| Basic Information | |
|---|---|
| Family ID | F021323 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 219 |
| Average Sequence Length | 45 residues |
| Representative Sequence | WRPVQKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 219 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.38 % |
| % of genes near scaffold ends (potentially truncated) | 97.26 % |
| % of genes from short scaffolds (< 2000 bps) | 89.04 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.968 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.507 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.507 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.402 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 219 Family Scaffolds |
|---|---|---|
| PF03054 | tRNA_Me_trans | 84.47 |
| PF00266 | Aminotran_5 | 4.11 |
| PF12732 | YtxH | 1.37 |
| PF02687 | FtsX | 0.46 |
| PF08238 | Sel1 | 0.46 |
| PF13340 | DUF4096 | 0.46 |
| PF07007 | LprI | 0.46 |
| PF14294 | DUF4372 | 0.46 |
| PF12728 | HTH_17 | 0.46 |
| PF03009 | GDPD | 0.46 |
| PF00515 | TPR_1 | 0.46 |
| PF02770 | Acyl-CoA_dh_M | 0.46 |
| PF12704 | MacB_PCD | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 219 Family Scaffolds |
|---|---|---|---|
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 84.47 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.46 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.46 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.97 % |
| Unclassified | root | N/A | 47.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101073655 | Not Available | 691 | Open in IMG/M |
| 3300002557|JGI25381J37097_1052455 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 664 | Open in IMG/M |
| 3300002914|JGI25617J43924_10280597 | Not Available | 570 | Open in IMG/M |
| 3300002916|JGI25389J43894_1079513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300004082|Ga0062384_101229180 | Not Available | 546 | Open in IMG/M |
| 3300004091|Ga0062387_100989056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 644 | Open in IMG/M |
| 3300004091|Ga0062387_101617189 | Not Available | 523 | Open in IMG/M |
| 3300004092|Ga0062389_100102762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2537 | Open in IMG/M |
| 3300004137|Ga0058883_1531489 | Not Available | 549 | Open in IMG/M |
| 3300004635|Ga0062388_101775496 | Not Available | 632 | Open in IMG/M |
| 3300004635|Ga0062388_102680039 | Not Available | 525 | Open in IMG/M |
| 3300005172|Ga0066683_10260988 | Not Available | 1075 | Open in IMG/M |
| 3300005181|Ga0066678_10887753 | Not Available | 584 | Open in IMG/M |
| 3300005186|Ga0066676_10789025 | Not Available | 644 | Open in IMG/M |
| 3300005332|Ga0066388_102109627 | Not Available | 1014 | Open in IMG/M |
| 3300005332|Ga0066388_107896054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 532 | Open in IMG/M |
| 3300005447|Ga0066689_10907971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300005451|Ga0066681_10574253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300005454|Ga0066687_10957193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005467|Ga0070706_101491095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300005471|Ga0070698_100042282 | All Organisms → cellular organisms → Bacteria | 4674 | Open in IMG/M |
| 3300005518|Ga0070699_101534312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300005548|Ga0070665_100447445 | Not Available | 1301 | Open in IMG/M |
| 3300005555|Ga0066692_10435590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300005568|Ga0066703_10159283 | Not Available | 1359 | Open in IMG/M |
| 3300005568|Ga0066703_10617360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 630 | Open in IMG/M |
| 3300005764|Ga0066903_101791182 | Not Available | 1173 | Open in IMG/M |
| 3300005764|Ga0066903_103882665 | Not Available | 803 | Open in IMG/M |
| 3300005843|Ga0068860_100370271 | Not Available | 1413 | Open in IMG/M |
| 3300006028|Ga0070717_11483796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300006032|Ga0066696_10122544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
| 3300006032|Ga0066696_11032882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300006052|Ga0075029_101049545 | Not Available | 564 | Open in IMG/M |
| 3300006086|Ga0075019_10930062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300006237|Ga0097621_101220090 | Not Available | 709 | Open in IMG/M |
| 3300006354|Ga0075021_10394630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300006354|Ga0075021_10631191 | Not Available | 685 | Open in IMG/M |
| 3300006796|Ga0066665_10819809 | Not Available | 731 | Open in IMG/M |
| 3300006804|Ga0079221_10493840 | Not Available | 792 | Open in IMG/M |
| 3300006806|Ga0079220_10477175 | Not Available | 844 | Open in IMG/M |
| 3300006854|Ga0075425_100152432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2649 | Open in IMG/M |
| 3300006914|Ga0075436_101171482 | Not Available | 580 | Open in IMG/M |
| 3300007076|Ga0075435_100345262 | Not Available | 1275 | Open in IMG/M |
| 3300007076|Ga0075435_101876687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300007255|Ga0099791_10087294 | Not Available | 1427 | Open in IMG/M |
| 3300007258|Ga0099793_10457624 | Not Available | 631 | Open in IMG/M |
| 3300007258|Ga0099793_10614014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
