085592	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	533
3300015301|Ga0182184_1096506	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	511
3300015306|Ga0182180_1024748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	816
3300015306|Ga0182180_1070330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	560
3300015309|Ga0182098_1042198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	736
3300015309|Ga0182098_1055065	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	675
3300015309|Ga0182098_1080415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	595
3300015309|Ga0182098_1089673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	572
3300015309|Ga0182098_1116218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	521
3300015310|Ga0182162_1048252	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	719
3300015310|Ga0182162_1075528	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	616
3300015310|Ga0182162_1121896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	515
3300015311|Ga0182182_1011793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1078
3300015311|Ga0182182_1033533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	785
3300015311|Ga0182182_1064481	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	633
3300015311|Ga0182182_1078450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	592
3300015311|Ga0182182_1084007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	577
3300015311|Ga0182182_1107344	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	528
3300015312|Ga0182168_1105899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	557
3300015313|Ga0182164_1111099	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	547
3300015315|Ga0182120_1088345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	601
3300015315|Ga0182120_1109181	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	554
3300015315|Ga0182120_1132397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	513
3300015316|Ga0182121_1049120	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	769
3300015316|Ga0182121_1083018	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	633
3300015316|Ga0182121_1087056	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	622
3300015317|Ga0182136_1060331	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	693
3300015317|Ga0182136_1090165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	599
3300015318|Ga0182181_1036277	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	747
3300015318|Ga0182181_1064702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	616
3300015318|Ga0182181_1081369	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	570
3300015318|Ga0182181_1083220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	565
3300015318|Ga0182181_1087201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	556
3300015318|Ga0182181_1110226	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	512
3300015318|Ga0182181_1111681	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	509
3300015319|Ga0182130_1070578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	643
3300015319|Ga0182130_1086698	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	598
3300015319|Ga0182130_1102518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	562
3300015319|Ga0182130_1123735	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	523
3300015320|Ga0182165_1023813	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	971
3300015320|Ga0182165_1108056	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	570
3300015324|Ga0182134_1095318	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	598
3300015325|Ga0182148_1055526	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	718
3300015325|Ga0182148_1103957	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	574
3300015326|Ga0182166_1007402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1289
3300015326|Ga0182166_1091351	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	601
3300015326|Ga0182166_1131710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523
3300015327|Ga0182114_1025270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1001
3300015327|Ga0182114_1063522	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	731
3300015327|Ga0182114_1091144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	638
3300015327|Ga0182114_1142128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	532
3300015328|Ga0182153_1112863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	568
3300015329|Ga0182135_1069184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	687
3300015329|Ga0182135_1092119	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	618
