NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F021437

Metagenome Family F021437

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F021437
Family Type Metagenome
Number of Sequences 219
Average Sequence Length 50 residues
Representative Sequence RRELVTSEPGLQGILDFLSESIPEAKAAKPAQFFDDRFVRQVNSGK
Number of Associated Samples 187
Number of Associated Scaffolds 219

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.65 %
% of genes near scaffold ends (potentially truncated) 94.06 %
% of genes from short scaffolds (< 2000 bps) 87.67 %
Associated GOLD sequencing projects 179
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.804 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(9.132 % of family members)
Environment Ontology (ENVO) Unclassified
(30.594 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.790 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.54%    β-sheet: 0.00%    Coil/Unstructured: 59.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 219 Family Scaffolds
PF04909Amidohydro_2 33.79
PF01799Fer2_2 7.76
PF09084NMT1 5.94
PF13883Pyrid_oxidase_2 3.65
PF00111Fer2 2.74
PF16868NMT1_3 2.28
PF02738MoCoBD_1 2.28
PF00903Glyoxalase 1.37
PF13620CarboxypepD_reg 1.37
PF12681Glyoxalase_2 1.37
PF00011HSP20 0.91
PF01797Y1_Tnp 0.91
PF01243Putative_PNPOx 0.91
PF03466LysR_substrate 0.46
PF02899Phage_int_SAM_1 0.46
PF03928HbpS-like 0.46
PF00171Aldedh 0.46
PF13531SBP_bac_11 0.46
PF01613Flavin_Reduct 0.46
PF01053Cys_Met_Meta_PP 0.46
PF00701DHDPS 0.46
PF01408GFO_IDH_MocA 0.46
PF03235DUF262 0.46
PF01471PG_binding_1 0.46
PF00890FAD_binding_2 0.46
PF04480DUF559 0.46
PF04542Sigma70_r2 0.46
PF05598DUF772 0.46
PF05977MFS_3 0.46
PF04055Radical_SAM 0.46
PF03795YCII 0.46
PF04392ABC_sub_bind 0.46
PF02604PhdYeFM_antitox 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 219 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.94
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.94
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.91
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.91
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 0.91
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.46
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.46
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.46
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.46
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.46
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.46
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.46
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.46
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.46
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.46
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.46
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.46
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.46
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.46
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.46
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.46
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.46
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.46
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.46
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.46
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.46
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.46
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.46
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.46
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.46
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.46
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.80 %
UnclassifiedrootN/A3.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_102659622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-8864Open in IMG/M
3300000574|JGI1357J11328_10164632All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10053288All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10134280All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300000890|JGI11643J12802_10598927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300000953|JGI11615J12901_10393959All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300001139|JGI10220J13317_11883588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300001431|F14TB_106112781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium850Open in IMG/M
3300002124|C687J26631_10028487All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300003996|Ga0055467_10084755All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300003998|Ga0055472_10131682All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300004114|Ga0062593_101122721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales818Open in IMG/M
3300004267|Ga0066396_10003963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1522Open in IMG/M
3300004633|Ga0066395_10618937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300004778|Ga0062383_10749114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300004808|Ga0062381_10049321All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300005168|Ga0066809_10087114All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005169|Ga0066810_10122852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300005179|Ga0066684_10890145All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium582Open in IMG/M
3300005181|Ga0066678_10626222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300005332|Ga0066388_100681168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1638Open in IMG/M
3300005347|Ga0070668_100186235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1698Open in IMG/M
3300005355|Ga0070671_100236813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1549Open in IMG/M
3300005366|Ga0070659_101001636All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium733Open in IMG/M
3300005435|Ga0070714_101815182Not Available595Open in IMG/M
