| Basic Information | |
|---|---|
| Family ID | F021282 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 219 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGE |
| Number of Associated Samples | 179 |
| Number of Associated Scaffolds | 219 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.70 % |
| % of genes near scaffold ends (potentially truncated) | 96.35 % |
| % of genes from short scaffolds (< 2000 bps) | 84.93 % |
| Associated GOLD sequencing projects | 168 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.630 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.657 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.484 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.598 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 219 Family Scaffolds |
|---|---|---|
| PF02618 | YceG | 83.56 |
| PF03652 | RuvX | 7.31 |
| PF04389 | Peptidase_M28 | 5.02 |
| PF00809 | Pterin_bind | 1.37 |
| PF12704 | MacB_PCD | 0.46 |
| PF13561 | adh_short_C2 | 0.46 |
| PF16925 | TetR_C_13 | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 219 Family Scaffolds |
|---|---|---|---|
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 83.56 |
| COG0816 | YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factor | Translation, ribosomal structure and biogenesis [J] | 7.31 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.63 % |
| Unclassified | root | N/A | 1.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101289419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300002562|JGI25382J37095_10267274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300002911|JGI25390J43892_10000383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8420 | Open in IMG/M |
| 3300002915|JGI25387J43893_1048306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300004082|Ga0062384_101106375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300004091|Ga0062387_100021966 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
| 3300004092|Ga0062389_100183057 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300004092|Ga0062389_100587996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300004479|Ga0062595_102293484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300004635|Ga0062388_100515255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300005172|Ga0066683_10373432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300005180|Ga0066685_10764352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300005187|Ga0066675_10084390 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300005334|Ga0068869_100462653 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300005468|Ga0070707_101387055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300005555|Ga0066692_10138775 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300005561|Ga0066699_10053468 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300005598|Ga0066706_10047735 | All Organisms → cellular organisms → Bacteria | 2872 | Open in IMG/M |
| 3300005712|Ga0070764_10955933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005764|Ga0066903_100168584 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
| 3300005921|Ga0070766_10411030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300005921|Ga0070766_11212376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300005944|Ga0066788_10114760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300006755|Ga0079222_11073432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300006854|Ga0075425_102716512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300006893|Ga0073928_10835771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300006903|Ga0075426_11381485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300007076|Ga0075435_101617419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300007076|Ga0075435_101890794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300007255|Ga0099791_10270355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300007265|Ga0099794_10034593 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300007265|Ga0099794_10079153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300009038|Ga0099829_10035946 | All Organisms → cellular organisms → Bacteria | 3572 | Open in IMG/M |
| 3300009038|Ga0099829_11441052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300009038|Ga0099829_11447277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300009090|Ga0099827_10078921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2564 | Open in IMG/M |
| 3300009137|Ga0066709_103737623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300009137|Ga0066709_103928928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300009174|Ga0105241_12550043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300009661|Ga0105858_1136222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300010046|Ga0126384_10526108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300010046|Ga0126384_12231749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300010301|Ga0134070_10464892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010304|Ga0134088_10367251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300010326|Ga0134065_10134477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300010341|Ga0074045_10200612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1336 | Open in IMG/M |