3300015329|Ga0182135_1131156	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	538
3300015330|Ga0182152_1089007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	627
3300015330|Ga0182152_1123260	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	552
3300015331|Ga0182131_1098314	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	606
3300015331|Ga0182131_1143132	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	521
3300015331|Ga0182131_1146128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	516
3300015331|Ga0182131_1154639	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	504
3300015332|Ga0182117_1094564	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	645
3300015332|Ga0182117_1121335	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	582
3300015333|Ga0182147_1046030	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	833
3300015333|Ga0182147_1110213	Not Available	602
3300015333|Ga0182147_1124067	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	573
3300015334|Ga0182132_1084457	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	670
3300015334|Ga0182132_1093478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	644
3300015334|Ga0182132_1097524	Not Available	633
3300015335|Ga0182116_1168588	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	517
3300015336|Ga0182150_1066895	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	718
3300015336|Ga0182150_1095660	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	628
3300015336|Ga0182150_1096446	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	626
3300015336|Ga0182150_1155152	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	517
3300015337|Ga0182151_1049857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	796
3300015337|Ga0182151_1107657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	601
3300015337|Ga0182151_1150684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	524
3300015337|Ga0182151_1154980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	518
3300015338|Ga0182137_1088067	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	681
3300015338|Ga0182137_1176435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	505
3300015339|Ga0182149_1105826	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	619
3300015339|Ga0182149_1175149	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	501
3300015340|Ga0182133_1090265	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	692
3300015340|Ga0182133_1161079	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	544
3300015340|Ga0182133_1177264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	521
3300015340|Ga0182133_1177547	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	520
3300015348|Ga0182115_1150004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	746
3300015348|Ga0182115_1166781	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	706
3300015348|Ga0182115_1210260	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	623
3300015348|Ga0182115_1259219	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	552
3300015348|Ga0182115_1264930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	545
3300015348|Ga0182115_1300462	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	506
3300015349|Ga0182185_1060671	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1019
3300015349|Ga0182185_1265372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	524
3300015349|Ga0182185_1283749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	506
3300015349|Ga0182185_1289600	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	500
3300015350|Ga0182163_1121863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	802
3300015350|Ga0182163_1191577	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	640
3300015350|Ga0182163_1235099	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	574
3300015350|Ga0182163_1245855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	561
3300015352|Ga0182169_1045483	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1300
3300015352|Ga0182169_1161722	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	731
3300015352|Ga0182169_1164634	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	725
3300015352|Ga0182169_1249400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	577
3300015353|Ga0182179_1095018	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	885
3300015353|Ga0182179_1132151	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	768
3300015353|Ga0182179_1168048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	690
3300015353|Ga0182179_1177419	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	672
3300015353|Ga0182179_1256230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	565