3300005444|Ga0070694_101171221All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005446|Ga0066686_10239525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1223Open in IMG/M
3300005446|Ga0066686_10806337All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300005451|Ga0066681_10321565All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300005518|Ga0070699_100531427All Organisms → cellular organisms → Bacteria → Proteobacteria1070Open in IMG/M
3300005545|Ga0070695_101801792All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium513Open in IMG/M
3300005552|Ga0066701_10715016All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005561|Ga0066699_10955122All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300005578|Ga0068854_100861626All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300005586|Ga0066691_10153019All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300005713|Ga0066905_101609300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300005764|Ga0066903_105216859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium687Open in IMG/M
3300005764|Ga0066903_107746739All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005895|Ga0075277_1005983All Organisms → cellular organisms → Bacteria → Proteobacteria1518Open in IMG/M
3300005895|Ga0075277_1061352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300005981|Ga0081538_10024736All Organisms → cellular organisms → Bacteria4267Open in IMG/M
3300006058|Ga0075432_10611342All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006794|Ga0066658_10906047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300006794|Ga0066658_10915999All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300006845|Ga0075421_100135508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3084Open in IMG/M
3300006846|Ga0075430_100672057All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300006847|Ga0075431_100705191All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300006847|Ga0075431_101799184All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300006852|Ga0075433_10223619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1672Open in IMG/M
3300006852|Ga0075433_10979610All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium737Open in IMG/M
3300006853|Ga0075420_101142026All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300006854|Ga0075425_100049142All Organisms → cellular organisms → Bacteria4723Open in IMG/M
3300006871|Ga0075434_100142234All Organisms → cellular organisms → Bacteria2419Open in IMG/M
3300006871|Ga0075434_100187341All Organisms → cellular organisms → Bacteria → Proteobacteria2090Open in IMG/M
3300006954|Ga0079219_11379525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300006969|Ga0075419_10749952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300007076|Ga0075435_100926128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300009012|Ga0066710_102809694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300009053|Ga0105095_10227446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1023Open in IMG/M
3300009094|Ga0111539_10703662All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300009111|Ga0115026_10766389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300009137|Ga0066709_100820217All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300009157|Ga0105092_10957639All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300009162|Ga0075423_10138900All Organisms → cellular organisms → Bacteria2551Open in IMG/M
3300009162|Ga0075423_12569985All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300009167|Ga0113563_13575145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300009174|Ga0105241_10054319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3066Open in IMG/M
3300009174|Ga0105241_10120810All Organisms → cellular organisms → Bacteria → Proteobacteria2110Open in IMG/M
3300009597|Ga0105259_1093559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300009609|Ga0105347_1026632All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2005Open in IMG/M
3300009609|Ga0105347_1212448All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300009610|Ga0105340_1246381All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300009818|Ga0105072_1002195All Organisms → cellular organisms → Bacteria3048Open in IMG/M
3300009837|Ga0105058_1023780All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300010043|Ga0126380_11488443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium599Open in IMG/M
3300010047|Ga0126382_10020160All Organisms → cellular organisms → Bacteria3452Open in IMG/M
3300010048|Ga0126373_11270236Not Available802Open in IMG/M
3300010329|Ga0134111_10024064All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300010360|Ga0126372_10009780All Organisms → cellular organisms → Bacteria5037Open in IMG/M
3300010360|Ga0126372_10038438All Organisms → cellular organisms → Bacteria3104Open in IMG/M
3300010360|Ga0126372_10934498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium873Open in IMG/M
3300010371|Ga0134125_12024929All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300010398|Ga0126383_10497254All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300010400|Ga0134122_11741042All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium653Open in IMG/M
3300010400|Ga0134122_11927834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300010401|Ga0134121_12362366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300010403|Ga0134123_11494281All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium719Open in IMG/M
3300011398|Ga0137348_1052995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300011423|Ga0137436_1100362All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium763Open in IMG/M
3300011429|Ga0137455_1234989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300011434|Ga0137464_1168086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300012038|Ga0137431_1136433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium698Open in IMG/M