| 3300007265|Ga0099794_10003679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5898 | Open in IMG/M |
| 3300007265|Ga0099794_10071022 | Not Available | 1705 | Open in IMG/M |
| 3300007265|Ga0099794_10151124 | Not Available | 1179 | Open in IMG/M |
| 3300009038|Ga0099829_10029272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3907 | Open in IMG/M |
| 3300009038|Ga0099829_10346741 | Not Available | 1222 | Open in IMG/M |
| 3300009038|Ga0099829_11094303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 661 | Open in IMG/M |
| 3300009038|Ga0099829_11115741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300009038|Ga0099829_11211702 | Not Available | 625 | Open in IMG/M |
| 3300009038|Ga0099829_11717324 | Not Available | 516 | Open in IMG/M |
| 3300009088|Ga0099830_10672993 | Not Available | 851 | Open in IMG/M |
| 3300009088|Ga0099830_10883220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 739 | Open in IMG/M |
| 3300009088|Ga0099830_10929811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 719 | Open in IMG/M |
| 3300009088|Ga0099830_11546131 | Not Available | 553 | Open in IMG/M |
| 3300009088|Ga0099830_11698239 | Not Available | 527 | Open in IMG/M |
| 3300009089|Ga0099828_11327530 | Not Available | 636 | Open in IMG/M |
| 3300009090|Ga0099827_11613197 | Not Available | 565 | Open in IMG/M |
| 3300009137|Ga0066709_103801710 | Not Available | 548 | Open in IMG/M |
| 3300009162|Ga0075423_11174612 | Not Available | 818 | Open in IMG/M |
| 3300009792|Ga0126374_10870094 | Not Available | 695 | Open in IMG/M |
| 3300010303|Ga0134082_10061852 | Not Available | 1448 | Open in IMG/M |
| 3300010322|Ga0134084_10324057 | Not Available | 579 | Open in IMG/M |
| 3300010323|Ga0134086_10237478 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300010358|Ga0126370_11947086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300010359|Ga0126376_11943166 | Not Available | 629 | Open in IMG/M |
| 3300010360|Ga0126372_10560514 | Not Available | 1087 | Open in IMG/M |
| 3300010360|Ga0126372_12426902 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 575 | Open in IMG/M |
| 3300010360|Ga0126372_12905812 | Not Available | 531 | Open in IMG/M |
| 3300010360|Ga0126372_13091486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010361|Ga0126378_11843034 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300010376|Ga0126381_100258805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2363 | Open in IMG/M |
| 3300010379|Ga0136449_100016917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 19093 | Open in IMG/M |
| 3300010398|Ga0126383_10677869 | Not Available | 1108 | Open in IMG/M |
| 3300010937|Ga0137776_1748346 | Not Available | 845 | Open in IMG/M |
| 3300011120|Ga0150983_10100619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300011120|Ga0150983_11957827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300011120|Ga0150983_15177269 | Not Available | 871 | Open in IMG/M |
| 3300011269|Ga0137392_10761477 | Not Available | 800 | Open in IMG/M |
| 3300011270|Ga0137391_10013092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6688 | Open in IMG/M |
| 3300011270|Ga0137391_10402794 | Not Available | 1169 | Open in IMG/M |
| 3300011271|Ga0137393_10279635 | Not Available | 1419 | Open in IMG/M |
| 3300011271|Ga0137393_11006823 | Not Available | 709 | Open in IMG/M |
| 3300012189|Ga0137388_10348471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
| 3300012189|Ga0137388_11449743 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012198|Ga0137364_10004081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7648 | Open in IMG/M |
| 3300012199|Ga0137383_11359814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
| 3300012201|Ga0137365_10696904 | Not Available | 742 | Open in IMG/M |
| 3300012203|Ga0137399_11015956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 698 | Open in IMG/M |
| 3300012205|Ga0137362_10864613 | Not Available | 773 | Open in IMG/M |
| 3300012205|Ga0137362_11427722 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 578 | Open in IMG/M |
| 3300012209|Ga0137379_10143927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2291 | Open in IMG/M |
| 3300012210|Ga0137378_10595706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300012210|Ga0137378_11415194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300012211|Ga0137377_10920588 | Not Available | 806 | Open in IMG/M |
| 3300012359|Ga0137385_10841061 | Not Available | 761 | Open in IMG/M |
| 3300012359|Ga0137385_11212651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300012361|Ga0137360_10148708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1854 | Open in IMG/M |
| 3300012361|Ga0137360_10603980 | Not Available | 939 | Open in IMG/M |
| 3300012361|Ga0137360_11340329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300012363|Ga0137390_10425002 | Not Available | 1306 | Open in IMG/M |
| 3300012363|Ga0137390_11526845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300012683|Ga0137398_10123440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
| 3300012683|Ga0137398_10631713 | Not Available | 742 | Open in IMG/M |
| 3300012683|Ga0137398_10982333 | Not Available | 586 | Open in IMG/M |
| 3300012918|Ga0137396_10087741 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300012918|Ga0137396_10162686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1630 | Open in IMG/M |