3300015353|Ga0182179_1268920	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	551
3300015353|Ga0182179_1293955	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	528
3300015353|Ga0182179_1299783	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	523
3300015353|Ga0182179_1315345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	510
3300015353|Ga0182179_1322260	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	504
3300015354|Ga0182167_1121708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	960
3300015354|Ga0182167_1128478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	934
3300015354|Ga0182167_1190169	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	753
3300015354|Ga0182167_1197790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	736
3300015354|Ga0182167_1232081	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	669
3300015354|Ga0182167_1239893	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	656
3300015354|Ga0182167_1257904	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	627
3300017408|Ga0182197_1115502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	558
3300017412|Ga0182199_1069598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	760
3300017412|Ga0182199_1094777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	679
3300017414|Ga0182195_1052039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	874
3300017422|Ga0182201_1037011	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	795
3300017422|Ga0182201_1075870	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	630
3300017422|Ga0182201_1112863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	549
3300017432|Ga0182196_1116977	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	557
3300017435|Ga0182194_1103643	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	585
3300017439|Ga0182200_1075091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	662
3300017439|Ga0182200_1132081	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	544
3300017440|Ga0182214_1061180	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	765
3300017447|Ga0182215_1138572	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	557
3300017691|Ga0182212_1157071	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	519
3300017693|Ga0182216_1077680	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	763
3300017694|Ga0182211_1178309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	508
3300020031|Ga0182119_106502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	525
3300026088|Ga0207641_11083077	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	800
3300028049|Ga0268322_1039315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	572
3300028050|Ga0268328_1040639	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	620
3300028053|Ga0268346_1014673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	712
3300028055|Ga0268338_1011112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	770
3300028061|Ga0268314_1016796	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	757
3300028064|Ga0268340_1038466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	675
3300028151|Ga0268308_1011532	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	710
3300028152|Ga0268336_1010859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	692
3300028152|Ga0268336_1017176	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	605
3300028154|Ga0268341_1013545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	655
3300028474|Ga0268331_1023683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	533
3300028476|Ga0268329_1005925	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	798
3300032490|Ga0214495_1146816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523
3300032502|Ga0214490_1112532	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	620

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	98.62%
Environmental	Environmental	1.38%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	98.62%
Terrestrial	Environmental → Terrestrial	1.38%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	84.86%
Unclassified	Host-Associated → Plants → Unclassified	9.17%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.29%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.83%
Soil	Environmental → Terrestrial → Soil	1.38%