3300012041|Ga0137430_1040650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1245Open in IMG/M
3300012041|Ga0137430_1052290All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300012143|Ga0137354_1075326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300012168|Ga0137357_1092793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300012202|Ga0137363_10950223All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300012208|Ga0137376_11203314All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300012208|Ga0137376_11243996All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300012231|Ga0137465_1260306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300012349|Ga0137387_10735704All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300012354|Ga0137366_10228667All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1383Open in IMG/M
3300012360|Ga0137375_10899566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas kerstersii703Open in IMG/M
3300012469|Ga0150984_107443402All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300012582|Ga0137358_10717642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300012906|Ga0157295_10328082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300012911|Ga0157301_10464661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300012918|Ga0137396_10190875All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300012922|Ga0137394_10712487All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300012930|Ga0137407_10712775All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria945Open in IMG/M
3300012951|Ga0164300_10122646All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300012960|Ga0164301_10489164All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300012972|Ga0134077_10054451All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1482Open in IMG/M
3300012985|Ga0164308_11221725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium679Open in IMG/M
3300013306|Ga0163162_10993960All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300013308|Ga0157375_12515744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300013308|Ga0157375_13037834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300014270|Ga0075325_1030510All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300014270|Ga0075325_1069074All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300014295|Ga0075305_1082823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300014298|Ga0075341_1132142All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300014307|Ga0075304_1131124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales591Open in IMG/M
3300014324|Ga0075352_1210256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300014745|Ga0157377_11157120All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium596Open in IMG/M
3300014882|Ga0180069_1009191All Organisms → cellular organisms → Bacteria1995Open in IMG/M
3300014884|Ga0180104_1182077All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300015200|Ga0173480_10684301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300015258|Ga0180093_1068961All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300015371|Ga0132258_11016850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2095Open in IMG/M
3300015372|Ga0132256_101199555All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium872Open in IMG/M
3300015372|Ga0132256_102514456All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium616Open in IMG/M
3300015373|Ga0132257_101920218All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium762Open in IMG/M
3300015373|Ga0132257_102223899All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium710Open in IMG/M
3300015374|Ga0132255_100894469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1327Open in IMG/M
3300015374|Ga0132255_102455174All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium796Open in IMG/M
3300015374|Ga0132255_103789576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300017966|Ga0187776_10546894All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300018000|Ga0184604_10336651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300018053|Ga0184626_10199649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium847Open in IMG/M
3300018068|Ga0184636_1286004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300018074|Ga0184640_10064189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1543Open in IMG/M
3300018075|Ga0184632_10099204All Organisms → cellular organisms → Bacteria → Proteobacteria1276Open in IMG/M
3300018075|Ga0184632_10283011All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300018078|Ga0184612_10025019All Organisms → cellular organisms → Bacteria3074Open in IMG/M
3300018079|Ga0184627_10279125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium877Open in IMG/M
3300018082|Ga0184639_10043368All Organisms → cellular organisms → Bacteria2314Open in IMG/M
3300018082|Ga0184639_10153709All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300018422|Ga0190265_10446666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1399Open in IMG/M
3300018429|Ga0190272_11697112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300018469|Ga0190270_10389463All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300018476|Ga0190274_11542783All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium756Open in IMG/M
3300018481|Ga0190271_12209080All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium656Open in IMG/M
3300018481|Ga0190271_12768524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300018481|Ga0190271_13800068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300019789|Ga0137408_1485888All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4852Open in IMG/M