| 3300012918|Ga0137396_10269576 | Not Available | 1257 | Open in IMG/M |
| 3300012922|Ga0137394_11112345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 654 | Open in IMG/M |
| 3300012923|Ga0137359_10447892 | Not Available | 1142 | Open in IMG/M |
| 3300012925|Ga0137419_11027689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 684 | Open in IMG/M |
| 3300012925|Ga0137419_11432447 | Not Available | 584 | Open in IMG/M |
| 3300012927|Ga0137416_10136820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
| 3300012944|Ga0137410_10837208 | Not Available | 775 | Open in IMG/M |
| 3300012948|Ga0126375_10451171 | Not Available | 945 | Open in IMG/M |
| 3300012971|Ga0126369_10801302 | Not Available | 1024 | Open in IMG/M |
| 3300012976|Ga0134076_10162850 | Not Available | 919 | Open in IMG/M |
| 3300014969|Ga0157376_12338838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300015241|Ga0137418_10300814 | Not Available | 1342 | Open in IMG/M |
| 3300016357|Ga0182032_10965119 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 727 | Open in IMG/M |
| 3300016387|Ga0182040_10785059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 784 | Open in IMG/M |
| 3300017659|Ga0134083_10273022 | Not Available | 712 | Open in IMG/M |
| 3300017934|Ga0187803_10361676 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 584 | Open in IMG/M |
| 3300017955|Ga0187817_10062976 | Not Available | 2298 | Open in IMG/M |
| 3300017972|Ga0187781_10211547 | Not Available | 1369 | Open in IMG/M |
| 3300018085|Ga0187772_10398447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300018088|Ga0187771_11822213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300018468|Ga0066662_11500559 | Not Available | 701 | Open in IMG/M |
| 3300019284|Ga0187797_1254278 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300019361|Ga0173482_10379013 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 650 | Open in IMG/M |
| 3300020580|Ga0210403_11153936 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 599 | Open in IMG/M |
| 3300020582|Ga0210395_10943520 | Not Available | 640 | Open in IMG/M |
| 3300020583|Ga0210401_11379524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300021086|Ga0179596_10304598 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 795 | Open in IMG/M |
| 3300021168|Ga0210406_10150452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1954 | Open in IMG/M |
| 3300021170|Ga0210400_10021626 | All Organisms → cellular organisms → Bacteria | 5020 | Open in IMG/M |
| 3300021170|Ga0210400_10852262 | Not Available | 745 | Open in IMG/M |
| 3300021178|Ga0210408_10343893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300021401|Ga0210393_10691529 | Not Available | 832 | Open in IMG/M |
| 3300021406|Ga0210386_11282154 | Not Available | 617 | Open in IMG/M |
| 3300021420|Ga0210394_10435369 | Not Available | 1154 | Open in IMG/M |
| 3300021420|Ga0210394_11143380 | Not Available | 670 | Open in IMG/M |
| 3300021478|Ga0210402_10313936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
| 3300021478|Ga0210402_10787688 | Not Available | 876 | Open in IMG/M |
| 3300021559|Ga0210409_10080668 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
| 3300021559|Ga0210409_11703354 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021560|Ga0126371_12286924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300021861|Ga0213853_10903090 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 609 | Open in IMG/M |
| 3300021861|Ga0213853_11262733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
| 3300024284|Ga0247671_1024114 | Not Available | 914 | Open in IMG/M |
| 3300024286|Ga0247687_1006004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1549 | Open in IMG/M |
| 3300024288|Ga0179589_10481527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300024290|Ga0247667_1019476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
| 3300024290|Ga0247667_1050680 | Not Available | 772 | Open in IMG/M |
| 3300025914|Ga0207671_11348715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300026285|Ga0209438_1126207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300026309|Ga0209055_1004857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7852 | Open in IMG/M |
| 3300026309|Ga0209055_1266947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300026310|Ga0209239_1159558 | Not Available | 882 | Open in IMG/M |
| 3300026312|Ga0209153_1050712 | Not Available | 1470 | Open in IMG/M |
| 3300026314|Ga0209268_1091959 | Not Available | 854 | Open in IMG/M |
| 3300026322|Ga0209687_1149685 | Not Available | 751 | Open in IMG/M |
| 3300026325|Ga0209152_10226107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 699 | Open in IMG/M |
| 3300026342|Ga0209057_1030161 | All Organisms → cellular organisms → Bacteria | 2861 | Open in IMG/M |
| 3300026356|Ga0257150_1030867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300026469|Ga0257169_1084083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300026489|Ga0257160_1010855 | Not Available | 1307 | Open in IMG/M |
| 3300026508|Ga0257161_1105930 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026523|Ga0209808_1224212 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026540|Ga0209376_1306200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300026542|Ga0209805_1293301 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 618 | Open in IMG/M |