| 3300010360|Ga0126372_11094924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300010361|Ga0126378_11168849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300010361|Ga0126378_12745357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 562 | Open in IMG/M |
| 3300010403|Ga0134123_11527721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300011120|Ga0150983_16201063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300011269|Ga0137392_11353713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300011270|Ga0137391_10898509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300011271|Ga0137393_10658401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300012189|Ga0137388_10518638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300012202|Ga0137363_11295380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300012203|Ga0137399_10917211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300012205|Ga0137362_10737256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300012205|Ga0137362_11403853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300012206|Ga0137380_11565388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300012207|Ga0137381_10418317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300012209|Ga0137379_10604342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300012210|Ga0137378_11140079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300012285|Ga0137370_10089436 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300012351|Ga0137386_10154922 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300012351|Ga0137386_10188706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
| 3300012357|Ga0137384_10826644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300012359|Ga0137385_11517373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300012361|Ga0137360_10654552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300012363|Ga0137390_10017188 | All Organisms → cellular organisms → Bacteria | 6602 | Open in IMG/M |
| 3300012363|Ga0137390_11644091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012363|Ga0137390_11943875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300012683|Ga0137398_10060683 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300012685|Ga0137397_10409433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300012685|Ga0137397_11251054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012918|Ga0137396_10488897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300012922|Ga0137394_10602816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300012923|Ga0137359_10362520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1288 | Open in IMG/M |
| 3300012925|Ga0137419_11000102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300012925|Ga0137419_11563350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012927|Ga0137416_10997432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300012927|Ga0137416_11517886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300012930|Ga0137407_10799371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300012944|Ga0137410_10433300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300012960|Ga0164301_10288750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300012975|Ga0134110_10052801 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300012976|Ga0134076_10540662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300014150|Ga0134081_10029000 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300014157|Ga0134078_10061555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
| 3300014166|Ga0134079_10360839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300015053|Ga0137405_1152965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1087 | Open in IMG/M |
| 3300015054|Ga0137420_1410915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4173 | Open in IMG/M |
| 3300015241|Ga0137418_10630972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300015245|Ga0137409_10651320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300015357|Ga0134072_10011751 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300015371|Ga0132258_10386175 | All Organisms → cellular organisms → Bacteria | 3474 | Open in IMG/M |
| 3300016357|Ga0182032_10401226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300016422|Ga0182039_10180145 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300016422|Ga0182039_11824760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300016445|Ga0182038_10271164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