3300020003|Ga0193739_1056782All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300020004|Ga0193755_1175115All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium633Open in IMG/M
3300020010|Ga0193749_1015141All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300020200|Ga0194121_10090386All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300021073|Ga0210378_10216819All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300021080|Ga0210382_10140973All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300022208|Ga0224495_10225601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300025310|Ga0209172_10460024Not Available593Open in IMG/M
3300025791|Ga0210115_1034683All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300025916|Ga0207663_11065240All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300025926|Ga0207659_11140577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300025930|Ga0207701_10005740All Organisms → cellular organisms → Bacteria12431Open in IMG/M
3300025930|Ga0207701_10055959All Organisms → cellular organisms → Bacteria3612Open in IMG/M
3300025932|Ga0207690_11578015All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300025933|Ga0207706_11055776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300025961|Ga0207712_11373310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300026005|Ga0208285_1016341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300026035|Ga0207703_12078128All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300026121|Ga0207683_11080446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300026296|Ga0209235_1229115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300026313|Ga0209761_1191612All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria912Open in IMG/M
3300026320|Ga0209131_1377561All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium528Open in IMG/M
3300027056|Ga0209879_1015994All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300027364|Ga0209967_1047054All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300027513|Ga0208685_1108658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300027654|Ga0209799_1154211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300027695|Ga0209966_1046602All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300027775|Ga0209177_10062260All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300027818|Ga0209706_10302919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300027831|Ga0209797_10014061All Organisms → cellular organisms → Bacteria3711Open in IMG/M
3300027843|Ga0209798_10151655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1162Open in IMG/M
3300027843|Ga0209798_10214688All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300027873|Ga0209814_10009529All Organisms → cellular organisms → Bacteria3803Open in IMG/M
3300027873|Ga0209814_10295174All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300027907|Ga0207428_10023543All Organisms → cellular organisms → Bacteria5178Open in IMG/M
3300027907|Ga0207428_10561942All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300028379|Ga0268266_10363502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1362Open in IMG/M
3300030006|Ga0299907_10336005Not Available1226Open in IMG/M
3300030606|Ga0299906_10351783Not Available1145Open in IMG/M
3300030619|Ga0268386_10196638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1513Open in IMG/M
3300030619|Ga0268386_10503189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300031820|Ga0307473_10605493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300031824|Ga0307413_12113866All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300031847|Ga0310907_10877675All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031890|Ga0306925_11554960All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium645Open in IMG/M
3300031903|Ga0307407_10809190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300031908|Ga0310900_10683869All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031995|Ga0307409_100838666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium929Open in IMG/M
3300032003|Ga0310897_10599545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300032013|Ga0310906_10447043All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300032059|Ga0318533_10789382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300032122|Ga0310895_10276790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium785Open in IMG/M
3300032163|Ga0315281_10133620All Organisms → cellular organisms → Bacteria2834Open in IMG/M
3300032174|Ga0307470_11820180Not Available516Open in IMG/M
3300032179|Ga0310889_10291657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium785Open in IMG/M
3300032180|Ga0307471_100175928All Organisms → cellular organisms → Bacteria → Proteobacteria2103Open in IMG/M
3300032180|Ga0307471_101848134All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300032205|Ga0307472_101115700All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300033004|Ga0335084_10184731All Organisms → cellular organisms → Bacteria2166Open in IMG/M
3300033289|Ga0310914_10315408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1411Open in IMG/M
3300033813|Ga0364928_0199435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300034148|Ga0364927_0016937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1676Open in IMG/M