| 3300026551|Ga0209648_10552195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 644 | Open in IMG/M |
| 3300026551|Ga0209648_10626759 | Not Available | 590 | Open in IMG/M |
| 3300026555|Ga0179593_1180449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2181 | Open in IMG/M |
| 3300026557|Ga0179587_10292477 | Not Available | 1048 | Open in IMG/M |
| 3300027512|Ga0209179_1055842 | Not Available | 852 | Open in IMG/M |
| 3300027655|Ga0209388_1111081 | Not Available | 784 | Open in IMG/M |
| 3300027678|Ga0209011_1093339 | Not Available | 881 | Open in IMG/M |
| 3300027729|Ga0209248_10006982 | All Organisms → cellular organisms → Bacteria | 3571 | Open in IMG/M |
| 3300027729|Ga0209248_10049334 | Not Available | 1293 | Open in IMG/M |
| 3300027729|Ga0209248_10074129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300027795|Ga0209139_10096182 | Not Available | 1043 | Open in IMG/M |
| 3300027829|Ga0209773_10303199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300027846|Ga0209180_10087090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1768 | Open in IMG/M |
| 3300027846|Ga0209180_10489780 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 689 | Open in IMG/M |
| 3300027862|Ga0209701_10460354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 698 | Open in IMG/M |
| 3300027875|Ga0209283_10675465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300027882|Ga0209590_10099092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1738 | Open in IMG/M |
| 3300028379|Ga0268266_11787493 | Not Available | 589 | Open in IMG/M |
| 3300028379|Ga0268266_12260232 | Not Available | 515 | Open in IMG/M |
| 3300028536|Ga0137415_10097415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2794 | Open in IMG/M |
| 3300030043|Ga0302306_10418030 | Not Available | 512 | Open in IMG/M |
| 3300030730|Ga0307482_1052993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300031128|Ga0170823_17566776 | Not Available | 1513 | Open in IMG/M |
| 3300031720|Ga0307469_10213230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
| 3300031720|Ga0307469_10289336 | Not Available | 1343 | Open in IMG/M |
| 3300031753|Ga0307477_10105731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300031753|Ga0307477_10654939 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 705 | Open in IMG/M |
| 3300031754|Ga0307475_10182861 | Not Available | 1673 | Open in IMG/M |
| 3300031754|Ga0307475_10717916 | Not Available | 796 | Open in IMG/M |
| 3300031820|Ga0307473_10802592 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 671 | Open in IMG/M |
| 3300031823|Ga0307478_10109671 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300031910|Ga0306923_11169646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 824 | Open in IMG/M |
| 3300031946|Ga0310910_11552399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300031962|Ga0307479_10123058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2532 | Open in IMG/M |
| 3300031962|Ga0307479_10317446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1540 | Open in IMG/M |
| 3300031962|Ga0307479_10359496 | Not Available | 1439 | Open in IMG/M |
| 3300031962|Ga0307479_11347786 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 673 | Open in IMG/M |
| 3300031962|Ga0307479_11868183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300032001|Ga0306922_12023814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 560 | Open in IMG/M |
| 3300032770|Ga0335085_10001193 | All Organisms → cellular organisms → Bacteria | 58987 | Open in IMG/M |
| 3300033829|Ga0334854_044093 | Not Available | 1069 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.28% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.46% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.46% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.46% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.46% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1010736552 | 3300002245 | Forest Soil | TKFTHSVWRPMHKVSALMQGIKVGIDLLRARRGRRRPEEPLEQEEELFI* |
| JGI25381J37097_10524551 | 3300002557 | Grasslands Soil | GSKFSHSFWRPVQKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI* |
| JGI25617J43924_102805971 | 3300002914 | Grasslands Soil | KASALVQGIKVGLDLLRSRRKRGSSGDEPREQQEEELFI* |
| JGI25389J43894_10795132 | 3300002916 | Grasslands Soil | FWKPVQRASALVQGIKVGLDLLRSRKATGSRNPESSAEQEEELFI* |
| Ga0062384_1012291801 | 3300004082 | Bog Forest Soil | KASALLTGIKVGLDILRSRRATSGTVPPDEPSEQQEEELFI* |
| Ga0062387_1009890561 | 3300004091 | Bog Forest Soil | VEDAGTQFKSTVWRPMQKASALVQGIKVGLDLLRSRRHRRRPDEPLEQEEELFI* |
| Ga0062387_1016171892 | 3300004091 | Bog Forest Soil | SALLTGIKVGLDMLRNRRAAAGTVPPDEPSEQQEEELFI* |
| Ga0062389_1001027623 | 3300004092 | Bog Forest Soil | PMQKASALLQGIKVGIDLLRSRRERRRPDEPLEQEEELFI* |
| Ga0058883_15314892 | 3300004137 | Forest Soil | WRPMQKASALVQGIKVGLDLLRSRRERRRPDEPLEQEEELFI* |
| Ga0062388_1017754961 | 3300004635 | Bog Forest Soil | SVLEPVKKASALLTGIKVGLDILRSRRQASRTTPPDEPSEQQEEELFI* |
| Ga0062388_1026800392 | 3300004635 | Bog Forest Soil | KASALLTGIKVGLDILRSRRTTSGTVPPDEPSEQQEEELFI* |
| Ga0066683_102609881 | 3300005172 | Soil | VKHSFWLPVQKASALLQGIKVGLDLLRSRRRGSDRRRGDEPREAQEEELFI* |
| Ga0066678_108877532 | 3300005181 | Soil | QKASALVQGIKVGIDLLRARRGPSSRRDEAAEHEEELFI* |