| 3300016750|Ga0181505_10685107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300017823|Ga0187818_10233180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300017936|Ga0187821_10482661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300017961|Ga0187778_10128994 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300017974|Ga0187777_11469952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300017975|Ga0187782_11551216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300017993|Ga0187823_10201451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300018006|Ga0187804_10172299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300018012|Ga0187810_10405035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300018012|Ga0187810_10484559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300018060|Ga0187765_10194051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300018086|Ga0187769_10945205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300018086|Ga0187769_10974694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300018088|Ga0187771_10995419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300019788|Ga0182028_1433381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1984 | Open in IMG/M |
| 3300019888|Ga0193751_1244575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300020021|Ga0193726_1069467 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300020150|Ga0187768_1027217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300020170|Ga0179594_10367165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300020170|Ga0179594_10417601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300020579|Ga0210407_10605100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300020579|Ga0210407_11152531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300020580|Ga0210403_11084064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300020582|Ga0210395_11170773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300020583|Ga0210401_10459552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300021046|Ga0215015_10722101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300021088|Ga0210404_10753044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300021170|Ga0210400_10381905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300021170|Ga0210400_10555421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300021170|Ga0210400_11333880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300021178|Ga0210408_11200123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300021403|Ga0210397_11466182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021404|Ga0210389_10398400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300021405|Ga0210387_10497313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300021432|Ga0210384_10090711 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300021432|Ga0210384_10162098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2008 | Open in IMG/M |
| 3300021433|Ga0210391_10588858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300021474|Ga0210390_11309374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300021475|Ga0210392_10003535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8098 | Open in IMG/M |
| 3300021475|Ga0210392_10817084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300021559|Ga0210409_10567846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300021559|Ga0210409_10714555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300021560|Ga0126371_12687192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300022724|Ga0242665_10040034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300024224|Ga0247673_1046097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300024251|Ga0247679_1000588 | All Organisms → cellular organisms → Bacteria | 6744 | Open in IMG/M |
| 3300024288|Ga0179589_10399504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300024330|Ga0137417_1086915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300025454|Ga0208039_1047865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300025898|Ga0207692_10545981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300025906|Ga0207699_10408976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300025922|Ga0207646_11332672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300025922|Ga0207646_11687242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300026277|Ga0209350_1118337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300026298|Ga0209236_1321597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300026301|Ga0209238_1016313 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
| 3300026301|Ga0209238_1220846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300026376|Ga0257167_1057882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300026515|Ga0257158_1101162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300026527|Ga0209059_1198157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300026530|Ga0209807_1257833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300026538|Ga0209056_10065818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3139 | Open in IMG/M |
| 3300026551|Ga0209648_10069768 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300026557|Ga0179587_10940946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300027535|Ga0209734_1122538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300027567|Ga0209115_1028165 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300027646|Ga0209466_1130983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300027651|Ga0209217_1190974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300027671|Ga0209588_1116669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300027671|Ga0209588_1123009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300027678|Ga0209011_1160891 | Not Available | 627 | Open in IMG/M |