Roots	Host-Associated → Plants → Roots	0.46%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	84.86%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	9.17%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.29%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.83%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.38%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.46%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	84.86%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	9.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.29%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.83%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.38%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.46%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	78.44%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	9.17%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	6.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.83%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.38%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.38%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.46%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated
3300009977	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG	Host-Associated
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300020031	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068859_1010916152	3300005617	Switchgrass Rhizosphere	VEKESKEFKMGLDAQKSFAQMHEDGNVNKEIGVQVMQVMKLDPIVTQEPKEEK*
Ga0068859_1018661001	3300005617	Switchgrass Rhizosphere	LRFQMEKKSEEFEMGLDAQKRFAQMHEDRNMNEGIGGQMMKLDPIVA*
Ga0068863_1025016861	3300005841	Switchgrass Rhizosphere	MEKESEKLEMGLDAQESFAQMHEDRNMNKGIGGQMM
Ga0105248_129685122	3300009177	Switchgrass Rhizosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQEPRKE
Ga0105129_1046101	3300009975	Switchgrass Associated	VEKESKEFKMGPDAQKSFVQMHEDRNVYKGIGGQVMKLDPV
Ga0105128_1188861	3300009976	Switchgrass Associated	MEKESGKLKMGLDAQERFTQMHEDRNMNKGIGGQMM*
Ga0105141_1112852	3300009977	Switchgrass Associated	MEKESKKLKMGLDAQESFAQMHEDRNMNKRIGGQMMQLDHVVA*
Ga0105135_1179041	3300009980	Switchgrass Associated	MERILEEFKIGLNAQKSFAQMHEDIYMNNRIGGKKMKLDPIILQESRKEIRVG
Ga0105131_1089081	3300009989	Switchgrass Associated	MGLDAQKIFAQMYKDGNMNKGVWGQVVKLDPVIMQELREEI*
Ga0105131_1184211	3300009989	Switchgrass Associated	MEKKSEKLKMGLDAQKCFAQVHEDRNMNEGIGGQMMKLDPV
Ga0105131_1222671	3300009989	Switchgrass Associated	LWLKVEKESKEIKMGLDAQKSFAQIHKDRNVNKEIGGQVVKLDPII
Ga0105131_1331741	3300009989	Switchgrass Associated	MEKKSEEFEMGIDAQKSFAQMHEDRNMKEGIGGQMMKLDPVVAQDSKKERRAWEP*
Ga0105132_1087292	3300009990	Switchgrass Associated	LEKKSKEFELGLDAQKCFAQMHEDRNMNERIGGQMMKLDPVVAQE
Ga0105132_1232941	3300009990	Switchgrass Associated	MKKESEKLKMGLDVQESFAQMHEDRNMNKGIGGKMMQLDPVVA*
Ga0105132_1274752	3300009990	Switchgrass Associated	MEKESKELKMGLDVQKSFAQMYEDRNMNKGIGGQVVKLDPVVTQEPKEEN*
Ga0105120_10149022	3300009992	Switchgrass Associated	MEKEPEEFKMGLDAQKSFAQMHEDGNVNKGIWGQMMQLDPVIAQESRKER*
Ga0105120_10154291	3300009992	Switchgrass Associated	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQVVKLDPIVT*
Ga0105120_10325851	3300009992	Switchgrass Associated	VEKKLEELKMGLDVQKSLAQIHEDGNMNKGIGGQVVKLNPVVM*
Ga0105120_10335032	3300009992	Switchgrass Associated	MEKKSEEFEMGLDAQKSFAQMHEDRNMNERIGGQMMKLDPVVA*
Ga0105126_10169581	3300009994	Switchgrass Associated	VEKKSKEFKMGLDAQKSFAQVHEDGNVNKGIGGQMVELDPVIAQEPREEN*
Ga0105126_10323121	3300009994	Switchgrass Associated	MEKESEKLKMGLDAHESFTQMHEDRNMNKGIGGRMMQLDPVVL*
Ga0105126_10553751	3300009994	Switchgrass Associated	MEKESEKFKMCLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVVQ*
Ga0105139_10497932	3300009995	Switchgrass Associated	WLRFKVEKESKEFKMGLDGQKSFVQMHKDRNVNKEIVGQVMQLDPVIAQETIEEKRTR*
Ga0105139_10955851	3300009995	Switchgrass Associated	VEEESKEFKIGLDAQKSFAQMHKDGNVNKGIGIQMMKLDPVVYVDAS*
Ga0134126_128903342	3300010396	Terrestrial Soil	MEKKSEELKMGLDAQKSFAQMHEDINVNKGIGGQVMKLDPVVAQESREEK*
Ga0134127_117097642	3300010399	Terrestrial Soil	MEKEAKELKMGLDAQKSFAQMYEDRNMNKRIWDQMVKLDPVI*
Ga0134121_108489622	3300010401	Terrestrial Soil	VEKESKELKMGLDAQKSFAQMHKDRNMNKGIGGQMMQLDPVIAQEPREEK*
Ga0163162_121674901	3300013306	Switchgrass Rhizosphere	MKKVVEEFKMGLDAQKSFAQMHEDGNVNKEIGVQVMKLDP
Ga0163163_123879191	3300014325	Switchgrass Rhizosphere	VEKKSKKLKMGLDAQKSFAQMYEDRKMNKRIGGQMVKLDPVIGQEPRKET
Ga0157380_113505811	3300014326	Switchgrass Rhizosphere	VEKESKELKMGLDAQKSFAQMHEDRNMNEGIGGQMMKLDPVVA*
Ga0157379_109183561	3300014968	Switchgrass Rhizosphere	MEKESEKLEMGLDAQESFAQMHKDRNMNKGIGGQMMQLDPVIA*
Ga0157379_114414412	3300014968	Switchgrass Rhizosphere	MEKESEKLKMGLDAQESFTQIHKDRNMNKGIRGQMMQLDPV
Ga0182183_10131462	3300015270	Switchgrass Phyllosphere	VEKESKEFKMGLYAQKSFAQIHEDGNVNKGIGGQVMKLDPVVAQESREEK*
Ga0182183_10712232	3300015270	Switchgrass Phyllosphere	MEKELEEFKMGLDAQKSFAQMHEDRNVNKGIGGQVMQLDPVVAQESREE
Ga0182102_10041821	3300015273	Switchgrass Phyllosphere	MEKKTKELEMGLDAQKSFAQMYEDRKMNKRFVGQMVKLDPVIGQEPSKET*
Ga0182099_10292141	3300015278	Switchgrass Phyllosphere	VEKESKEFKMGLDGQKNFVQMHKDRNVNKEIGGQVMQ