| Ga0066676_107890251 | 3300005186 | Soil | QFRQSFWRPVQKASALVQGIKVGLDLLRARKGRSSGNSEPSAEQEEELFI* |
| Ga0066388_1021096271 | 3300005332 | Tropical Forest Soil | TLEDAGSRFSHGVWRPVQKVSALMQGIRVGLDLLRSRRAPRKPEDSLEQEEELFI* |
| Ga0066388_1078960541 | 3300005332 | Tropical Forest Soil | AGSKFSHGVWRPVQKISALVQGIRVGLDLLRSRRTNRRPEEPLEQEEELFI* |
| Ga0066689_109079711 | 3300005447 | Soil | PVQKASALVQGIKVGLDLLRSRRRSASRSRNDEPRESQEEELFI* |
| Ga0066681_105742531 | 3300005451 | Soil | VEEAGSQFKHSVWRPMQKASALVQGIKVGIDLLRARRGPSSRRDEAAEHEEELFI* |
| Ga0066687_109571931 | 3300005454 | Soil | QKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI* |
| Ga0070706_1014910952 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ASALVQGIKVGLDLLRSRRARTQPDSQERSPEQEEELFI* |
| Ga0070698_1000422821 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QKASALVQGIKVGLDLLRARKAKSSGNQEPSTEQEEELFI* |
| Ga0070699_1015343121 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ASALVQGIKVGLDLLRSRRARTERDSQERSPEQEEELFI* |
| Ga0070665_1004474451 | 3300005548 | Switchgrass Rhizosphere | ASALVQGIKVGLDLLRSRRAPAPRRHGDETAEQEEELFI* |
| Ga0066692_104355901 | 3300005555 | Soil | HSFWRPVQKASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI* |
| Ga0066703_101592831 | 3300005568 | Soil | SFWRPVQKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI* |
| Ga0066703_106173602 | 3300005568 | Soil | GSKFSHSFWRPVQKASALVQGIKVGLDLLRSRRKRSPGGDEPREQQEEELFI* |
| Ga0066903_1017911822 | 3300005764 | Tropical Forest Soil | DAGTQFRQSFWRPMQKASALVQGIKVGLDLLRSRKSPPPPRDEAAEQEEELFI* |
| Ga0066903_1038826652 | 3300005764 | Tropical Forest Soil | DAGTQFRQSFWRPVQKASALVQGIKVGLDLLRSRRAAAPRRDEATEQEEELFI* |
| Ga0068860_1003702711 | 3300005843 | Switchgrass Rhizosphere | AGAQFRQSFWRPVQKASALVQGIKVGLDLLRSRRSASPRRRDDETAEQEEELFI* |
| Ga0070717_114837962 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ASALVQGIKVGLDLLRSRRAATQPDAQERSPEQEEELFI* |
| Ga0066696_101225443 | 3300006032 | Soil | KFSHSFWRPVQKASALVQGIKVALDLLRSRRSRSRGDEPREQQEEELFI* |
| Ga0066696_110328821 | 3300006032 | Soil | QGIKVGLDLLRSRRRGSDRRRGDEPREAQEEELFI* |
| Ga0075029_1010495452 | 3300006052 | Watersheds | VLQPVKKASALLTGIKVGLDILRSRSAARGGSNPDEPLEQQEEELFI* |
| Ga0075019_109300623 | 3300006086 | Watersheds | ASALVQGIKVGLDLLRSRRKPSSRGDEPREQQEEELFI* |
| Ga0097621_1012200902 | 3300006237 | Miscanthus Rhizosphere | QKASALVQGIKVGLDLLRSRRAAAPRRRDDETAEQEEELFI* |
| Ga0075021_103946301 | 3300006354 | Watersheds | VQKASALIQGIKVGIDLLRSRRSGRPAASSGDDRAEQEEELFI* |
| Ga0075021_106311911 | 3300006354 | Watersheds | QKASALVQGIKVGLDLLRSRRKSDSRNDDPREQQEEELFI* |
| Ga0066665_108198092 | 3300006796 | Soil | KASALVQGIKVGLDFFRSRRRGTPARESVEREDELFI* |
| Ga0079221_104938401 | 3300006804 | Agricultural Soil | SFWRPVQKASALVQGIKVGLDILRSRRGNARRRRSDDPRESQEEELFI* |
| Ga0079220_104771752 | 3300006806 | Agricultural Soil | LLQGIKVGLDLLRSRRRGTGHRRDDEPRETQEEELFI* |
| Ga0075425_1001524321 | 3300006854 | Populus Rhizosphere | KASALVQGIKVGLDLLRARKAKRSGNQEPSAEQEEELFI* |
| Ga0075436_1011714821 | 3300006914 | Populus Rhizosphere | PMQKASALVQGIKVGIDLLRARRGASPRRDEAAEHEEELFI* |
| Ga0075435_1003452621 | 3300007076 | Populus Rhizosphere | QFRQSFWRPVQKASALVQGSKVGLDLLRSRRAPAARRRDDETAEQEEELFI* |
| Ga0075435_1018766872 | 3300007076 | Populus Rhizosphere | KASALVQGIKVGLDLLRSRRAAAPRRRDDETAEQEEELFI* |
| Ga0099791_100872943 | 3300007255 | Vadose Zone Soil | FWRPVQKASALVQGIRVGLDLLRSRRSRRSGDEPREQQEEELFI* |
| Ga0099793_104576241 | 3300007258 | Vadose Zone Soil | VSALVQGIKVGIDLLRARRTNRRPEEPLEQEEELFI* |
| Ga0099793_106140141 | 3300007258 | Vadose Zone Soil | KASALVQGIKVGLDLLRSRRRSGSRGDDPREQQEEELFI* |
| Ga0099794_100036791 | 3300007265 | Vadose Zone Soil | KFKHNFWRPVQKASALVQGIKVGLDLLRSRRGRGSRRDDPREQQEEELFI* |
| Ga0099794_100710223 | 3300007265 | Vadose Zone Soil | VQKASALVQGIKVGLDLLRSRRRRSRGDEPREQQEEELFI* |
| Ga0099794_101511241 | 3300007265 | Vadose Zone Soil | ALAQGIKVGLDLLRSRRGRGSRRDDPREQQEEELFI* |
| Ga0099829_100292721 | 3300009038 | Vadose Zone Soil | TSFWRPVRKASALVQGIKVGLDLLRSRRGRANPEEPLEHEEELFI* |
| Ga0099829_103467412 | 3300009038 | Vadose Zone Soil | VQGIKVGLDLLRSRRSRGSRRDDPREQQEEELFI* |
| Ga0099829_110943032 | 3300009038 | Vadose Zone Soil | HKASALVQGIKVGLDLLRSRRRGSRGDEPREQQEEELFI* |
| Ga0099829_111157411 | 3300009038 | Vadose Zone Soil | GAKFSHSFWRPVQKASALVQGIKVGLDLLRSRRGHRRGDEPREQQEEELFI* |
| Ga0099829_112117022 | 3300009038 | Vadose Zone Soil | QIKHSFWRPVQKASALVQGIKVGLDLLRSRRRSASRSRNDEPRESQEEELFI* |
| Ga0099829_117173241 | 3300009038 | Vadose Zone Soil | SFWRPVQKASALVQGIKVGLDLLRSRRKRGSSGDEPREQQEEELFI* |
| Ga0099830_106729932 | 3300009088 | Vadose Zone Soil | WRPMHKASALVQGIKVGLDLLRSRRRGSRGDEPREQQEEELFI* |
| Ga0099830_108832202 | 3300009088 | Vadose Zone Soil | EDAGAQFRQNFWKPVQKASALVQGIKVGLDLLRARRGATASSASQERSPEQEEELFI* |
| Ga0099830_109298112 | 3300009088 | Vadose Zone Soil | DAGAKFKHSFWRPVQKASALVQGIKVGLDLLRSRRGRSRGDEPREQQEEELFI* |
| Ga0099830_115461311 | 3300009088 | Vadose Zone Soil | QKASALVQGIKVGLDLLRSRRKRRPGGEEPREQQEEELFI* |
| Ga0099830_116982392 | 3300009088 | Vadose Zone Soil | FKHRFWRPVQKASALVQGIKVGLDLLRSRRGRTRGDEPREQQEEELFI* |
| Ga0099828_113275302 | 3300009089 | Vadose Zone Soil | GAKFKHSFWRPVQKASALVQGIKVGLDLLRSRRGHSRGDEPREQQEEELFI* |
| Ga0099827_116131972 | 3300009090 | Vadose Zone Soil | PVQKASALVQGIKVGLDLLRSRRKRSPGGDEPREQQEEELFI* |