| 3300027857|Ga0209166_10533416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300027875|Ga0209283_10202723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
| 3300028536|Ga0137415_10657065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300028884|Ga0307308_10336146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300028906|Ga0308309_10141664 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300030848|Ga0075388_11323797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031057|Ga0170834_104941941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3310 | Open in IMG/M |
| 3300031231|Ga0170824_122905146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031233|Ga0302307_10036817 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300031715|Ga0307476_10415451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300031715|Ga0307476_10916104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300031715|Ga0307476_11343439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300031718|Ga0307474_10689103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300031720|Ga0307469_10127572 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300031720|Ga0307469_11319643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300031744|Ga0306918_10045230 | All Organisms → cellular organisms → Bacteria | 2891 | Open in IMG/M |
| 3300031753|Ga0307477_10096090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2058 | Open in IMG/M |
| 3300031754|Ga0307475_10238532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300031754|Ga0307475_10581453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300031799|Ga0318565_10068131 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300031820|Ga0307473_10473626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300031893|Ga0318536_10081392 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300031910|Ga0306923_10251773 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300031910|Ga0306923_10304277 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300031910|Ga0306923_10777278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300031910|Ga0306923_12129685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300031912|Ga0306921_10011068 | All Organisms → cellular organisms → Bacteria | 9626 | Open in IMG/M |
| 3300031912|Ga0306921_12634960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031954|Ga0306926_10453276 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300031962|Ga0307479_10193847 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300031962|Ga0307479_10338261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1488 | Open in IMG/M |
| 3300031962|Ga0307479_10833525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300032001|Ga0306922_10023911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6135 | Open in IMG/M |
| 3300032064|Ga0318510_10376606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 602 | Open in IMG/M |
| 3300032068|Ga0318553_10265439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300032076|Ga0306924_10697072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300032160|Ga0311301_12852258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300032180|Ga0307471_101283182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300032180|Ga0307471_102407358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300032205|Ga0307472_101007657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300032261|Ga0306920_100084715 | All Organisms → cellular organisms → Bacteria | 4668 | Open in IMG/M |
| 3300032783|Ga0335079_10933810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300032898|Ga0335072_10683723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300033158|Ga0335077_10643828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300033289|Ga0310914_10760852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300033290|Ga0318519_10080276 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.07% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.11% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.46% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.46% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.46% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.46% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.46% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.46% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1012894192 | 3300000364 | Soil | MTELLQTKKAMILRAAAAIGAEKWTPAEIEQLRRK |
| JGI25382J37095_102672742 | 3300002562 | Grasslands Soil | MNEEAKTKKSLILETAREIKVEKWTPAEIDQLRRRLVAEHGEAGKTG |
| JGI25390J43892_100003831 | 3300002911 | Grasslands Soil | MTEDLKSKKALILEAAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGMEYI |
| JGI25387J43893_10483062 | 3300002915 | Grasslands Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGK |
| Ga0062384_1011063752 | 3300004082 | Bog Forest Soil | MSDAEKSKKDLILDTAREIGASKWTLAEIDQLRRRLHAEHGEAGKTSSEYI |
| Ga0062387_1000219664 | 3300004091 | Bog Forest Soil | MTEGPQTKKALILEAARQLGLQKWTTAEVDQLRRKLLADHGEVGKSTNDYI |
| Ga0062389_1001830574 | 3300004092 | Bog Forest Soil | VTNDSLKTKKEMIIETARAIGVQKWTPAEIDQLRRRMLAEHGEEGKTGS |
| Ga0062389_1005879961 | 3300004092 | Bog Forest Soil | MNESLRTKKELILETAREIGAQRFTLAEIDQLRRRLIAEHGEDGKTGND |