Ga0182099_10336993	3300015278	Switchgrass Phyllosphere	MEKESKELKMGLDAQKSFAQMHKDRNMNKRIGGQAMKLDPVVEQEPREEK*
Ga0182099_10343151	3300015278	Switchgrass Phyllosphere	VFKVEKESKEFKMGLDAQKSFAQMHEDGNVNKGIGGQVMKLDPIVAQ*
Ga0182100_10269652	3300015280	Switchgrass Phyllosphere	MEKVAEEFKMGLDAQKSFAQMYEDRKMKKGIGGQMMKLDLVVAQE
Ga0182100_10353062	3300015280	Switchgrass Phyllosphere	MEKESKKLKMGLDAQESFAQMHEDRNMNKRIGGQMM*
Ga0182101_10239702	3300015284	Switchgrass Phyllosphere	VEIWLWFQVEKESKEFKMGLDAQKSFAQMHEDGNVNKEIGCQMMK
Ga0182101_10455701	3300015284	Switchgrass Phyllosphere	VEKESKEFKMGLDAKKSFAQMHEDRNMNKRIGGQVMELDPVLAQ
Ga0182101_10672551	3300015284	Switchgrass Phyllosphere	VEKESKEFKMGIDAQKSFAQMHEDGIVNQGIGGQVMKLDPVVV
Ga0182103_10228191	3300015293	Switchgrass Phyllosphere	VERESKELKMGLDAQKSFAQMYEDRNMDKGIGGQMMKLDTVVAQEPREEK*
Ga0182103_10866581	3300015293	Switchgrass Phyllosphere	MEKIAEELKMGLDAQKSFAQMHEVRNMNKGIWGQMMQLDPVVAQE
Ga0182104_10101171	3300015297	Switchgrass Phyllosphere	VEKKSKKLKMGLDAQKSFAQMHGDGNMSKEIGGQVVKLDPVVMQELREET
Ga0182104_11138141	3300015297	Switchgrass Phyllosphere	MGLDAQKSFAQMYEDRKMNKRIGGQVVELDHVVRQEPTKETRT
Ga0182104_11164031	3300015297	Switchgrass Phyllosphere	MEKDSEEFKMGLDAQKSFAQMHEDRNVNKEIGGQVMKLDPVVAQEPKEEK*
Ga0182104_11174191	3300015297	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDGNMNKRIGGQVMK
Ga0182184_10198371	3300015301	Switchgrass Phyllosphere	MEKEPKEFEMGLDAQKSFAQMHEDGNVNKGIGVK*
Ga0182184_10198632	3300015301	Switchgrass Phyllosphere	MEKKLKKLKMGLDAQKSFAQMHEDRNMNKGIEGQMVKLDPVVAQEPKEEK*
Ga0182184_10581081	3300015301	Switchgrass Phyllosphere	MEKELEKLKMGLDAQKSFAQMYEDRHMNKGIWGQMMQLDPVVA*
Ga0182184_10855921	3300015301	Switchgrass Phyllosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVA
Ga0182184_10965062	3300015301	Switchgrass Phyllosphere	MQKKSEEFEMGLDAQKCFAQMHEDRNMNEGIGGQMMKLDPVVAQESRKERR
Ga0182180_10247481	3300015306	Switchgrass Phyllosphere	MEKDPKEFEMGLDSQKSFAQMHKDGNVNKGIGGQMVELDPVIAQEPREEN*
Ga0182180_10703301	3300015306	Switchgrass Phyllosphere	MEKKSEEFEMGLDAQKGFAQMHEDRNMNEGIGGQMMKLDPVVAQDSRK*
Ga0182098_10421983	3300015309	Switchgrass Phyllosphere	MEKKSEEFEIGLDAQKRFTQMHEDRNMNEGIGGQMMKLDPVVAQEPREEK*
Ga0182098_10550651	3300015309	Switchgrass Phyllosphere	MGLDAQKSFAQMHEDRNMNKEIGGQMVKLDPVVEQGPREEK*
Ga0182098_10804152	3300015309	Switchgrass Phyllosphere	VEKESKEFKMELDAQKSFAQMHEDGNVNKGIGGQVMKLDPVITQESREEK*
Ga0182098_10896731	3300015309	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAEMHEDGNMNKGIGGQVMKLDPVVAQESREEI*
Ga0182098_11162181	3300015309	Switchgrass Phyllosphere	VEKKSKELKMGLDAQKSFAQIHEDGNVNKEIGSQVMKLDLVVAQEPRKEKRTRKPQSSLQIR
Ga0182162_10482521	3300015310	Switchgrass Phyllosphere	MEKKSEEFEMGLDAQKCFAQMHEDRNMNEGIGGQMMKLDPVVA*
Ga0182162_10755281	3300015310	Switchgrass Phyllosphere	VEKKSKELKMGFDAQKSFAQMHEDGNMNERVWGQVVKLDPVIMQEPREEN*
Ga0182162_11218962	3300015310	Switchgrass Phyllosphere	VETESEEFKMGLDAKKSFAQMHEDRNVNKGIGSQVMKLDPVEA*
Ga0182182_10117931	3300015311	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDKNVNKGIGGQMMKLDPVVS*
Ga0182182_10335332	3300015311	Switchgrass Phyllosphere	MEKKSEKLKMGLDAQKSFAEMHEDGNMNKGIGGQVVKLDSIVM*
Ga0182182_10644811	3300015311	Switchgrass Phyllosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIWGQMMQLDPVVA*
Ga0182182_10784501	3300015311	Switchgrass Phyllosphere	VEKKSKELKMGLNAQKSFAQMHEDRNMNERVWGQVVKLNP
Ga0182182_10840071	3300015311	Switchgrass Phyllosphere	VEKESKELKMGLDAQKSFAQMHEDRNMNKRIGGQVMKLDPVIAQEPREEK*
Ga0182182_11073441	3300015311	Switchgrass Phyllosphere	GIRMRFQVEKESKEFKMGLDAQKNFAQMHEDRYVNKRIGGQVVKLDPVIP*
Ga0182168_11058992	3300015312	Switchgrass Phyllosphere	MEKELEKLEMGLDAQESFAQMHEDRNMNKGIGGQMMQLDL*
Ga0182164_11110991	3300015313	Switchgrass Phyllosphere	MEKESKEFKMGLDAQKSFAQMHEDGNVNKGIGGQVMKLDPVVAQEPREEK*
Ga0182120_10883451	3300015315	Switchgrass Phyllosphere	MEKEPKEFEMGLDSQKSFVQMHEDGNVNKGIGGQMVELDPVIAQEPREEN*
Ga0182120_11091811	3300015315	Switchgrass Phyllosphere	VEKESKELKMGLDAQKSFAQMHEDRNVNKGVGDQVIKLDPVVAQEPREEK*
Ga0182120_11323971	3300015315	Switchgrass Phyllosphere	FEMGLDAQKSFAQMYEDRKMNKRFVGQMVKLDPVIGQEPSKET*
Ga0182121_10491202	3300015316	Switchgrass Phyllosphere	MGLDDQKSFAQMHEDRNVNKGIEGQTVKLDPVVAQEPKEEK*
Ga0182121_10830181	3300015316	Switchgrass Phyllosphere	MEEESKEFKMGLDAQKSFAQMHEDGIVNQGIGGQVMKLDPVVAQESRE
Ga0182121_10870561	3300015316	Switchgrass Phyllosphere	MGLDAQKSFAQMHEDRNVNKGIGGQVMQLDPVVAQESREER*
Ga0182121_11474762	3300015316	Switchgrass Phyllosphere	MGLDAQKSFAQMYKDRKVNERIGGQMVALDLITGQEPSEES*
Ga0182136_10603312	3300015317	Switchgrass Phyllosphere	VEKKSKELKMGLDAQKSFAQMHENGNVNKGIGSQVMKLDPIVAQESRKEK*
Ga0182136_10901651	3300015317	Switchgrass Phyllosphere	MEKESEEFKMGLDAQKSFAQMHEDRNMNKRIGGQMVQLDPVVAQEPRKE