| Ga0066709_1038017102 | 3300009137 | Grasslands Soil | EEAGMQFKQSFWRPVQKASALVQGIKVGLDLLRARKARSSGNPEGSAEQEEELFI* |
| Ga0075423_111746122 | 3300009162 | Populus Rhizosphere | ALVQGIKVGLDLLRSRRAANPRRRGDETAEQEEELFI* |
| Ga0126374_108700941 | 3300009792 | Tropical Forest Soil | EAVEEAGSQFKHSFWRPVQKASALVQGIKVGIDLLRSRRSSSSSRRDEERSEHEEELFI* |
| Ga0126384_100924433 | 3300010046 | Tropical Forest Soil | TLEAVEEAGSQFKHSFWRPVQKASALVQGIKVGIDLLRSRRSSSSSRRDEERSEHEEELFI* |
| Ga0134082_100618523 | 3300010303 | Grasslands Soil | GSKFSHSFWRPVQKASALVQGIKVGLDLLRSRRRRRNSDDPREQQEEELFI* |
| Ga0134084_103240572 | 3300010322 | Grasslands Soil | AGSKFSHSFWRPMQKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI* |
| Ga0134086_102374781 | 3300010323 | Grasslands Soil | MNKASALVQGIKVGLDFFRSRRRGTPARESVEREDELFI* |
| Ga0126370_119470861 | 3300010358 | Tropical Forest Soil | SALVQGIKVGLDLLRSRRASKSKGDEPPRETQEEELFI* |
| Ga0126376_119431662 | 3300010359 | Tropical Forest Soil | WRPVQKASALVQGIKVGIDLLRSRRSSSSSRRDEERSEHEEELFI* |
| Ga0126372_105605142 | 3300010360 | Tropical Forest Soil | LEAVEEAGSGFKNSFWRPMQKASALVQGIKVGLDLLRSRRASKSKGDEPPRETQEEELFI |
| Ga0126372_124269021 | 3300010360 | Tropical Forest Soil | KVSALVQGIRLGLDLLRSRRARQTGNEEPSSEQEEELFI* |
| Ga0126372_129058121 | 3300010360 | Tropical Forest Soil | QKASALVQGIKVGIDLLRSRRSSSSSRRGEERSEHEEELFI* |
| Ga0126372_130914862 | 3300010360 | Tropical Forest Soil | ALVQGIKVGIDLLRSRNRRSTERDRRSDEPPRESQEEELFI* |
| Ga0126378_118430341 | 3300010361 | Tropical Forest Soil | AQVKNSFWRPMHKASALVQGIKVGLDLLRSRRRGWDGRSERRRSDEPREPQEEELFI* |
| Ga0126381_1002588051 | 3300010376 | Tropical Forest Soil | GAQVKNSFWRPMHKASALVQGIKVGLDLLRSRRRGWDGRSDRRRSDEPRESQEEELFI* |
| Ga0136449_10001691717 | 3300010379 | Peatlands Soil | QKASALLQGIKVGLDLLRSRRASRNPDEPLEQEEELFI* |
| Ga0126383_106778692 | 3300010398 | Tropical Forest Soil | GAQFKSNFWRPVQKASALVQGIKVGLDLLRSRRAPRPSAGGREEGSEQEEELFI* |
| Ga0137776_17483461 | 3300010937 | Sediment | KHSFWSPVRKASALVQGIKVGIDLLRSRRGSSKKSDEPLEQEEELFI* |
| Ga0150983_101006192 | 3300011120 | Forest Soil | ALMQGIKVGIDLLRSRRGNRRPEEPLEHEEELFI* |
| Ga0150983_119578272 | 3300011120 | Forest Soil | FWRPVRKASALVQGIKVGLDLLRSRRGRVNPDEPLEHEEELFI* |
| Ga0150983_151772691 | 3300011120 | Forest Soil | VWRPMQKASALVQGIKVGLDLLRSRRERRRPDEPLEQEEELFI* |
| Ga0137392_107614771 | 3300011269 | Vadose Zone Soil | SFWRPMQKASALVQGIKVGIDLLRARRGPSSRGDEAAEHEEELFI* |
| Ga0137391_100130928 | 3300011270 | Vadose Zone Soil | VEDAGTKFTHNVWRPVQKVSALVQGIKVGIDLLRARRGRRRPEEPLEQEEELFI* |
| Ga0137391_104027942 | 3300011270 | Vadose Zone Soil | RSFWRPMHKASALVQGIKVGLDLLRSRRRGSRGDEPREQQEEELFI* |
| Ga0137393_102796351 | 3300011271 | Vadose Zone Soil | ASALVQGIKVGLDLLRARRGATASSASQERSPEQEEELFI* |
| Ga0137393_110068232 | 3300011271 | Vadose Zone Soil | RPMHKASALVQGIRVGLDLLRSRRGNRKPEPSSEREEELFI* |
| Ga0137388_103484712 | 3300012189 | Vadose Zone Soil | LVQGIKVGLDLLRSRRKRSRGGDEPREQQEEELFI* |
| Ga0137388_114497432 | 3300012189 | Vadose Zone Soil | HSVWRPVQKVSALMQGIKVGLDLLRSRRGGNRRRSEDPLEQEEELFI* |
| Ga0137364_100040817 | 3300012198 | Vadose Zone Soil | VQGIKVGLDLLRSRRRGWDGRPDRRRSDEPREPQEEELFI* |
| Ga0137383_113598142 | 3300012199 | Vadose Zone Soil | KASALVQGIKVGLDLLRSRRRRSRGDEPREQQEEELFI* |
| Ga0137365_106969042 | 3300012201 | Vadose Zone Soil | SALVQGIKVGLDLLRSRRRRPNGDEPREQQEEELFI* |
| Ga0137399_110159562 | 3300012203 | Vadose Zone Soil | WRPVQKASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI* |
| Ga0137362_108646131 | 3300012205 | Vadose Zone Soil | ALVQGIKVGIDLLRARRTNRRPEEPLEQEEELFI* |
| Ga0137362_114277221 | 3300012205 | Vadose Zone Soil | EAGSQFKHSFWRPVQKASALVQGIKVGLDLLRSRRSSSHSRRDEPLEQEEELFI* |
| Ga0137381_108615021 | 3300012207 | Vadose Zone Soil | TLETVEEAGSQFKHSFWRPVQKASALVQGIKVGLDLLRSRRRSASRSRNDEPRESQEEELFI* |
| Ga0137379_101439273 | 3300012209 | Vadose Zone Soil | RPMHKASALVQGIKVGLDLLRSRRRGWDGRPDRRRSDEPREPQEEELFI* |
| Ga0137378_105957062 | 3300012210 | Vadose Zone Soil | FWLPVQKASALVQGIKVGLDLLRSRRRRPNGDEPREQQEEELFI* |
| Ga0137378_114151942 | 3300012210 | Vadose Zone Soil | LVQGIKVGLDLLRSRRRGSDGRADRRRGDEPREAQEEELFI* |
| Ga0137377_109205882 | 3300012211 | Vadose Zone Soil | FSHSFWRPMQKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI* |
| Ga0137385_108410611 | 3300012359 | Vadose Zone Soil | QKASALVQGIKVGLDILRSRRRRRQGDEPREQQEEELFI* |
| Ga0137385_112126511 | 3300012359 | Vadose Zone Soil | MHKASALVQGIKVGLDLLRSRRRGWDGRSERRPSDEPREPQEEELFI* |
| Ga0137360_101487081 | 3300012361 | Vadose Zone Soil | LVQGIKVGLDLLRSRRKRGSGGDEPREQQEEELFI* |
| Ga0137360_106039801 | 3300012361 | Vadose Zone Soil | ALVQGIKVGLDLLRSRRAATQSDSQERSPEQEEELFI* |
| Ga0137360_113403292 | 3300012361 | Vadose Zone Soil | VWRPVQKVSALMQGIKVGIDLLRARRGGRRRTEEPLEHEEELFI* |
| Ga0137390_104250021 | 3300012363 | Vadose Zone Soil | KASALVQGIKVGLDLLRSRRRSRRSGDEPREQQEEELFI* |
| Ga0137390_115268451 | 3300012363 | Vadose Zone Soil | ASALVQGIKVGLDLLRSRRKRSRGGDEPREQQEEELFI* |
| Ga0137398_101234401 | 3300012683 | Vadose Zone Soil | KHSVWRPMQKASALVQGIKVGIDLLRARRGPSSRRDEPLEHEEELFI* |
| Ga0137398_106317132 | 3300012683 | Vadose Zone Soil | SVWRPMHKVSALVQGIKVGIDLLRARRTNRRPEEPLEQEEELFI* |
| Ga0137398_109823332 | 3300012683 | Vadose Zone Soil | FWKPVQKASALVQGIKVGLDLLRARRGATASSASQERSPEQEEELFI* |
| Ga0137396_100877413 | 3300012918 | Vadose Zone Soil | PVQKASALVQGIKVGLDLLRSRRGRGSRGDDPREQQEEELFI* |