| Ga0062595_1022934841 | 3300004479 | Soil | MSDLLRTKKELILETAREIGAQTYTPAEIDQLRRRLIAEH |
| Ga0062388_1005152552 | 3300004635 | Bog Forest Soil | VTDEAKTKKALIVETARELGLQTWTSAEIDQLRRRLIAEHGEAGKTGNEY |
| Ga0066683_103734321 | 3300005172 | Soil | MTEGLKTKKALILQTAREINVQKWTPAEIDQLRRRLVAEHGEAGK |
| Ga0066685_107643522 | 3300005180 | Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHG |
| Ga0066675_100843901 | 3300005187 | Soil | MTEDLKSKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGMEYIA |
| Ga0068869_1004626531 | 3300005334 | Miscanthus Rhizosphere | MSEILQSKKAMILRAAAAIGAEKWTPAEIEQLRRKLLAEHG |
| Ga0070707_1013870551 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEEAKTKKSLILDTAREIKVEKWTPAEIDQLRRRLVAEHGEAGKTGS |
| Ga0066692_101387751 | 3300005555 | Soil | MNEEAKTKKSLILETAREIKVEKWTPAEIDQLRRRLV |
| Ga0066699_100534681 | 3300005561 | Soil | MSDALRTKKELILETAREIGAQTYTPAEIDQLRRRLIAEYGEDGKTGNDYIAD |
| Ga0066706_100477354 | 3300005598 | Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGMEYIADVL |
| Ga0070764_109559332 | 3300005712 | Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLQAEHGEA |
| Ga0066903_1001685841 | 3300005764 | Tropical Forest Soil | MSEVLQTKKAMILRAAAAIGVEKWTPAEIEQLRRKLLA |
| Ga0070766_104110302 | 3300005921 | Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLQAEHG |
| Ga0070766_112123762 | 3300005921 | Soil | MTEGLHTKKATILEAARELGHQKWTTAEIDQLRRKLIA |
| Ga0066788_101147601 | 3300005944 | Soil | MNDPGNTKKALILETARRIGVQKWTPAEIDQLRRRLIAEHGEAGK |
| Ga0079222_110734321 | 3300006755 | Agricultural Soil | MTEDLKSKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKT |
| Ga0075425_1027165122 | 3300006854 | Populus Rhizosphere | MSGALETKKAMILRAAAAIGAEKWTPAEIDQLRRKLLADHGSEGKTGS |
| Ga0073928_108357711 | 3300006893 | Iron-Sulfur Acid Spring | MTDSDKSKKDLILETAREIGASKWTLAEIDQLRRRLHAEHGEE |
| Ga0075426_113814852 | 3300006903 | Populus Rhizosphere | MSDLLRTKRELILETAREIGAQTYTPAEIDQLRRRLIAEH |
| Ga0075435_1016174191 | 3300007076 | Populus Rhizosphere | MTDELKTKKEMILDTARSMGIQRWTTAEIDQLRRKLLSEH |
| Ga0075435_1018907941 | 3300007076 | Populus Rhizosphere | MSEVLQTKKAMILRAAAAIGAEKWTPAEIEQLRRKL |
| Ga0099791_102703552 | 3300007255 | Vadose Zone Soil | MSEEAKTKKLLILDTAREIKVEKWTPAEIDQLRRRLVAEHG |
| Ga0099794_100345931 | 3300007265 | Vadose Zone Soil | MSEEAKTKKLLILDTAREIKVEKWTPAEIDQLRRRLVAEHGEAGKTGSD |
| Ga0099794_100791533 | 3300007265 | Vadose Zone Soil | MTEILETKKAMILRAAAAIGAEKWTPAEIDQLRRKLLADHGAEGK |
| Ga0099829_100359461 | 3300009038 | Vadose Zone Soil | MNETLKTKKDMILEAARQIAASKWTPAEIDQLRRRLVAEH |
| Ga0099829_114410521 | 3300009038 | Vadose Zone Soil | MTESLKTKKSLILETAREIAASKWTPAEIDQLRRRLVAEHGET |
| Ga0099829_114472772 | 3300009038 | Vadose Zone Soil | MTEGLKTKKALILETAREINVQKWTPAEIDQLRRRLVAEHGEAGK |
| Ga0099827_100789211 | 3300009090 | Vadose Zone Soil | MNDHLKTKKALILETAREIKVQQWTPAEIDQLRRRLVAEHGDAGKA |
| Ga0066709_1037376232 | 3300009137 | Grasslands Soil | MTEGLKTKKALILQTAREINVQKWTPAEIDQLRRRLVA |
| Ga0066709_1039289281 | 3300009137 | Grasslands Soil | MSEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTEME |
| Ga0105241_125500431 | 3300009174 | Corn Rhizosphere | MSDSLRTKKELILETARKIGAQTYTPAEIDQLRRRLIAEH |
| Ga0105858_11362222 | 3300009661 | Permafrost Soil | MNDPSNTKKSLILEAARRIGVQKWTPAEIAQLRRRLIVEHGEAGK |
| Ga0126384_105261081 | 3300010046 | Tropical Forest Soil | MNQDPKTKKALILETAREINAQKWTPAEIDQLRRRLLAEHGE |
| Ga0126384_122317491 | 3300010046 | Tropical Forest Soil | MSDPLHTKKELILQTAREIGAQTYTPAELDQLRRRLIAEHGEEGKTGNDYIADV |
| Ga0134070_104648922 | 3300010301 | Grasslands Soil | MTDTLKTKKAMILDAAQAIGAERFTPAEIEQLRRKLLAE |
| Ga0134088_103672512 | 3300010304 | Grasslands Soil | MTDTLKTKKAMILDAAQAIGAERFTPAEIEQLRRK |
| Ga0134065_101344771 | 3300010326 | Grasslands Soil | MTEDLKSKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAG |
| Ga0074045_102006121 | 3300010341 | Bog Forest Soil | MTEISRTKKEMIAETAREMGIQKWSTAEVDQLRRKLQAQHGEAGKTSN |
| Ga0126372_110949242 | 3300010360 | Tropical Forest Soil | MSEVLQTKKAMILRAAAAIGAEKWTPAEIEQLRRKLL |
| Ga0126378_111688492 | 3300010361 | Tropical Forest Soil | MSEALKTKKTLILQAAREIGAPRFTAAEIEQLRRRLIAQYGEEGKTGSEYIAEVLKG |
| Ga0126378_127453572 | 3300010361 | Tropical Forest Soil | MTQLLKNKKALILETAREINAQKWTPAEIEQLRLRLLAEHGE |
| Ga0134123_115277212 | 3300010403 | Terrestrial Soil | MTDSQKSKKDLILETAREIGASKWTLAEIDQLRRRILAE |
| Ga0150983_162010631 | 3300011120 | Forest Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLHAEH |
| Ga0137392_113537132 | 3300011269 | Vadose Zone Soil | MTEALETKKAMILRAAAAIGAEKWTAAEIDQLRRKLLADHGAEGKTGS |
| Ga0137391_108985092 | 3300011270 | Vadose Zone Soil | MTEALETKKAMILRAAAAIGAEKWTAAEIDQLRRKLLADHGAEG |
| Ga0137393_106584011 | 3300011271 | Vadose Zone Soil | MSEDLKTKKALILETAREIKVQQWTPAEIDQLRRRL |
| Ga0137388_105186382 | 3300012189 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLMAEHG |
| Ga0137363_112953802 | 3300012202 | Vadose Zone Soil | MTETLETKKAMILRAAAAIGAERWTPAEIDQLRRKLLA |
| Ga0137399_109172111 | 3300012203 | Vadose Zone Soil | MSEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEA |
| Ga0137362_107372561 | 3300012205 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAELDQLRRRL |
| Ga0137362_114038531 | 3300012205 | Vadose Zone Soil | MTETLETKKAMILRAAAAIGAERWTPAEIDQLRRKLLADHGAEGKT |
| Ga0137380_115653881 | 3300012206 | Vadose Zone Soil | MTEGLKTKKALILKTAREINVQKWTPAEIDQLRRRLVAEHGEAGKTGSDYIADV |
| Ga0137381_104183172 | 3300012207 | Vadose Zone Soil | MTQDLKNKKALILETAREINAQKWTPAEIEQLRLRLLAEHGD |
| Ga0137379_106043421 | 3300012209 | Vadose Zone Soil | MTEGLKTKKALILKTAREINVQKWTPAEIDQLRRRLVAE |
| Ga0137378_111400792 | 3300012210 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGMEYI |
| Ga0137377_105809831 | 3300012211 | Vadose Zone Soil | MTEILETKKAMILRAAAAIGAEKWTPAEIDQLRRKLLADHGAEGKTGSDYIA |
| Ga0137370_100894363 | 3300012285 | Vadose Zone Soil | MTEDLKAKKALILEAAREIKVQQWTPAEIDQLRRRLLAE |
| Ga0137386_101549221 | 3300012351 | Vadose Zone Soil | MNDHLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGDAGKAGPDYIAD |
| Ga0137386_101887063 | 3300012351 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLMAEHGEAG |
| Ga0137384_108266442 | 3300012357 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAG |
| Ga0137385_115173732 | 3300012359 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEYGEAGKAGSDYIAD |
| Ga0137360_106545521 | 3300012361 | Vadose Zone Soil | MNEEAKTKKSLILDTAREIKVEKWTPAEIDQLRRRLVAEH |
| Ga0137390_100171881 | 3300012363 | Vadose Zone Soil | MTEALETKKAMILRAAAAIGAEKWTAAEIDQLRRKLLADHGA |
| Ga0137390_116440911 | 3300012363 | Vadose Zone Soil | MTEALETKKAMILRAAAAIGAEKWTAAEIDQLRRKLLADHGAEGKTSSD |
| Ga0137390_119438751 | 3300012363 | Vadose Zone Soil | MTEGLKTKKALILETAREINVQKWTPAEIDQLRRRLVAEHGEAGKT |
| Ga0137398_100606834 | 3300012683 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGSDYIAD |
| Ga0137397_104094331 | 3300012685 | Vadose Zone Soil | MSEDLKTKKALILETAREIKMQQWTPAEIDQLQRRLLAEHGEAGKTG |
| Ga0137397_112510541 | 3300012685 | Vadose Zone Soil | MTEILETKKAMILRAAAAIGAEKWTPAEIDQLRTD |
| Ga0137396_104888972 | 3300012918 | Vadose Zone Soil | MSEDLKTKALILETAREIKVQQWTPAEIDQLRRRLVAEHGEAGK |
| Ga0137394_106028161 | 3300012922 | Vadose Zone Soil | MNEEAKTKKSLILDTAREIKVEKWTPAEIDQLRRRLIAEHGEAGKTGSDY |
| Ga0137359_103625202 | 3300012923 | Vadose Zone Soil | MNEEAKTKKALILDTAREIKVEKWTPAEIDQLRRRLLAE |
| Ga0137419_110001022 | 3300012925 | Vadose Zone Soil | MSEEAKTKKLLILDTAREIKVEKWTPAEIDQLRRRLVAEH |
| Ga0137419_115633501 | 3300012925 | Vadose Zone Soil | MNEEAKTKKLLILDTAREIKVEKWTPAEIDQLRRRLVAEHGEA |
| Ga0137416_109974322 | 3300012927 | Vadose Zone Soil | MNEEAKTKKALILDTAREIKVEKWTPAEIDQLRRRLLAEHG |
| Ga0137416_115178861 | 3300012927 | Vadose Zone Soil | MNEEAKTKKSLILETAREIKVEKWTPAEIDQLRRR |
| Ga0137407_107993712 | 3300012930 | Vadose Zone Soil | MTEDHKTKKALILETAREIGAEKWTAAEIDQLRRRMIAE |
| Ga0137410_104333002 | 3300012944 | Vadose Zone Soil | MSEEAKTKKLLILDTAREIKVEKWTPAEIDQLRRRLVAEHGEAGK |
| Ga0164301_102887502 | 3300012960 | Soil | MTEDNKTKKALILETAREIGAEKWTAAEIDQLRRRMIAEHGE |
| Ga0134110_100528013 | 3300012975 | Grasslands Soil | MTEEHKTKKALILETAREIGAEKWTAAEIDQLRRRMIAEHGEEAKTGAD |
| Ga0134076_105406622 | 3300012976 | Grasslands Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLMAEHGEAG* |
| Ga0134081_100290001 | 3300014150 | Grasslands Soil | MTEDLKSKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEA |
| Ga0134078_100615551 | 3300014157 | Grasslands Soil | MNQALKNKKALILETAREINAPKWTPAEIEQLRLR |
| Ga0134079_103608391 | 3300014166 | Grasslands Soil | MTEILETKKAMILRAAAAIGADKWTPAEIDQLRRKLLADHGSEGKTGSDY |
| Ga0137405_11529652 | 3300015053 | Vadose Zone Soil | MNEEAKTKKSLILDTAREIKVEKWTPAEIDQLRRRLIAEH |
| Ga0137420_14109158 | 3300015054 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTEWNTLPTC* |
| Ga0137418_106309721 | 3300015241 | Vadose Zone Soil | MTEDHKTKKALILETAREIGAEKWTAAEIDQLRRKMIAEHGEEAK |
| Ga0137409_106513202 | 3300015245 | Vadose Zone Soil | MSEEAKTKKLLILDTAREIKVEKWTPAEIDQLRRRLVAE |
| Ga0134072_100117511 | 3300015357 | Grasslands Soil | MNQALKNKKVLILETAREINAQKWTPAEIEQLRLRLLAEHGEAGKTGPEY |
| Ga0132258_103861751 | 3300015371 | Arabidopsis Rhizosphere | MTEVMQTKKAMILRAAAAIGAEKWTPAEIEQLRRKLLADH |
| Ga0182032_104012263 | 3300016357 | Soil | MTEQNQLKTKKALILEAARDLGHQKWTTAEIDQLRRKLIADHG |
| Ga0182039_101801453 | 3300016422 | Soil | MTQGLKNKKAMILETAREINVQKWTPAEIEQLRLRLLAEHGEAGKTGTEYI |
| Ga0182039_118247601 | 3300016422 | Soil | MTDELKTKKEMILSTARSMGIQRWTTAEIDQLRRKLLAEH |
| Ga0182038_102711642 | 3300016445 | Soil | MTQGLKNKKAMILETAREINAQKWTPAEIEQLRLRLLA |
| Ga0181505_106851072 | 3300016750 | Peatland | MTEALHTKKALILEAARQLGHQKWTTAEIDQLRRKLVADHGDAGKT |
| Ga0187818_102331802 | 3300017823 | Freshwater Sediment | MTEGPHTKKELIVEAARQLGVQKWSTAEIDQLRRK |
| Ga0187821_104826611 | 3300017936 | Freshwater Sediment | MTESLKTKKLLILETAREIAATKWTPAEIDQLRRRLVAEHGETGKTGSEYIAD |
| Ga0187778_101289941 | 3300017961 | Tropical Peatland | MTQDLKTKKVLILETAREINVQKWTPAEIDQLRRRLLAEHGETGKT |
| Ga0187777_114699522 | 3300017974 | Tropical Peatland | MTEGLQTKKAMILEAARELGIQKWSTAEVEQLHRKLVADHGAAG |
| Ga0187782_115512162 | 3300017975 | Tropical Peatland | MTEGSNSKKAMILEAARQLGHQKWSTAEVDQLRRKLIADHGEVGK |
| Ga0187823_102014511 | 3300017993 | Freshwater Sediment | MTDSQKSKKDLILETARAIGASRWTLAEIDQLRRRIHAEHGEAGKTSSEYI |
| Ga0187804_101722992 | 3300018006 | Freshwater Sediment | MTEALKTKKAMILEAARELSIEKWTTAEIDQLRRK |
| Ga0187810_104050352 | 3300018012 | Freshwater Sediment | MTQDLKTKKALILETAREINVQKWTPAEIDQLRRRLLAEHGEAGKTGSD |