3300034177|Ga0364932_0191050All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300034417|Ga0364941_063214Not Available848Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.13%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.13%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.02%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.74%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.74%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.28%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.28%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.83%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.37%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.37%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.37%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.37%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.37%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.91%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.46%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.46%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.46%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.46%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.46%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.46%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.46%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.46%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.46%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.46%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.46%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300022208Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026005Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10265962213300000559SoilKAGFRRELTISEPGVQGILNFLSDTVPEAKNAVPSQFFDDRFVRQLNSGR*
JGI1357J11328_1016463223300000574GroundwaterGFRRELVTSEPGLQGILDFLGDSIPEAKTAKPSQFFDDRIVRQMNAGK*
AF_2010_repII_A001DRAFT_1005328833300000793Forest SoilELVTSNPGIQGMLDFLSESIPEAKKATPAQFFDDRFVRQVNNAR*
AF_2010_repII_A001DRAFT_1013428023300000793Forest SoilGMQGILDFLSETIPEAKKATPAQFFDDRFVHQLNSAR*
JGI11643J12802_1059892713300000890SoilSREMVTSEPGLQGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSAK*
JGI11615J12901_1039395923300000953SoilSGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNARDR*
JGI10220J13317_1188358823300001139SoilQGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSAK*
F14TB_10611278123300001431SoilMISEPGMRGMLNFLSESVPEAKKAEPAQFFDDRFVRQLNSGK*
C687J26631_1002848713300002124SoilGVQGILDFLSDTVPEAKKATPAQFFDDRFVRQLNSAR*
Ga0055467_1008475513300003996Natural And Restored WetlandsKKAGFRREMVTSEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK*
Ga0055472_1013168213300003998Natural And Restored WetlandsKAGFRREMVTSEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK*
Ga0062593_10112272123300004114SoilGFKRELMISEPGMQGILDFLSETMPETKRATPAQFFDDRFVRQLNSAK*
Ga0066396_1000396323300004267Tropical Forest SoilDRTYEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEVKTAKPSQFFDDRFVRAVNAAK*
Ga0066395_1061893723300004633Tropical Forest SoilYEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEAKTAKPSQFFDDRFVRAVNAAK*
Ga0062383_1074911413300004778Wetland SedimentIAKYNKETDPDALDRSYEFYRRAGFRRELLISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKLLDASK*
Ga0062381_1004932113300004808Wetland SedimentESDPDVLDRSYEFFKKAGFRRELVTSEAGLQGVLDFLSESISEAKTAKPAQFFDDRILRQVNAAK*
Ga0066809_1008711423300005168SoilFRRELIISEPGVQGILNFLSETIPEAKNAVPSQFFDDRFVRQLNSGR*
Ga0066810_1012285213300005169SoilISEPGIQGILDFLSETMPETKKAIPAQFFDDRFVRQLNSGK*
Ga0066684_1089014513300005179SoilSEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSVK*
Ga0066678_1062622223300005181SoilSYEFFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK*
Ga0066388_10068116823300005332Tropical Forest SoilPFFFSPHDFLDRTYEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEAKTAKPSQFFDDRFVRAVNAAK*
Ga0070668_10018623533300005347Switchgrass RhizosphereVLDRSYEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK
Ga0070671_10023681313300005355Switchgrass RhizosphereEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRRVNSGK*
Ga0070659_10100163613300005366Corn RhizosphereDLMISASGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNVRDR*
Ga0070714_10181518223300005435Agricultural SoilSDPGIQGMLDFLSESIPEAKKATPSQFFDDRFVRQVNSAR*
Ga0070694_10117122123300005444Corn, Switchgrass And Miscanthus RhizosphereDQEVLDRSYEFYKKAGFRREMVTSEPGLQGMLDFLAESIPEAKSVKPSQFFDDRFVRQVNAGK*
Ga0066686_1023952513300005446SoilYTKESDQDVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK*
Ga0066686_1080633713300005446SoilDVLDRSYEFFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK*
Ga0066681_1032156523300005451SoilDLMISEPGVQGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP*
Ga0070699_10053142733300005518Corn, Switchgrass And Miscanthus RhizosphereISESGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSVK*
Ga0070695_10180179223300005545Corn, Switchgrass And Miscanthus RhizosphereYKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0066701_1071501613300005552SoilISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDSGR*
Ga0066699_1095512223300005561SoilKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPSQFFDDRFVRQVNSGK*
Ga0068854_10086162623300005578Corn RhizosphereVLDRSYEFYKKAGFRRELLTSEPGVQGILDFLSESIPEAKTAKPAQFFDDRFVRRVNSGK
Ga0066691_1015301923300005586SoilTRENDPEVLDKTYEFYAKAGFRRDLMISEPGVRGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP*
Ga0066905_10160930023300005713Tropical Forest SoilRRELMISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGGR*
Ga0066903_10521685913300005764Tropical Forest SoilLQGILDFLSESIPEAKTAKPAQFFDDRFVRQLNSGK*
Ga0066903_10774673913300005764Tropical Forest SoilKAGFRRELMISEPGMRGILDFLSETLPEAKKATPSQFFDDRFVRQINSAR*
Ga0075277_100598313300005895Rice Paddy SoilGKYTKENDQEVLDRSYEFYKRAGFRRELVTSEPGIQGILDFLSDSIPEAKHAKPSQFFDDRFVRQVNGGK*
Ga0075277_106135223300005895Rice Paddy SoilSEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK*
Ga0081538_1002473643300005981Tabebuia Heterophylla RhizosphereISEPGVQGILDFLSETTPEAKKAVPAQFFDDRFVRQLNSGR*
Ga0075432_1061134223300006058Populus RhizosphereSGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNVRDR*
Ga0066658_1090604713300006794SoilYEFYGKAGFRRDLMISEPGVQGILNFLQETIPEAKNAKPSRFYDDRLVRQMDSGR*
Ga0066658_1091599913300006794SoilYEFYGKAGFRRDLMISEPGVQGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP*
Ga0075421_10013550843300006845Populus RhizosphereDRSYEFYKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSAK*