| Ga0137396_101626862 | 3300012918 | Vadose Zone Soil | LWRPVQKASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI* |
| Ga0137396_102695761 | 3300012918 | Vadose Zone Soil | MHKVSALMQGIKVGIDLLRSRRGNRRPEEPLEQEEELFI* |
| Ga0137394_111123451 | 3300012922 | Vadose Zone Soil | KHNFWRPVQKASALVQGIKVGLDLLRSRRGRGSRGDDPREQQEEELFI* |
| Ga0137359_104478921 | 3300012923 | Vadose Zone Soil | FSHNVWRPMHKVSALVQGIKVGIDLLRARRTNRRPEEPLEQEEELFI* |
| Ga0137419_110276892 | 3300012925 | Vadose Zone Soil | QKASALVQGIKVGLDLLRSRRSRGSRRDDPREQQEEELFI* |
| Ga0137419_114324471 | 3300012925 | Vadose Zone Soil | KASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI* |
| Ga0137416_101368201 | 3300012927 | Vadose Zone Soil | SFWRPVQKASALVQGIKVGLDLLRSRRGRRSGDEPREQQEEELFI* |
| Ga0137410_108372082 | 3300012944 | Vadose Zone Soil | ALVQGIKVGLDLLRSRRSRGSRRDDPREQQEEELFI* |
| Ga0126375_104511712 | 3300012948 | Tropical Forest Soil | EAGSQFKHGFWRPVQKASALLQGIKVGLDLLRSRRRGPDRRRNDEPRETQEEELFI* |
| Ga0126369_108013021 | 3300012971 | Tropical Forest Soil | KASALVHGIKVGLDLLRSRRAPGPRRRDDETAEQEEELFI* |
| Ga0134076_101628502 | 3300012976 | Grasslands Soil | PVQKASALVQGIKVGLDLLRSRRRRRSSDDPREQQEEELFI* |
| Ga0157376_123388382 | 3300014969 | Miscanthus Rhizosphere | VQGIKVGLDLLRSRRAPAPRRRDDEPAEQEEELFI* |
| Ga0137418_103008143 | 3300015241 | Vadose Zone Soil | WRPVQKASALVQGIKVGLDLLRSRRKRSPGGDEPREQQEEELFI* |
| Ga0182032_109651192 | 3300016357 | Soil | TSFWRPMQKASALVQGIKVGIVLLRSRNRRTTERRRDEPPREPQEEELFI |
| Ga0182040_107850592 | 3300016387 | Soil | AGVQFRQSFWRPVQKASALVHGIKVGLDLLRSRRAPGPRRRDDETAEQEEELFI |
| Ga0134083_102730221 | 3300017659 | Grasslands Soil | PMHKASALVQGIKVGLDLLRSRRRGSRGDEPREQQEEELFI |
| Ga0187803_103616761 | 3300017934 | Freshwater Sediment | GSQFRTSFWRPVRKASALVQGIKVGLDLLRSRRGRVNPDEPLEHEEELFI |
| Ga0187817_100629764 | 3300017955 | Freshwater Sediment | FWRPLQKATALIQGIKVGLDLLRSRRGGNSRRDEPREQQEEELFI |
| Ga0187781_102115471 | 3300017972 | Tropical Peatland | HSFWRPMQKASALVQGIKVGLDLLRSRRGSSSRSDEPRESQEEELFI |
| Ga0187772_103984471 | 3300018085 | Tropical Peatland | QFKHSFWRPVQKASALVQGIKVGLDLLRSRRGSGSRSDEPRESQEEELFI |
| Ga0187771_118222132 | 3300018088 | Tropical Peatland | VEEAGSQFKHSFWRPMQKASALVQGIKVGLDLLRSRHSSGARSGEPRESQEEELFI |
| Ga0066662_115005592 | 3300018468 | Grasslands Soil | RPVQKASALVQGIKVGLDLLRSRRGRGSRRDDPREQQEEELFI |
| Ga0187797_12542781 | 3300019284 | Peatland | GSQFKHSVWRPMQKASALVQGIKVGLDLLRSRRGPGSRRDEPRESQEEELFI |
| Ga0173482_103790132 | 3300019361 | Soil | QKASALVQGIKVGLDLLRSRRAQAPRRDEATEQEEELFI |
| Ga0210403_111539361 | 3300020580 | Soil | LEAVEDAGGKFRQSFWRPMQKASALVQGIKVGLDLLRSRRKSGSRNDDPREQQEEELFI |
| Ga0210395_109435202 | 3300020582 | Soil | WKPLQKASALVQGIKVGLDLLRSRRAPSRRGDDSVEQEEELFI |
| Ga0210401_113795241 | 3300020583 | Soil | VQKVSAVLTGIKVGLDLLRSRRGGRSAHPDDPIGDEEELFI |
| Ga0179596_103045981 | 3300021086 | Vadose Zone Soil | QPVQKASALVQGIKVGLDLLRSRRRRPNGDEPREQQEEELFI |
| Ga0210406_101504523 | 3300021168 | Soil | VEDAGFKFKNSFWRPMQKASALVQGIKVGLDLLRSRRGKSDGEDPREQQEEELFI |
| Ga0210400_100216265 | 3300021170 | Soil | AGSKFKHNFWKPVQQASALVQGIKVGLDLLRSRRKRSSGRDEPREQQEEELFI |
| Ga0210400_108522622 | 3300021170 | Soil | SALMQGIKVGIDLLRSRRGNRRPEEPLEQEEELFI |
| Ga0210408_103438931 | 3300021178 | Soil | SFWRPMQKASALVQGIKVGLDLLRSRRKSGSRNDDPREQQEEELFI |
| Ga0210393_106915292 | 3300021401 | Soil | QFKSTVWRPMQKASALVQGIKVGLDLLRSRRERRRPDEPLEQEEELFI |
| Ga0210386_112821542 | 3300021406 | Soil | SFWRPVQKASALVQGIKVGLDILRSRRRRRSGDEPREQQEEELFI |
| Ga0210394_104353692 | 3300021420 | Soil | DAGSQFRSTVWRPMQKASALLQGIKVGLDLLRSRRASRNPDEPLEQEEELFI |
| Ga0210394_111433802 | 3300021420 | Soil | ASALVQGIKVGLDLLRSRRERRRPDEPLEQEEELFI |
| Ga0210402_103139362 | 3300021478 | Soil | SKFNHNFWRPVQKASALVQGIKVGLDLLRSRRGRSGGDEPREQQEEELFI |
| Ga0210402_107876882 | 3300021478 | Soil | SALVQGIKVGIDLLRARRERRRPDEPLEQEEELFI |
| Ga0210409_100806684 | 3300021559 | Soil | KPMQKASALVQGIKVGLDLLRSRRSRSRRSGDEPREQQEEELFI |
| Ga0210409_117033542 | 3300021559 | Soil | SHNVWRPVQKVSALMQGIKVGIDLLRARRGRRRPEEPLEQEEELFI |
| Ga0126371_122869242 | 3300021560 | Tropical Forest Soil | FWRPVQKASALVQGIKVGLDLLRSRRGPSTRRGDDERTEQEEELFI |
| Ga0213853_109030901 | 3300021861 | Watersheds | FSHSFWKPMQKASALVQGIKVGLDLLRSRRKPSSRGDEPREQQEEELFI |
| Ga0213853_112627332 | 3300021861 | Watersheds | MQKASALVQGIKVGLDLLRSRRKPSSRGDEPREQQEEELFI |
| Ga0247671_10241142 | 3300024284 | Soil | RPMQKASALVQGIKVGLDLLRSRRDRRRPDEPLEQEEELFI |
| Ga0247687_10060041 | 3300024286 | Soil | KASALVQGIKVGLDLLRSRRDRRRPDEPLEQEEELFI |
| Ga0179589_104815271 | 3300024288 | Vadose Zone Soil | RPVQKASALVQGIKVGLDILRSRRRRRQGDEPREQQEEELFI |
| Ga0247667_10194761 | 3300024290 | Soil | EAVEEAGSQFKHSFWRPMQKASALVQGIKVGIDLLRARRAPSARRDEAAEHEEELFI |
| Ga0247667_10506802 | 3300024290 | Soil | HSVWRPMQKASALVQGIKVGIDLLRARRGASPRRDEAAEHEEELFI |
| Ga0207671_113487151 | 3300025914 | Corn Rhizosphere | WRPVQKASALVQGIKVGLDLLRSRRAASPRRPDDETAEQEEELFI |
| Ga0209438_11262071 | 3300026285 | Grasslands Soil | KHSLWRPVQKASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI |
| Ga0209055_10048577 | 3300026309 | Soil | LVQGIKVGLDLLRSRRRGWDGRPDRRRSDEPREPQEEELFI |
| Ga0209055_12669472 | 3300026309 | Soil | FKNSFWSPVQKASALLQGIKVGLDLLRSRRRADGRPGHPRSDEPREPQEEELFI |
| Ga0209239_11595582 | 3300026310 | Grasslands Soil | PVQKASALVQGIKVGLDILRSRRRRRQGDEPREQQEEELFI |
| Ga0209153_10507122 | 3300026312 | Soil | LVQGIKVGLDLLRSRRRADGRPGHRRSDEPHEPQEEELFI |