Ga0182181_10362771	3300015318	Switchgrass Phyllosphere	MEKKSEEFEMGLDAQKSFAQMHEDRNMNEEIGGQMMKLDPIVT*
Ga0182181_10647021	3300015318	Switchgrass Phyllosphere	VEKESKEFKMRLDAQKSFAQMHEDGNMNKGIKGQVMKLDLVITQEPRK*
Ga0182181_10813692	3300015318	Switchgrass Phyllosphere	MEKESKEFKMGLDAQKSFAQIHED*NMNKGIGGQMVELDPIVAQESREEK
Ga0182181_10832201	3300015318	Switchgrass Phyllosphere	MEKEPKEFKMGLDAQKSFAKVHEDRNMSKGIGGQVLKLDPIVAQELEKKDE
Ga0182181_10872011	3300015318	Switchgrass Phyllosphere	VEKESKELKMGLDAQKSFAQMYEDGNVNKGIGGQVMKLDPVITQESREEK*
Ga0182181_11102261	3300015318	Switchgrass Phyllosphere	MEYKLEEFKMGLDAQESFAQMHKDRNMNKGIGGQVMKLDSVVAQEPREQK*
Ga0182181_11116811	3300015318	Switchgrass Phyllosphere	MEKEPEEFKMGLDAQKSFAQMHKDRNMNKGIGDQMMQLDPVVA*
Ga0182130_10705781	3300015319	Switchgrass Phyllosphere	MEKEAEEFKMGLDAQKSFAQMHKDRNVNKGIGGQMVKLDPVVAQEPREE*
Ga0182130_10866981	3300015319	Switchgrass Phyllosphere	LWLKVEKESKEFKMGLDAQKSLAEMHEDGNMNKGIGGQVMKLDPVVAQESRE
Ga0182130_11025181	3300015319	Switchgrass Phyllosphere	MEKESEKLKMGLDAQESFAQMHKDRNMNKRIGGQMVELDPVVAQEPREEK*
Ga0182130_11237352	3300015319	Switchgrass Phyllosphere	MEKESKEFKMGLDAQKSFAQMYEDRNMNKRIGGQMVKLDPAVEQESREEK*
Ga0182165_10238132	3300015320	Switchgrass Phyllosphere	MEKIAEKFKMGLDAQKSFAQMYEDGNMNKGIGGQMVQLDHVVAQE
Ga0182165_11080561	3300015320	Switchgrass Phyllosphere	MEKESEKLKMGLDAQESFAQMHKDRNMNKGIGGQMMQLDPVVA*
Ga0182134_10953182	3300015324	Switchgrass Phyllosphere	MEKEPKEFEMGLDVQKSFAQMHEDENVSKGIGGQVMKLDPVIAQEPKNEKRTKKPQFPF*
Ga0182148_10555261	3300015325	Switchgrass Phyllosphere	VEKEPKEFKMGLDAQTSFAQMHEDRNVNKGIGGQMMELDPVVAL
Ga0182148_11039571	3300015325	Switchgrass Phyllosphere	VEKESKEFKMGLDGQKSFVQMHKDRNVNKEIGGQVMQLDPVIAQETIEEKRTR*
Ga0182148_11249891	3300015325	Switchgrass Phyllosphere	MEEMAKKLKMGLDAQKSFTQMHEDRNMNKGIGGQMM*
Ga0182166_10074022	3300015326	Switchgrass Phyllosphere	MEKESEKLKMGLDAKESFAQMHGDRNMNKGIGGQMVKLDSVVAQESKEEK*
Ga0182166_10913512	3300015326	Switchgrass Phyllosphere	MEKIAEELKMGLDAQKSFAQMHEDRNMNKGIEGQMMQLDPVVAQEPRKER
Ga0182166_11317101	3300015326	Switchgrass Phyllosphere	VEKEPEELKMGFDAQKSFAQMHEDGNVNKGIGGQVMKLN
Ga0182114_10252702	3300015327	Switchgrass Phyllosphere	MEKEPKEFEMGLNAQKSFAQMDEDVNVNKGIGGQVMKLDSVVA*
Ga0182114_10635222	3300015327	Switchgrass Phyllosphere	MEKKSEEFKMGLDAQKSFAQMHEDGNINKEIWGQMMQLDPVVAQEPRKER
Ga0182114_10911441	3300015327	Switchgrass Phyllosphere	MEKELKEFKMGLNAQKSFAQMHEVGNVNKGIGGQMVELDPVIAQEPREEKRTRKP*
Ga0182114_11421281	3300015327	Switchgrass Phyllosphere	KSEEFKMGLDAQKSFAQMHEDGNVNKEIGVQVMQVMKLDPIVTQEPKEEK*
Ga0182114_11532701	3300015327	Switchgrass Phyllosphere	MEKIAEELKMGLDAQKSFAQMHEDRNMNKGIWGQMM*
Ga0182153_11128632	3300015328	Switchgrass Phyllosphere	MEKESKEFKMGLDAQKSFAQMYEDRNMNKRIGGQMVKLDPIVTQEPREEK*
Ga0182135_10640382	3300015329	Switchgrass Phyllosphere	MEKKSEELKMGLDAQKSFAQMHEDRNMNKGIGGQMM
Ga0182135_10691841	3300015329	Switchgrass Phyllosphere	MGLDAQKSFTQMHEDRNVNKEIGGQVMKLDPVVAQEPREEK*
Ga0182135_10921191	3300015329	Switchgrass Phyllosphere	VEKESEELKMGLDAQKSFAQMYEDGNVNQGIRGPMMKL
Ga0182135_11311561	3300015329	Switchgrass Phyllosphere	MEYKLEEFKMGLDAQKSFAQMHEDRNMNKRIGGQMVKLDS
Ga0182152_10534341	3300015330	Switchgrass Phyllosphere	MEKKPKEFKMGLDAQKIYAQMYEDGNMNKGVWGQVVKLDPVIMQEPREKSQTREP*
Ga0182152_10890071	3300015330	Switchgrass Phyllosphere	VEKESKEFKMVLDAQKSFAQMHEDINMDKRIGGQVMKLDPVITQESREEK*
Ga0182152_11232601	3300015330	Switchgrass Phyllosphere	MEKESEKLEMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQES
Ga0182131_10983141	3300015331	Switchgrass Phyllosphere	MGLDAQKSFAQVHEVRKVNKGIGGQVMKLDPVVAQKSREEK*
Ga0182131_11431321	3300015331	Switchgrass Phyllosphere	MEKELEEFKMELDAQKSFAQMHEDGNVNKGIGGQVMKLNL*
Ga0182131_11461281	3300015331	Switchgrass Phyllosphere	MEKIAEELKMGLDAQKSFAQMHEDINLNKEIGGQMVQLDLVVAQEPRKE
Ga0182131_11546392	3300015331	Switchgrass Phyllosphere	VEKKSEEFKMGLDAQKSFAQMHEDRNMNKGIEGQMVKLDPVGAQEPREEK*
Ga0182117_10945641	3300015332	Switchgrass Phyllosphere	FEVKKESKEFKMGLDAQKSFAQTHEDGNMNKRIGGQVMKLDPVVAQETREEKWMRKP*
Ga0182117_11213351	3300015332	Switchgrass Phyllosphere	LWLEVEKMAEMFKMGLDAQKSFAQMHEDRNMNKGIGGQMMQLDPVVA
Ga0182147_10460301	3300015333	Switchgrass Phyllosphere	VEKESKEFKMVLDAQKSFAQMHEDGNVNKRIGSQVMKLDPIVAQEPREEKRTRKPQSSF*
Ga0182147_11102131	3300015333	Switchgrass Phyllosphere	VEKESKEFKMELDAQKSFSQMHEDGNMNKQIGGQVMKLDPVV
Ga0182147_11240671	3300015333	Switchgrass Phyllosphere	LRLQIEKESKKLKMGLDAQESFAQMHEDRNMNKKIGGQMMQLDLVVAQ
Ga0182132_10844571	3300015334	Switchgrass Phyllosphere	MEKKSEEFEMGLDAQKSFAQMYEDRNMNKGIGGQMVQLDHVVAQEPRKERRARKP*
Ga0182132_10934781	3300015334	Switchgrass Phyllosphere	MEKESKKLKMGLDAQESFTQMHEDRNMNKRIGGQMMQLDPVVAQE
Ga0182132_10975241	3300015334	Switchgrass Phyllosphere	VEKESKEFKMELDAQKSFSQMHEDGNMNKQIGGQVMKLDPIVAQEHRK