Ga0075430_10067205713300006846Populus RhizospherePGVQGILDFLSETIPEANKAKPSQFFDDRLVKQVDGGR*
Ga0075431_10070519123300006847Populus RhizosphereGVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK*
Ga0075431_10179918423300006847Populus RhizosphereLQGMLDFLTETIPEAKSAKPSQFFDDRFVRQVNAGK*
Ga0075433_1022361943300006852Populus RhizosphereLDKTYEFYRKAGFRRELVTSDPGIQGMLDFLSESIPEAKKATPSQFFDDRFVRQVNSGK*
Ga0075433_1097961013300006852Populus RhizosphereTSGIQGILDFLSETFPEAKKATPAQFFDDRLLRQVNARDH*
Ga0075420_10114202613300006853Populus RhizosphereISEPGVQGILNFLSETIPEAKNAVPSQFFDDRFVRQLNSGR*
Ga0075425_10004914213300006854Populus RhizosphereRRELVTSEPGLQGILDFLSESIPEAKAAKPAQFFDDRFVRQVNSGK*
Ga0075434_10014223453300006871Populus RhizosphereSYEFYKRAGFRRELLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0075434_10018734113300006871Populus RhizosphereTYEFYRKAGFRRELIISEPGVQGILNFLSDTVPEAKNAVPAQFFDDRFVRQLNSGR*
Ga0079219_1137952523300006954Agricultural SoilAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSSR*
Ga0075419_1074995213300006969Populus RhizosphereKSYEFYRKAGFRRELVTSEPGVQGILDFLTESIPQAKNAKPSQFFDDRFVRQVNSAK*
Ga0075435_10092612823300007076Populus RhizosphereSYEFYKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0066710_10280969423300009012Grasslands SoilVLDRSYEFFKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPSQFFDDRFVRQVNTGK
Ga0105095_1022744623300009053Freshwater SedimentYRRAGFRRELMISEPGVQGILDFLSETVPETKKAPPAQFFDDRFVRQLNSGK*
Ga0111539_1070366233300009094Populus RhizosphereFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK*
Ga0115026_1076638923300009111WetlandAGFRRELVTSEPGLQGILDFLSESIPEAKSAKPTQFFDDRILRQVNAGK*
Ga0066709_10082021713300009137Grasslands SoilGFRRDLMISEPGVQGILNCLSDTVPEAKNAVPAQFFDDRFVRQLNSGR*
Ga0105092_1095763913300009157Freshwater SedimentTDHEILERTYEFYKRAGFRREMVTSEPGLQGMLDFLSETIPEAKNAKPAQFFDDRFVRQLNSGK*
Ga0075423_1013890043300009162Populus RhizosphereGIQGILDFLSETVPEAKKATPAQFFDDRLLRQLNTVDR*
Ga0075423_1256998513300009162Populus RhizosphereRDLMISTSGIQGILHFLSETLPEAKKATPAQFFDDRLLRQVNARDH*
Ga0113563_1357514513300009167Freshwater WetlandsPGIQGILDFLSETMPETKKATPAQFFDDRFVRQLNSAK*
Ga0105241_1005431913300009174Corn RhizosphereLLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVLRVNSGK*
Ga0105241_1012081013300009174Corn RhizosphereASGIQGILDFLSETVPEAKRAAPAQFFDDRLLRQLNARDR*
Ga0105259_109355913300009597SoilAGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPTQFFDDRILRQVNAGK*
Ga0105347_102663223300009609SoilLKVIPKYTRDTDADIIERTYEFYRKAGFKRELMISEPGMQGVLDFMAETMPETKKATPAQFFDDRFVRQLNSGR*
Ga0105347_121244813300009609SoilTSEPGLQGMLDFLAESIPEAKSAKPSQFFDDRFVRQVNAGK*
Ga0105340_124638123300009610SoilDPDALDRSYEFYRRAGFRRELTISEPGVQGMLDFLSETIPEAKKAKPAHFFDDRLVKQLDGGK*
Ga0105072_100219513300009818Groundwater SandLMISEPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR*
Ga0105058_102378023300009837Groundwater SandFRRELMISEPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR*
Ga0126380_1148844323300010043Tropical Forest SoilVLERSYEFYKKAGFRRELVTSEPGLQGIMDFLSETIPEAKTAKPSQFFDDRFVRQVNSGK
Ga0126382_1002016013300010047Tropical Forest SoilELMISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVRQMDGGR*
Ga0126373_1127023613300010048Tropical Forest SoilAEVLDKTYEFYRKAGFRRELVTSDPGIQGMLDFLSESIPEARKATPSQFFDDRFVRQVNNAR*
Ga0134111_1002406413300010329Grasslands SoilQGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP*
Ga0126372_1000978053300010360Tropical Forest SoilVTSEQGLQGVLDFLSESIPEVKTAKPSQFFDDRFVRAVNAAK*
Ga0126372_1003843813300010360Tropical Forest SoilPGMQGILDFLSETVPEAKKAAPAQFFDDRFVRQLNSGR*
Ga0126372_1093449823300010360Tropical Forest SoilMISEPGIQGILDFLSETIPEAKKAAPAQFFDDRFVRQLNSAR*
Ga0134125_1202492913300010371Terrestrial SoilKKAGFRRELLTSDPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0126383_1049725413300010398Tropical Forest SoilTYEFYRKAGFRRELMISEPGMRGILDFLSETLPEAKKATPAQFFDDRFVRQINSAR*
Ga0134122_1174104223300010400Terrestrial SoilGIQGILDYLTETIPEAKKATPAQFFDDRFVRQLNSAK*
Ga0134122_1192783423300010400Terrestrial SoilVLDRSYEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRRVNSGK
Ga0134121_1236236623300010401Terrestrial SoilLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0134123_1149428113300010403Terrestrial SoilRELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRQLNSAK*
Ga0137348_105299513300011398SoilRELVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK*
Ga0137436_110036223300011423SoilSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK*
Ga0137455_123498923300011429SoilAGFRRELVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK*
Ga0137464_116808623300011434SoilEFFKKAGFRRELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQVNAGK*
Ga0137431_113643313300012038SoilALETNPEVLDRSYEFYKKAGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAGK*
Ga0137430_104065033300012041SoilMISEPGMQGILDFLSETMPETKKATPAQFFDDRFVRQLNSGK*
Ga0137430_105229013300012041SoilPFSMKVIGKYAIETNPEVLDRSYEFYKKAGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAGK*
Ga0137354_107532623300012143SoilLVTSEPGLQGMLDFLAESIPEAKSAKPSQFFDDRFVRQVNAGK*
Ga0137357_109279323300012168SoilRRELMVSEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGGR*
Ga0137363_1095022313300012202Vadose Zone SoilRRDLMISEPGVQGILNFLQETIPEAKNAKPSQFYDDRLVRQIDSGRQP*
Ga0137376_1120331423300012208Vadose Zone SoilFYRKAGFRRDLMISEPGVQGILNFLSDTVPEAKNAVPAQFFDDRFVRQLNSGR*
Ga0137376_1124399623300012208Vadose Zone SoilLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK*
Ga0137465_126030613300012231SoilYNRETDPDALNRSYEFYRRAGFRRELTISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKQLDGGK*
Ga0137387_1073570413300012349Vadose Zone SoilQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR*
Ga0137366_1022866713300012354Vadose Zone SoilLMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR*
Ga0137375_1089956623300012360Vadose Zone SoilRRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRLLNSAK*
Ga0150984_10744340223300012469Avena Fatua RhizosphereVSEPGIQGILDFLSETVPEAKKASPGQFFDDRLLRQLNSGK*