| Ga0187810_104845591 | 3300018012 | Freshwater Sediment | MSESLRTKKELILETAREIGAQRFTPAEIDQLRRRLIAEHGEE |
| Ga0187765_101940511 | 3300018060 | Tropical Peatland | MTDALQTKKAMILEAARELGIQRWTTAEIDQLRRKL |
| Ga0187769_109452052 | 3300018086 | Tropical Peatland | MTEALKTKKALILEAARELSIERWTTAEIEQLRRKLIAEHGEEGKS |
| Ga0187769_109746941 | 3300018086 | Tropical Peatland | MSTELKNKKALILETAREINVQSWTPAEIDQLRRRLVAEHGEAGKTGSD |
| Ga0187771_109954191 | 3300018088 | Tropical Peatland | MMDDSKTKKNMILEAARAIGVQKWTPAEIDQLRRKLLADHG |
| Ga0187770_102963722 | 3300018090 | Tropical Peatland | MMHELKTKKNLIVEAARQLGIQKWTPAEIDQLRRKLLAQHGETGKTGNDY |
| Ga0182028_14333814 | 3300019788 | Fen | MMDELKTKKKLILEAARAIGVQKWTPAEIDQLRRKLLADHGEAEKRE |
| Ga0193751_12445751 | 3300019888 | Soil | MTEALETKKAMILRAAAAIGAEKWTAAEIDQLRRKLLADHGAEGKT |
| Ga0193726_10694673 | 3300020021 | Soil | MNDPSNTKKSLILETARRIGVQKWTPAEIDQLRRRLIAEHGEAGKT |
| Ga0187768_10272171 | 3300020150 | Tropical Peatland | MTEVTRTKKEMILNAARELGLQKWSTAEIDQLRRKLIAAHGEAGK |
| Ga0179594_103671652 | 3300020170 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGSDYIADV |
| Ga0179594_104176012 | 3300020170 | Vadose Zone Soil | MNEPSTTKKALILETARRIGVQKWTPAEIDQLRRRLIAEHGEAGKTGAEYI |
| Ga0210407_106051001 | 3300020579 | Soil | MTEDLKTKKALILDTAREIKVEKWTPAEIDQLRRR |
| Ga0210407_111525312 | 3300020579 | Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLQA |
| Ga0210403_110840641 | 3300020580 | Soil | MNESLKTKKELILQAAREIGAQQFTPAEIDQLRRRL |
| Ga0210395_111707731 | 3300020582 | Soil | MSEDLKTKKTLILDTAREIKVEKWTPAEIDQLRRRLIAEHGEAGKTGP |
| Ga0210401_104595522 | 3300020583 | Soil | MSEMLRTKKEMILQTAREIGAQRYTIAEIDQLRRRLLAEYGEEGKTASDYI |
| Ga0215015_107221012 | 3300021046 | Soil | MNESLKTKKVLILDTAREIAATKWTPAEIEQLRLSLIHI |
| Ga0210404_107530441 | 3300021088 | Soil | MNESLKTKKSLILETAREIGAGKWTPAEIDQLRRRLVAEHGETGKTGS |
| Ga0210400_103819052 | 3300021170 | Soil | MNESSNTKKSLILQTAREIGVQKWTPAEIDQLRRR |
| Ga0210400_105554211 | 3300021170 | Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLHAEHGEAGKTS |
| Ga0210400_113338802 | 3300021170 | Soil | MSDMSDSQTTKKELILQTAREIGAQQYTPAEIDQLRRKLIAE |
| Ga0210408_112001232 | 3300021178 | Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLQAEHGEAGKTS |
| Ga0210397_114661822 | 3300021403 | Soil | MSDMSDSQTTKKELILQTAREIGAQQYTPAEIDQLRRKL |
| Ga0210389_103984002 | 3300021404 | Soil | MSDPQTTKKDLILQAAREIGAQQYTPAEIDQLRRRLIAEFGEDGKTGNDYIADV |
| Ga0210387_104973132 | 3300021405 | Soil | VTNDSLKTKKEMILETARAIGVQKWTPAEIDQLRRRMLAEHGEEGK |
| Ga0210384_100907111 | 3300021432 | Soil | MNESVKTKKELILQTAREIGAQQFTPAEIDQLRRRLLAEHGEEG |
| Ga0210384_101620981 | 3300021432 | Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLVAE |
| Ga0210391_105888581 | 3300021433 | Soil | MTEDLKTKKTLILDTAREIKVEKWTPAEIDQLRRRLVAEYGE |
| Ga0210390_113093741 | 3300021474 | Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLHAEHGEAGK |
| Ga0210392_100035351 | 3300021475 | Soil | MTDELKTKKEMILSTARSMGIQRWATAEIDQLRRKLLAEHGEHVK |
| Ga0210392_108170841 | 3300021475 | Soil | MTEDLKTKKTLILDTAREIKVEKWTPAEIDQLRRRLVAEYGEAGKTGPD |
| Ga0210409_105678461 | 3300021559 | Soil | MTDDLKTKKALILETAREIKVEQWTPAEIDQLRRRLLAEHGEA |
| Ga0210409_107145551 | 3300021559 | Soil | MSESLKTKKELILQAARQISAQNWTPAEIDQLRRRLIAEHGETAKTGTDYI |
| Ga0126371_126871921 | 3300021560 | Tropical Forest Soil | MNDSQKTKKELILQAARQISAQSWTPAEIDQLRRRLIAEHGEA |
| Ga0242665_100400341 | 3300022724 | Soil | MTDDSKTKKALILDTAREIKVEKWTPAEIDQLRRRLIA |
| Ga0247673_10460971 | 3300024224 | Soil | MTEDNKTKKALILETAREIGAEKWTAAEIDQLRRKMIAEHGEEA |
| Ga0247679_10005886 | 3300024251 | Soil | MTDSQKSKKDLILETAREIGASKWTLAEIDQLRRRILAEHGEAGKTSSEYIG |
| Ga0179589_103995041 | 3300024288 | Vadose Zone Soil | MTDELKTKKAMILETAHEIGAEKWTPAEIDQLRRK |
| Ga0137417_10869152 | 3300024330 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLVAEHGEAGKTGMEYIADV |
| Ga0208039_10478652 | 3300025454 | Peatland | MMDDLKTKKNLILEAARAIGVQKWTPAEIDQLRRKLLAEHGEAGKTS |
| Ga0207692_105459811 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDELKTKREMILSTARSMGIQRWATAEIDQLRRKLLAEYGE |
| Ga0207699_104089761 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSQTTKKELILQTAQEIGAQQYTPAEIDQLRRRLIAEHGEDGKTGNE |
| Ga0207646_113326721 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEVLQTKKAMILRAAAAIGAERWTPAEIDQLRRKLLADHG |
| Ga0207646_116872421 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTESLKTKKALILETAREIAASKWTPAEIDQLKRRL |
| Ga0209350_11183371 | 3300026277 | Grasslands Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLA |
| Ga0209236_13215971 | 3300026298 | Grasslands Soil | MMEELKTKKALILETAQEIGAQNWTPAEIDQLRRR |
| Ga0209238_10163131 | 3300026301 | Grasslands Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGMEY |
| Ga0209238_12208461 | 3300026301 | Grasslands Soil | MTEDLKSKKALILETAREIKVQQWTPAEIDQLRRRLL |
| Ga0257167_10578822 | 3300026376 | Soil | MNESVKTKKALILDTAREIAATKWTAAEIEQLRRRLLA |
| Ga0257158_11011622 | 3300026515 | Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLVAEHGEAGKTGMEYIADVL |
| Ga0209059_11981572 | 3300026527 | Soil | MTEDLKSKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGMEY |
| Ga0209807_12578331 | 3300026530 | Soil | MTEDLKSKKALILEAAREIKVQQWTPAEIDQLRRR |