Ga0182116_11685882	3300015335	Switchgrass Phyllosphere	MEKELEKLKMGLDAQESFAQMHENRNMNKGFGGQMMQLDPVV
Ga0182150_10668951	3300015336	Switchgrass Phyllosphere	MEKKSDKFEMGLDAQKSFAQMHEDRNMNEGIGGQMMKLDPIVAQKSRKKR*
Ga0182150_10956601	3300015336	Switchgrass Phyllosphere	MKKELKELKMGLDARKSFAQMHEDRNMNKGIGGQVVKLDPIVT*
Ga0182150_10964462	3300015336	Switchgrass Phyllosphere	MEKELEEFKMGLDAQKSFAQMHEDRNVNKGIGSQVMKLDPVVA*
Ga0182150_11204501	3300015336	Switchgrass Phyllosphere	KKLEMGLDAQKCFAQMHKDGNVNKEIGGQLMKLDSVIT*
Ga0182150_11551521	3300015336	Switchgrass Phyllosphere	MRFQVKKEPKEFEMGLDAQKSYAQMHEDGNVNKGIEGQVMELDPVVTQEPREEN*
Ga0182151_10498572	3300015337	Switchgrass Phyllosphere	VEKKSKEFKMGLDAQKSFAQVHKDGNVNNGIGGQVMKLDPVVAQEPREEKRTRKPQSSF*
Ga0182151_11076572	3300015337	Switchgrass Phyllosphere	MEKKSKELKIGLDAQKSFTQMHEYRNMNNEIGGQVVKLDPIVTQEPREENR
Ga0182151_11506841	3300015337	Switchgrass Phyllosphere	MEKIAEELKMGLDAQKSFAQMHEDRNVNKGIGGHVMKQDPVVAQESREER*
Ga0182151_11549802	3300015337	Switchgrass Phyllosphere	LRFQIEKKSEEFEMGLDAQKSFAQMHEDRNMNEGIGGQMMKLDP
Ga0182137_10880671	3300015338	Switchgrass Phyllosphere	VGLRLQMEKESEKLEMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVA*
Ga0182137_11764351	3300015338	Switchgrass Phyllosphere	VEKESKELKMGLDAQKSFAEMYED*NVNKGIWSQVMELDP
Ga0182149_10100181	3300015339	Switchgrass Phyllosphere	MGLDAQKSFAQMYEDRNMDKGIGSQVVKLDPIVMQEPREEI*
Ga0182149_11058261	3300015339	Switchgrass Phyllosphere	MEKEPKEFEMGLDSQKSFAQMHEEGNVNKGIEGQMVELDPVIVQEPKEKI
Ga0182149_11408412	3300015339	Switchgrass Phyllosphere	MGLDAQKSFAQMCEDRNMDKGIGSQVVKLDPIVMQEPREE
Ga0182149_11751492	3300015339	Switchgrass Phyllosphere	MEKEPKEFEIGLDAQKRFAQMHEDGNVNKAIGGQVVELDPIIAQEPREEKR
Ga0182133_10902652	3300015340	Switchgrass Phyllosphere	VEKESEELKMGLDAQKSFAQMYEDGNVNQGIRGPMMKLDPVVT*
Ga0182133_11610792	3300015340	Switchgrass Phyllosphere	VEKKSKKLKMGLDAQKSFAQMHEDGNMSEEIGGQVVKLH
Ga0182133_11772641	3300015340	Switchgrass Phyllosphere	LEEFKMGLDAQKSFAQMHEDGNVNKEIGVQVMKLDPIVTQEPKEEK*
Ga0182133_11775471	3300015340	Switchgrass Phyllosphere	MEKKSEEFEMGLDVQKSFAQMHEDRNVNKGIGGQVMQLDPVVAQESREER*
Ga0182115_11500041	3300015348	Switchgrass Phyllosphere	MEKESEKLEMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVA*
Ga0182115_11667811	3300015348	Switchgrass Phyllosphere	VEKESKELKMGLDAQKSFAKMHEDGNVNKGIGGQVIKLDPVVAQVPREEK*
Ga0182115_12102602	3300015348	Switchgrass Phyllosphere	VEQKSKELKMGLDAQKNFAQMYEDGNMNKEIWGQVIQLDPVTMQEPREKSR
Ga0182115_12592191	3300015348	Switchgrass Phyllosphere	MGLDAQESFAQMHEDRNMNKEIGGQMMQLDPVVAQESKKERRTRK
Ga0182115_12649301	3300015348	Switchgrass Phyllosphere	MEKKSEEFEIGLDAQKRFAQMHEDRNMNEGIGGQMMKLDPVVA
Ga0182115_13004621	3300015348	Switchgrass Phyllosphere	FKMGLDAQKSFAQVHEDRKVNKEIGGQMMKLDPVVAQEPREEK*
Ga0182185_10606711	3300015349	Switchgrass Phyllosphere	MEKESEEFKMGLDAQKSFAQMHEDINVNKGIGGQVMKLDPVVAQESREER*
Ga0182185_12653721	3300015349	Switchgrass Phyllosphere	VEKEMKEFKMGLDAPKSFAQMHKDGNVNKGIGGQVMKLDP
Ga0182185_12837491	3300015349	Switchgrass Phyllosphere	MEMESKEFKLGLDAQKNVAQMHKD*NVYKGIGHQMVELDPVVAQEPREEK
Ga0182185_12896002	3300015349	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDRNVNKGIGGQVMQLDPVVAQESREER*
Ga0182163_11218631	3300015350	Switchgrass Phyllosphere	RFKVEKESKEFKMGLDAQKSFAQMHKDRNMNKRIGGQMVELDPVVAQEPREEK*
Ga0182163_11915771	3300015350	Switchgrass Phyllosphere	MEKESKEFKMGLDAQKSFSQMHEDGNMNKGIGGQVMKLDPVITQESREEK*
Ga0182163_12350991	3300015350	Switchgrass Phyllosphere	MEKELEKLEMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVVQ*
Ga0182163_12458552	3300015350	Switchgrass Phyllosphere	MEKEPKEFEMGLDAQKSFAQMHEDENVNKGIGDQVMKLDPVVA*
Ga0182163_12814192	3300015350	Switchgrass Phyllosphere	MGLDAQKSFAQVHEDRKVNKEIGGQMMKLDPVVAQE
Ga0182169_10454831	3300015352	Switchgrass Phyllosphere	KKSEELKMGLDALKSFAQMYEDGNMKERIWGQVVKLDPVIM*
Ga0182169_11617223	3300015352	Switchgrass Phyllosphere	MEKIGEKFKIGLDAQKSFAQMHEDGNMNKRIWGQMMQLDPVVAQEPREERR
Ga0182169_11646341	3300015352	Switchgrass Phyllosphere	VEKESKEFEMGFDAQKSFAQMHEVGNVNKGIGGQMVELDPVIAQEPREEK*
Ga0182169_12494001	3300015352	Switchgrass Phyllosphere	VEKESKEFEMGFDAQKSFAQMHEDGNMNKGIGGQVMKLD
Ga0182179_10950182	3300015353	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDGNMNRRIGGQVMKLDLVIMQESREEKRTRKPQS*
Ga0182179_11321511	3300015353	Switchgrass Phyllosphere	VEKESKEFKMGLYAQKSFAQIHEDGNVNKGIGGQVMRLDPVVAQESREEK*
Ga0182179_11680482	3300015353	Switchgrass Phyllosphere	MEKEPKEFEMGLDSQKSFVQMHEDGNVNKGIGGQMVELDPVVTQEPREERRTRK
Ga0182179_11774192	3300015353	Switchgrass Phyllosphere	MLQMEKESEKLKMGLDAQESFAQIHEDRNMNKGIGGQMM
Ga0182179_12562301	3300015353	Switchgrass Phyllosphere	MEKDPKEFEMGLDSQKSFAQMHKDGNVNKGIGGQMVELDLVIAQ*
Ga0182179_12689201	3300015353	Switchgrass Phyllosphere	GIWLRFKVEKESKEFKMGLDGQKNFVQMHKDRNVNKEIGGQVMQLDPVIA*