Ga0137358_1071764223300012582Vadose Zone SoilVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNTGK*
Ga0157295_1032808223300012906SoilVDRSYEFYKKAGFRRELITSEPGLQGVLDFLSESIPEAKAAKPTQFFDDRILRQVNAAK*
Ga0157301_1046466113300012911SoilRSYEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK*
Ga0137396_1019087513300012918Vadose Zone SoilVLDRSYEFFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK
Ga0137394_1071248713300012922Vadose Zone SoilRDLMISEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVNDSK*
Ga0137407_1071277533300012930Vadose Zone SoilEPGVQGILNFLSETIPEAKNAVPSQFFDDRFVRQLNSGR*
Ga0164300_1012264633300012951SoilQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0164301_1048916413300012960SoilLDRSYEFYKKAGFRRELLTSDPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0134077_1005445133300012972Grasslands SoilFRRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR*
Ga0164308_1122172523300012985SoilTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0163162_1099396023300013306Switchgrass RhizosphereYEFYKKAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK*
Ga0157375_1251574423300013308Miscanthus RhizosphereTSESGVQGILDFLSDSIPEAKSAKPSQFFDDRFVRQVNSSK*
Ga0157375_1303783413300013308Miscanthus RhizosphereKAGFRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK*
Ga0075325_103051013300014270Natural And Restored WetlandsGFRRELVTSEPGIQGILDFLSDSIPEAKHAKPGQFFDERFVRQVNAAK*
Ga0075325_106907413300014270Natural And Restored WetlandsMISEPGMRGILNFLSETTVPEAKKAEPSQFFDDRFVRQLNSGK*
Ga0075305_108282313300014295Natural And Restored WetlandsSETGVQGILDFLGETIPEARKAKLGQFFDDRLVKQVDAGR*
Ga0075341_113214213300014298Natural And Restored WetlandsPGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAGK*
Ga0075304_113112423300014307Natural And Restored WetlandsRRELMISEPGVQGILDFLSETVPETKKAVPGQFFDDRFVRQLNSAK*
Ga0075352_121025613300014324Natural And Restored WetlandsIGKYTHETDQDVLERSYEFYKKAGFRRELVTSEPGLRGILDFLFESIPEAKAAKPTQFFDDRILRQVNAAK*
Ga0157377_1115712023300014745Miscanthus RhizosphereQGILDFLSETIPEAKRATPAQFFDDRLLRQLNARER*
Ga0180069_100919133300014882SoilQGILDFLSETIPEAKKAKPSQFFDDRLVKQMDGAK*
Ga0180104_118207723300014884SoilFRRELVISESGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGAR*
Ga0173480_1068430113300015200SoilKAGFRRELLTSDPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0180093_106896113300015258SoilYEFYRKAGFRRELLISEPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR*
Ga0132258_1101685013300015371Arabidopsis RhizosphereYEFYKRAGFRRELLTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK*
Ga0132256_10119955513300015372Arabidopsis RhizosphereKAGFRRELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRQLNSAK*
Ga0132256_10251445623300015372Arabidopsis RhizosphereELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFMRQLNSAK*
Ga0132257_10192021813300015373Arabidopsis RhizosphereLMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRHLNSAK*
Ga0132257_10222389923300015373Arabidopsis RhizosphereGFRRELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFMRQLNSAK*
Ga0132255_10089446923300015374Arabidopsis RhizosphereAGFRRELLTSDPGLQGILDFLSESIPEAKAAKPAQFFDDRFVRQVNSGK*
Ga0132255_10245517413300015374Arabidopsis RhizosphereQGILDFLTETIPEAKKATPAQFFDDRFMRQLNSAK*
Ga0132255_10378957623300015374Arabidopsis RhizosphereVLDRSYEFYKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQYFDDRFVRHVNSGK
Ga0187776_1054689423300017966Tropical PeatlandVQGILDFLSETTPEAKKAAPAQFFDDRFVRQLNSGR
Ga0184604_1033665113300018000Groundwater SedimentKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK
Ga0184626_1019964923300018053Groundwater SedimentFAMKVIGKYTKENDQEILDRTYEFYKKAGFRRDMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK
Ga0184636_128600423300018068Groundwater SedimentELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQINATK
Ga0184640_1006418923300018074Groundwater SedimentMKVIGKYAKETDQEVLDRSYEFYKEAGFRRELVASELGLQGILDLLSESMPEAKSAKPAQFFDDLIVRQVHATK
Ga0184632_1009920413300018075Groundwater SedimentRTYEFYRKAGFRRELTISEPGVQGILNFLSDTVPEAKNAVPSQFFDDRFVRQLNSGR
Ga0184632_1028301123300018075Groundwater SedimentQGILDFLSETIPEAKKAKPSQFFDERLVKQVNDSK
Ga0184612_1002501933300018078Groundwater SedimentYEFYKKAGFRREMVTSEPGLQGMLDFLTETIPEAKSAKPSQFFDDRFVRQINAGK
Ga0184627_1027912523300018079Groundwater SedimentKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK
Ga0184639_1004336813300018082Groundwater SedimentPGLQGMLDFLTETIPEAKSAKPSQFFDDRFVRQVNAGK
Ga0184639_1015370913300018082Groundwater SedimentFRREMVTSEPGLQGMLDFLSETIPEAKSAKPAQFFDDRFVRQVNSGK
Ga0190265_1044666613300018422SoilAYKEPGVQDILDFLSETVPEAKKAQAAQFFDNRFVRQLNGAK
Ga0190272_1169711223300018429SoilFFKKAGFRRELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQVNATK
Ga0190270_1038946313300018469SoilKAGFRRELVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK
Ga0190274_1154278323300018476SoilRELMISEPGIQGILDFLTETTPEAKKATPAQFFDDRFVRQLNSGK
Ga0190271_1220908013300018481SoilLVTSDAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK
Ga0190271_1276852423300018481SoilEVLDRSYEFYKKAGFRRELVTSEPGLQGMLDFLAESIPEAKSAKPSQFFDDRFVRQVNAG
Ga0190271_1380006813300018481SoilETDPEVLARSYEFFKKAGFRRELVTSEAGVQGVLDFLSESIPEAKTAKPAQFFDDRILRQVNATK
Ga0137408_148588883300019789Vadose Zone SoilVIGKYTKESDQDVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK
Ga0193739_105678213300020003SoilTKESDQEVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK
Ga0193755_117511513300020004SoilRRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSVK
Ga0193749_101514113300020010SoilFFKKAGFRRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK
Ga0194121_1009038643300020200Freshwater LakeTRESENDIVDRSYEFYKKAGFRRELVTSEPGLQGMLDFLSESMPEAKTAKPAQFFDDRFVRQVNK
Ga0210378_1021681923300021073Groundwater SedimentYRKAGFRRELMISETGVRGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSAK
Ga0210382_1014097313300021080Groundwater SedimentVIGKYTKESDQDVLDRTYEFYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSAK
Ga0224495_1022560123300022208SedimentVTSEAGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNAAK
Ga0209172_1046002423300025310Hot Spring SedimentFRRELMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGK
Ga0210115_103468313300025791Natural And Restored WetlandsTYEFYRKAGFRRELMISEPGMRGILNFLSETTVPEAKKAEPMQFFDDRFVRQLNSGK
Ga0207663_1106524023300025916Corn, Switchgrass And Miscanthus RhizosphereGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK
Ga0207659_1114057723300025926Miscanthus RhizosphereYKKAGFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK
Ga0207701_10005740173300025930Corn, Switchgrass And Miscanthus RhizosphereRRELLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK
Ga0207701_1005595913300025930Corn, Switchgrass And Miscanthus RhizosphereQFRRELVTSEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK
Ga0207690_1157801513300025932Corn RhizosphereDLMISASGIQGILDFLSETVPEAKRATPAQFFDDRLLRQLNVRDR
Ga0207706_1105577623300025933Corn RhizosphereFKKAGFRRELVTSEPGVQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSNK
Ga0207712_1137331033300025961Switchgrass RhizosphereEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK
Ga0208285_101634113300026005Rice Paddy SoilKKAGFRREMVTSEPGLQGMLDFLSATIPEAKNAKPPQFFDDRFVRQLNGGK
Ga0207703_1207812813300026035Switchgrass RhizosphereELVTSEPGLHGMLEFLSESIPEAKTAKPSQFFDDRFVRQVNAGK
Ga0207683_1108044613300026121Miscanthus RhizosphereGLQGILDLLSESIPEAKTAKTAQFFDDRFVRQVNSGK
Ga0209235_122911513300026296Grasslands SoilRNPGLQGMLDFLSETIPEAKTAKPAQFFDDRFLRQVNSGK
Ga0209761_119161213300026313Grasslands SoilMISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGR
Ga0209131_137756123300026320Grasslands SoilSEPGVQGILDFLSETVPEAKKATPAQFFDDRLVRQLNSGK
Ga0209879_101599413300027056Groundwater SandEPGVQGILDFLSETIPEAKKAVPAQFFDDRFVRQLNSGR
Ga0209967_104705413300027364Arabidopsis Thaliana RhizosphereGLQGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSGK
Ga0208685_110865823300027513SoilKRELMISEPGIQGILDFLSETMPETKKATPAQFFDDRFVRQLNSAK
Ga0209799_115421123300027654Tropical Forest SoilFFSPHDFLDRTYEFYKKAGFRRELVTSEQGLQGVLDFLSESIPEAKTAKPSQFFDDRFVRAVNAAK
Ga0209966_104660223300027695Arabidopsis Thaliana RhizosphereYKKAGFRREMVTSEPGLQGMLDFLSETIPEAKNAKPSQFFDDRFVRQVNSGK
Ga0209177_1006226023300027775Agricultural SoilEPGLQGILDFLSESIPEAKTAKPAQFFDDRFVRQVNSGK
Ga0209706_1030291923300027818Freshwater SedimentDPNVLDRTYEFYKKAGFRRELVTSEPGLQGVLDFLSESIPEAKSAKPAQFFDDRILRQVNATK
Ga0209797_1001406153300027831Wetland SedimentDRSYEFYRRAGFRRELLISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKLLDASK
Ga0209798_1015165513300027843Wetland SedimentAGFKRELTISETGMQGILDFMAETMPEAKKATPAQFFDDRFVRQLNRAN
Ga0209798_1021468813300027843Wetland SedimentKVIAKYNKETDPDALDRSYEFYRRAGFRRELLISEPGVQGMLDFLSETIPEAKKAKPAQFFDDRLVKLLDASK
Ga0209814_1000952953300027873Populus RhizospherePGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVNDSK
Ga0209814_1029517423300027873Populus RhizosphereLVTSEPGVQGILDFLSESIPEAKKALPSQFFDDRFVRQVNVGK
Ga0207428_1002354313300027907Populus RhizosphereAGFRRELVTSEPGLQGILDFLSESIPEAKSAKPAQFFDDRFVRQLNSGK
Ga0207428_1056194213300027907Populus RhizosphereELVVSEPGVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK
Ga0268266_1036350233300028379Switchgrass RhizosphereLLTSEPGLQGILDFLSESIPEAKTARPAQFFDDRFVRRVNSGK
Ga0299907_1033600513300030006SoilMAADIIERTYEFYRKAGFRRELMISEPGMRGILNFLSETTVPEAKKAEPAQFVDDRFVRQLNSGK
Ga0299906_1035178333300030606SoilMAADIIERTYEFYRKAGFRRELMISEPGMGGILNFLSETTVPEAKKAEPAQFFDDRFVRQLNSGK
Ga0268386_1019663813300030619SoilTYEFYRRAGFRRDLTISEPGMRGILNFLSETVPEAKKAVPAQLFDDRFLRQLNSGK
Ga0268386_1050318923300030619SoilMAADIIERTYEFYRKAGFRRELMISEPGMRGILNFLSETTVPEAKKAEPAQFFDDRFVRQLNSGK
Ga0307473_1060549323300031820Hardwood Forest SoilRELVTSEPGLQGILDFLSDSIPEAKTAKPSQFFDDRFVRQVNSGK
Ga0307413_1211386623300031824RhizospherePEVLDRTYEFFKKAGFRRELVTSEPGLQGVLDFLSESIPEAKAAKPTQFFDDRILRQVNAGK
Ga0310907_1087767523300031847SoilKETDPEVLDRSYEFYKKAGFRREMVTSEPGLKGMLEFFAESIPEAKSAKPAQFFDDRFVRQVNSGK
Ga0306925_1155496023300031890SoilMRGILDFLSETLPEAKKATPAQFFDDRFVRQVNSAR
Ga0307407_1080919023300031903RhizosphereVIPKYTRDSDADIIDRTYEFYRKAGFKRELMTSEAGMQGVLDFMSATMPEAKKATPAQFFDDRFVRQLNSGK
Ga0310900_1068386923300031908SoilRRELVVSEPGVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK
Ga0307409_10083866623300031995RhizosphereIDRTYEFYRKAGFKRELMTSEAGMQGVLDFMSATMPEAKKATPAQFFDDRFVRQLNSGK
Ga0310897_1059954513300032003SoilTHETDQDVLDRSYEFYKKAGFRRELVTSEPGLRGILDFLSESIPEAKTAKPTQFFDDRILRQVNAAK
Ga0310906_1044704323300032013SoilLVVSEPGVQGILDFLSETIPEAKKAAPGQFFDDRFVRQVNSGK
Ga0318533_1078938223300032059SoilLVTSDPGLQGILDFLSESIPEAKTAKPTQFFDDRFVRQVNSGK
Ga0310895_1027679023300032122SoilRTYEFYRKAGFRRELMISEPGMRGILNFLSESVPEAKKAEPAQFFDDRFVRQLNSGK
Ga0315281_1013362013300032163SedimentSEPGLQGILDFLSDSIPEAKTAKPSQFFDERIVRQVNSGK
Ga0307470_1182018013300032174Hardwood Forest SoilFRRELMISEPGIQGILDFLTETIPEAKKATPAQFFDDRFVRHLNSAK
Ga0310889_1029165713300032179SoilLDRTYEFYKKAGFRRELVTSEPGLQGILDFLSESIPEAKSAKPAQFFDDRFVRQLNSGK
Ga0307471_10017592813300032180Hardwood Forest SoilFRRELIISEPGVQGILDFLSETVPEAKKAVPAQFFDDRFVRQLNSGK
Ga0307471_10184813423300032180Hardwood Forest SoilGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVNDSK
Ga0307472_10111570013300032205Hardwood Forest SoilDRTYEFYKRAGFRRELVTSEPGLQGILDFLSESMPEAKTAKPAQFFDDRIVRQVNATK
Ga0335084_1018473133300033004SoilTYEFYRKAGFRRELVTSEPGLQGMLDFLSESIPEAKKASPGQFFDDRFVRQVNSAR
Ga0310914_1031540813300033289SoilRRELVTSDPGLQGILDFLSESIPEAKTAKPTQFFDDRFVRQVNSGK
Ga0364928_0199435_20_2443300033813SedimentMKVIGKYAKETEQEVLDRSYEFYKKAGFRRELVTSEPGLQGMLDFLSESIPEAKSAKPSQFFDDRFVRQVNAGK
Ga0364927_0016937_1319_14473300034148SedimentMVSEPGVQGILDFLSETIPEAKKAKPSQFFDDRLVKQVDGGR
Ga0364932_0191050_1_1683300034177SedimentYEFYRRAGFRRELMISEPGVQGMLDFLSETIPEAKRAKPSQFFDDRLVKQLDGAR
Ga0364941_063214_1_1173300034417SedimentAGLQGVLDFLSESIPEAKTAKPGQFFDDRILRQVNATK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.