| Ga0209268_10919592 | 3300026314 | Soil | HSFWRPMQKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI |
| Ga0209687_11496851 | 3300026322 | Soil | WRPVQKASALVQGIKVGLDLLRSRRSRSRGDEPREQQEEELFI |
| Ga0209152_102261072 | 3300026325 | Soil | QKASALVQGIKVGLDILRSRRRRRQGDEPREQQEEELFI |
| Ga0209057_10301611 | 3300026342 | Soil | DAGSQVKNSFWRPMHKASALVQGIKVGLDLLRSRRRGWDGRPDRRRSDEPREPQEEELFI |
| Ga0257150_10308671 | 3300026356 | Soil | WRPMHKVSALMQGIKVGIDLLRARRGRRRPEEPLEQEEELFI |
| Ga0257169_10840831 | 3300026469 | Soil | ALVQGIKVGLDLLRARRGATASSASQERSPEQEEELFI |
| Ga0257160_10108552 | 3300026489 | Soil | QFKQSFWKPVQRASALVQGIKVGLDLLRSRRAATQPDAQERSPEQEEELFI |
| Ga0257161_11059301 | 3300026508 | Soil | LWRPVQKASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI |
| Ga0209808_12242121 | 3300026523 | Soil | QGIKVGIDLLRSRRRGGDGRAERRRSDDPPREPQEEELFI |
| Ga0209376_13062002 | 3300026540 | Soil | QKASALLQGIKVGLDLLRSRRRGSDRRRGDEPREAQEEELFI |
| Ga0209805_12933011 | 3300026542 | Soil | FSHSFWRPVQKASALVQGIKVGLDLLRSRRRRRNSDDPREQQEEELFI |
| Ga0209648_105521952 | 3300026551 | Grasslands Soil | HSFWRPVQKASALVQGIKVGLDLLRSRRKRSRGGDEPREQQEEELFI |
| Ga0209648_106267592 | 3300026551 | Grasslands Soil | SFWRPVQKASALVQGFKVGLDLLRSRRGRSRGDEPREQQEEELFI |
| Ga0179593_11804493 | 3300026555 | Vadose Zone Soil | WRPMQKASALVQGIKVGIDLLRARRGPSSRRDEAAEHEEELFI |
| Ga0179587_102924771 | 3300026557 | Vadose Zone Soil | PVQKASALVQGIKVGLDLLRSRRRRKSGDEPREQQEEELFI |
| Ga0209179_10558422 | 3300027512 | Vadose Zone Soil | HSIWRPMHKASALVQGIKVGLDLLRSRRGRRNSDPSVEREEELFI |
| Ga0209388_11110811 | 3300027655 | Vadose Zone Soil | WRPVQKASALVQGIRVGLDLLRSRRSRRSGDEPREQQEEELFI |
| Ga0209011_10933392 | 3300027678 | Forest Soil | ASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI |
| Ga0209248_100069821 | 3300027729 | Bog Forest Soil | PMQKASALVQGIKVGLDLLRSRRGRRRPDEPLEQEEELFI |
| Ga0209248_100493342 | 3300027729 | Bog Forest Soil | ALLTGIKVGLDILRSRRATSGTVPPDETSEQEEELFI |
| Ga0209248_100741292 | 3300027729 | Bog Forest Soil | KASALVQGIKVGLDLLRSRRAPTRGGGGDDSVEQQEEELFI |
| Ga0209139_100961822 | 3300027795 | Bog Forest Soil | ASALLTGIKVGLDLLRSRRAASGTVPPDEPSEQQEEELFI |
| Ga0209773_103031992 | 3300027829 | Bog Forest Soil | ETVEDAGTQFKSTVWRPMQKASALLQGIKVGIDLLRSRRERRRPDEPLEQEEELFI |
| Ga0209180_100870901 | 3300027846 | Vadose Zone Soil | TSFWRPVRKASALVQGIKVGLDLLRSRRGRANPEEPLEHEEELFI |
| Ga0209180_104897802 | 3300027846 | Vadose Zone Soil | SKFKHSFWRPVQKASALVQGIKVGLDLLRSRRSRGSRRDDPREQQEEELFI |
| Ga0209701_104603542 | 3300027862 | Vadose Zone Soil | QKASALVQGIKVGLDLLRSRRKRRPGGEEPREQQEEELFI |
| Ga0209283_106754652 | 3300027875 | Vadose Zone Soil | QKASALVQGIKVGLDLLRSRRKRSRGGDEPREQQEEELFI |
| Ga0209590_100990921 | 3300027882 | Vadose Zone Soil | KFRDSFWRPVRKASALVEGIKVGLDLLRSRRRGSRGDDSREQREEELFI |
| Ga0268266_117874932 | 3300028379 | Switchgrass Rhizosphere | QSFWRPVQKASALVQGIKVGLDLLRSRRAPAPRRDEAAEQEEELFI |
| Ga0268266_122602321 | 3300028379 | Switchgrass Rhizosphere | AGTQFRQSFWRPVQKASALVQGIKVGLDLLRSRRAPAPRRHGDETAEQEEELFI |
| Ga0137415_100974151 | 3300028536 | Vadose Zone Soil | SFWRPVQKASALVQGIKVGLDLLRSRRGRRSGDEPREQQEEELFI |
| Ga0302306_104180302 | 3300030043 | Palsa | QPVRKASAFITGIKAGLDLLRARSARSQKSDGGGEPREQQEEELFI |
| Ga0307482_10529931 | 3300030730 | Hardwood Forest Soil | MQKASAIVQGIKVGLDLLRARRARRPDEPLEQEEELFI |
| Ga0170823_175667762 | 3300031128 | Forest Soil | QRASALVQGIKVGLDLLRSRRAATQPDAQERSPEQEEELFI |
| Ga0307469_102132301 | 3300031720 | Hardwood Forest Soil | QKASALVQGIKVGLDLLRSRRAPAPRRDEAAEQEEELFI |
| Ga0307469_102893361 | 3300031720 | Hardwood Forest Soil | KVSALMQGIKVGLDLLRSRRGGNRRRSEDPLEQEEELFI |
| Ga0307477_101057313 | 3300031753 | Hardwood Forest Soil | PMRKASALLQGIKVGIDLLRTRKSGGSRGDDSRESQEEELFI |
| Ga0307477_106549391 | 3300031753 | Hardwood Forest Soil | LVQGIKVGLDLLRSRRSRSRRSGDEPREQQEEELFI |
| Ga0307475_101828613 | 3300031754 | Hardwood Forest Soil | QGIKVGLDLLRSRRTATQPDAQERSSPEQEEELFI |
| Ga0307475_107179162 | 3300031754 | Hardwood Forest Soil | ALVQGIKVGLDLLRSRRSRSRRSGDEPREQQEEELFI |
| Ga0307473_108025921 | 3300031820 | Hardwood Forest Soil | HSFWRPVQKASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI |
| Ga0307478_101096711 | 3300031823 | Hardwood Forest Soil | LQGIKVGLDLLRSRRAGTQPDNQERSPEHEEELFI |
| Ga0306923_111696461 | 3300031910 | Soil | AGSQVKNSFWRPMHKASALVQGIKVGLDLLRSRRRGWDGRSERRRSDEPREPQEEELFI |
| Ga0310910_115523992 | 3300031946 | Soil | QKVSALVQGIRFGLDLLRSRRARQTGNEEPSPEQEEELFI |
| Ga0307479_101230583 | 3300031962 | Hardwood Forest Soil | AGSKFTHSVWRPVQKVSALMQGIKVGIDLLRARRGGRRRTEEPLEHEEELFI |
| Ga0307479_103174463 | 3300031962 | Hardwood Forest Soil | GALEALEDAGSQFRSSFWRPVQKVSALLQGIRVGIDLLRSRRGNSKSDEQREHEEELFI |
| Ga0307479_103594963 | 3300031962 | Hardwood Forest Soil | KFSHNVWRPVQKVSALMQGIKVGIDLLRARRGRRRPEEPLEQEEELFI |
| Ga0307479_113477861 | 3300031962 | Hardwood Forest Soil | FWRPVQKASALVQGIKVGLDLLRSRRRRRSGDEPREQQEEELFI |
| Ga0307479_118681832 | 3300031962 | Hardwood Forest Soil | FSHSFWRPVQKASALVQGIKVGLDLLRSRRRRRGSDEPREQQEEELFI |
| Ga0306922_120238141 | 3300032001 | Soil | LEALEDAGSQFKRGFWRPVQKASALIQGIKVGIDLLRSRRSKRPSSADEGMEQEEELFI |
| Ga0335085_1000119351 | 3300032770 | Soil | GSQFRHTVWKPMQKASALVQGIKVGLELLRAAQRRKRPDEPLEQEEELFI |
| Ga0334854_044093_931_1068 | 3300033829 | Soil | QPVKKASALLTGIKVGLDILRSRSAARSGSKPDEPLEQQEEELFI |
| ⦗Top⦘ |