Ga0182179_12939551	3300015353	Switchgrass Phyllosphere	MEKEAEEFKMGLNAQKSFAQVHEDRNMNKGIGGQVMKLDPVVAQESREER*
Ga0182179_12997831	3300015353	Switchgrass Phyllosphere	MEKKSEEFKMGLDAQKSFAQMYEDGNMNKRVGGQVVKLDPVVM*
Ga0182179_13153451	3300015353	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDRNMNKGIWGQMVELDPIV
Ga0182179_13222601	3300015353	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDGNVNKRIGGQMMELDPVVAQE
Ga0182167_11217081	3300015354	Switchgrass Phyllosphere	VEKKSEEFKMGLDAQKSFPQMHENRNVNKGIEGQMVKLDPVVAQEPKEEK*
Ga0182167_11284781	3300015354	Switchgrass Phyllosphere	MGLDAQKSFAQVHEDRKVNKEIGGQMMKLDPVVAQEPREEK*
Ga0182167_11901691	3300015354	Switchgrass Phyllosphere	VEKESKEFEMGFDAQKSFAQMHEDGNMNKRIGGQVMK
Ga0182167_11977902	3300015354	Switchgrass Phyllosphere	VEKKSKKLKMGLDAQKSFAQMYEDGNVNKGIGGQVMKLDSVIT*
Ga0182167_12320811	3300015354	Switchgrass Phyllosphere	MEKKSEELKMGLDAQKSFAQMHEDRNMNKGIGGQMMQLDPVVAQE
Ga0182167_12398931	3300015354	Switchgrass Phyllosphere	MEQEAKELKMGLDAQKSFAQMYEGRNMNKKIWGQVMKLDPVITQEPRKKK*
Ga0182167_12579041	3300015354	Switchgrass Phyllosphere	VEKESNEFKMGLDAQKSFAEMHEDGNMNKGIRGQVVKLYPVITQESREKS*
Ga0182167_13241941	3300015354	Switchgrass Phyllosphere	ELKMGLGAQKSFTQMYEDRNMNKRIWGQVVKLDPIIIQEPREKKAN*
Ga0182197_11155021	3300017408	Switchgrass Phyllosphere	MEKESKKLKMGLDAQESFAQMHEDRNMNKEIGGQMMQLDPVVA
Ga0182199_10695981	3300017412	Switchgrass Phyllosphere	SEEFKMGLDAQKSFAQMHEDINVNKGIGGQVMKLDPVVAQESREER
Ga0182199_10947771	3300017412	Switchgrass Phyllosphere	VEKEPKELKMGLDAQKSFVQMHEDGNMNKGIEGQVMKLDPVVAQEPREEK
Ga0182195_10520392	3300017414	Switchgrass Phyllosphere	METESEELKMGLDAQKSFAPMHEDRNMNKRIGGQMMQRIL
Ga0182201_10370111	3300017422	Switchgrass Phyllosphere	KMGLDAQKSFAQMHEDRNMNKEIEGQMVELDPVVAQETREEK
Ga0182201_10758701	3300017422	Switchgrass Phyllosphere	MEKEPKEFEMGLDAQKCFAQMYEDXNVNKGIGGQVMELDPIIKQEPRKEKQTRK
Ga0182201_11128632	3300017422	Switchgrass Phyllosphere	MEKESEKLKMGLDAQESFAQMNEDRNMNKEIGGQMMQL
Ga0182196_11169771	3300017432	Switchgrass Phyllosphere	MEKMLEEFKMGLDAQKSLAQIHEDGNMNKGIGGQVVKLNPVVM
Ga0182194_11036431	3300017435	Switchgrass Phyllosphere	MAKKSEEFEMGLDAQKSFAQMYEDRNMNKGIGGQMVQLDHVVAQEPRKERRARKP
Ga0182200_10750912	3300017439	Switchgrass Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDGNMNKRIGGQVMKLDLVITQESREEKRTRKPQS
Ga0182200_11320811	3300017439	Switchgrass Phyllosphere	MEKKSEEFKMGLDAQKRFAQMHEDRNMNEGIGGQMM
Ga0182214_10611801	3300017440	Switchgrass Phyllosphere	MEKKSEEFEMGLDAQKGFAQMHEDRNMNEGIGGQMMKLDPVVAQDSRK
Ga0182215_11385721	3300017447	Switchgrass Phyllosphere	LRFQVEKESEEFKMGLDAQKSFAQMNKDRNVNKIIGGQVMKLDPVVALESKKERR
Ga0182212_11570712	3300017691	Switchgrass Phyllosphere	MGLDAQKSFAQMYEDGNMNKGIGGQVMKLDPGITQESREEK
Ga0182216_10776801	3300017693	Switchgrass Phyllosphere	EEFKMGLDAQKSFAQMHEDRNVNKGIGGQVMKLDPVVAQESREER
Ga0182211_11783091	3300017694	Switchgrass Phyllosphere	VEKEPKEFEMGLDAQKSFAQMYEDGNVNKGIGGQVMKLDPVIAQEPRKEK
Ga0182119_1065021	3300020031	Switchgrass Phyllosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVVQE
Ga0207641_110830771	3300026088	Switchgrass Rhizosphere	VEKESEEFKMGLDAQKSFAQMHEDGNVNKVIGGQVMKLDPVVAQEPREER
Ga0268322_10040783	3300028049	Phyllosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGVQM
Ga0268322_10393151	3300028049	Phyllosphere	MEKESKELKIGLDTQKSFAQMHEDRNMNKRIGGQVVKL
Ga0268328_10406391	3300028050	Phyllosphere	MEKKSKELKMGLDAQKSFAQIHEDGNMNKGIGGQVMKLDPVVT
Ga0268346_10146732	3300028053	Phyllosphere	VEKELKEFKMGLDAQKSFVQMREDRNMNKGIRGQVMKLDLVVA
Ga0268338_10111121	3300028055	Phyllosphere	VEKESKEFKMGLDAQKSFAQMHEDGNVNKGIGGQVMKLDPIVAQ
Ga0268314_10167962	3300028061	Phyllosphere	MEKESEKLKIGLDALESFAQMHEDRNMNKGIGGQMMQLDPVVA
Ga0268340_10384662	3300028064	Phyllosphere	MGLDAQKSFAYMHEDGNMDKGIWGQMMQLDPVVVQESRKE
Ga0268308_10115322	3300028151	Phyllosphere	MEKESKEFKMGLDAQKSFSQMHEDGNMNKGIGGQVMKLDPVITQESREEK
Ga0268336_10108591	3300028152	Phyllosphere	MGLDAQKSFAYMHEDGNMDKGIWGQMMQLDPVVVQESR
Ga0268336_10171762	3300028152	Phyllosphere	MEKEPEEFKMGLDAQKSFAQMHEDRNMNKGIGGQMMQLDPVVA
Ga0268341_10135452	3300028154	Phyllosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGVQMMQLDPIVA
Ga0268312_10221991	3300028248	Phyllosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGLLSP
Ga0268331_10236831	3300028474	Phyllosphere	MGLDAQKSFAEMYEDXNVNKGIWSQVMELDPVITQEPKKE
Ga0268329_10059252	3300028476	Phyllosphere	MEKESEKLKMGLDAQESFTQMHKDRNMNKGIGGQMMQ
Ga0214495_11468162	3300032490	Switchgrass Phyllosphere	MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLD
Ga0214490_11125321	3300032502	Switchgrass Phyllosphere	VEKESEEFEMGLNAQKSFAQMHEDGIVNQGIGGQVMKLDPVVTQEPRKEN
Ga0214499_12222951	3300032697	Switchgrass Phyllosphere	MEKVAEEFKMWLDAQKSFAYMHEDENINKGIWGQMMQL