| Ga0209056_100658181 | 3300026538 | Soil | MTETLETKKAMILRAAAAIGAERWTPAEIDQLRRKLLADHGAE |
| Ga0209648_100697681 | 3300026551 | Grasslands Soil | MSEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLVAE |
| Ga0179587_109409462 | 3300026557 | Vadose Zone Soil | MTEDLKTKKSLILETAREIKVQQWTPAEIDQLRRRLLA |
| Ga0209734_11225382 | 3300027535 | Forest Soil | MNESSNTKKSLILQTARQIGVQTWTPAEIDQLRRRLIAEHGEAG |
| Ga0209115_10281652 | 3300027567 | Forest Soil | MTDSDKSKKDLILETAREIGASKWTLAEIDQLRRQFGASW |
| Ga0209466_11309833 | 3300027646 | Tropical Forest Soil | MSEVLQTKKAMILRAAAAIGAEKWTPAEIEQLRRKLLAEHGAEGK |
| Ga0209217_11909742 | 3300027651 | Forest Soil | VTDEPKTKKVLIVETARELGLQNWTSAEIDQLRRRLIAEHGEAGK |
| Ga0209588_11166692 | 3300027671 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLVAEHGEAGKT |
| Ga0209588_11230092 | 3300027671 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRRLAE |
| Ga0209011_11608912 | 3300027678 | Forest Soil | MSEMLRTKKEMILQTAREIGAQRYTLAEIDQLRRRLLAEYGEEG |
| Ga0209166_105334161 | 3300027857 | Surface Soil | MTEDNKTKKALILETAREIGAEKWTAAEIDQLRRRMIAEHGEEAKTG |
| Ga0209283_102027231 | 3300027875 | Vadose Zone Soil | MTEDLKTKKALILETAREIKVEQWTPAEIDQLRRRLVA |
| Ga0137415_106570652 | 3300028536 | Vadose Zone Soil | MNESVKTKKALILDTAREIAATKWTAAEIEQLRRRLLAEHGEAGKTGSDY |
| Ga0307308_103361462 | 3300028884 | Soil | MTEDLKTKKALILEAAREIKVQQWTPAEIDQLRRRLLAEHGE |
| Ga0308309_101416641 | 3300028906 | Soil | MTEELKTKKALILETARELNVQTWTTAEVDQLRRRLIAEHG |
| Ga0075388_113237971 | 3300030848 | Soil | MTDELKTKKEMILRTARSMGIQRWATAEIDQLRRKLLAEHGEHGKTGND |
| Ga0170834_1049419412 | 3300031057 | Forest Soil | MNESSNTKKSLILQAARQIGVQKWTPAEIDQLRRRLIAEHGEAGKTGSDTSSMFWKPLA |
| Ga0170824_1229051461 | 3300031231 | Forest Soil | MSDSQKTKKELILQTAREIGAQQFTMAEIDQLRRRLIAEHGEEGKT |
| Ga0302307_100368174 | 3300031233 | Palsa | MNDALKTKKALILQAAQEVGAQSFTIAEIDQLRRKLIAEHGEEGKTG |
| Ga0307476_104154512 | 3300031715 | Hardwood Forest Soil | MSDMSDSQTTKKELILQTAREIGAQQYTPAEIDQLRRRLIAEHGEDGRTG |
| Ga0307476_109161041 | 3300031715 | Hardwood Forest Soil | MSDPQMTKKELILQVAHEIGAQQYTPAEIDQLRRRLFAEFGEDGKT |
| Ga0307476_113434391 | 3300031715 | Hardwood Forest Soil | MTEVLHTKKAMILRAAAAIGAEKWTPAEIDQLRRKL |
| Ga0307474_106891032 | 3300031718 | Hardwood Forest Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLL |
| Ga0307469_101275721 | 3300031720 | Hardwood Forest Soil | MNESQKTKKELILQAARQISAQSWTPAEIDQLRRRLIAEHGEAAKTG |
| Ga0307469_113196431 | 3300031720 | Hardwood Forest Soil | MTETLETKKAMILRAAAAIGAERWTAAEIDQLRRKLLADHGAEGKTG |
| Ga0306918_100452304 | 3300031744 | Soil | MTDHDQPKTKKALILEAARDLGHQKWTSAEIDQLRRKLIADHG |
| Ga0307477_100960904 | 3300031753 | Hardwood Forest Soil | MTDLLKTKKALILETARELGHQKWTTAEIDQLRRKLLADHGEEAKS |
| Ga0307475_102385321 | 3300031754 | Hardwood Forest Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKTGMEYIA |
| Ga0307475_105814532 | 3300031754 | Hardwood Forest Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGE |
| Ga0318565_100681313 | 3300031799 | Soil | MTEHNELKTKKAFILEAARDLGHQKWTTAEIDQLRRKLIADHGEAAK |
| Ga0307473_104736262 | 3300031820 | Hardwood Forest Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRR |
| Ga0318536_100813921 | 3300031893 | Soil | MTEHNELKTKKAFILEAARDLGHQKWTTAEIDQLR |
| Ga0306923_102517731 | 3300031910 | Soil | MTEQNQLKTKKALILEAARDLGHQKWTTAEIDQLRRKLIADHGEAA |
| Ga0306923_103042771 | 3300031910 | Soil | MTEHNQLKTKKALILEAARDLGHQKWTTAEVDQLRRKL |
| Ga0306923_107772781 | 3300031910 | Soil | MTEPNQLKTKKALILEAARDLGHQKWTTAEIDQLRRKLIADHGEAA |
| Ga0306923_121296852 | 3300031910 | Soil | MTEGPQTKKAMILEAARELGLQKWTTAEIDQLRRKLIADHGEAGK |
| Ga0306921_100110681 | 3300031912 | Soil | MTEQNQLKTKKALILEAARDLGHQKWTTAEIDQLRRKLIADHGEA |
| Ga0306921_126349601 | 3300031912 | Soil | MTEGPQTTKKEMIVEAARELGVQKWSTAEIDQLRRKLIADHGEL |
| Ga0306926_104532761 | 3300031954 | Soil | MTEGPQTTKKEMIVEAARELGVQKWSTAEIDQLRRKLIADHGE |
| Ga0307479_101938474 | 3300031962 | Hardwood Forest Soil | MTETLETKRAMILRAAAAIGAEKWTAAEIDQLRRKLLADHGSEGKTGS |
| Ga0307479_103382613 | 3300031962 | Hardwood Forest Soil | MTDSEKSKKDLILETAREIGASKWTLAEIDQLRRRLHAE |
| Ga0307479_108335252 | 3300031962 | Hardwood Forest Soil | MTETLETKRAMILRAAAAIGAEKWTAAEIDQLRRK |
| Ga0306922_100239118 | 3300032001 | Soil | MTEHNELKTKKAFILEAARDLGHQKWTTAEIDQLRRKL |
| Ga0318510_103766062 | 3300032064 | Soil | MTQLLKNKKALILETAREINAQKWTPAEIEQLRLRLLAEHGEAGKAGTDY |
| Ga0318553_102654391 | 3300032068 | Soil | MTEHNELKTKKAFILEAARDLGHQKWTTAEIDQLRRKLIADHGEAAKSGN |
| Ga0306924_106970722 | 3300032076 | Soil | MTDTLQTKKAMILEAARGLGLQRWSMAEIDQLRRKLIADHGEAGKSS |
| Ga0311301_128522582 | 3300032160 | Peatlands Soil | MTEDLKTKKALILETAREIKVQQWTPAEIDQLRRRLLAEHGEAGKAGSDYIADV |
| Ga0307471_1012831821 | 3300032180 | Hardwood Forest Soil | MSDDLKTKKAMILETAREIGVEKWTPAEIDQLRRKLVAEH |
| Ga0307471_1024073582 | 3300032180 | Hardwood Forest Soil | MNEEAKTKKLLILDTAREIKVEKWTPAEIDQLRRRLLAEHGEAGKT |
| Ga0307472_1010076571 | 3300032205 | Hardwood Forest Soil | MSEILQTKKAMILRAAAAIGAEKWTPAEIEQLRRKLLADHGA |
| Ga0306920_1000847151 | 3300032261 | Soil | MTEPNQLKTKKALILEAARDLGHQKWTTAEIDQLRRKLIADHGEA |
| Ga0335079_109338101 | 3300032783 | Soil | MTEAVKTKKALILEAARELSIEKWTTAEIDQLRRKLIADHGEEG |
| Ga0335072_106837232 | 3300032898 | Soil | MNDALRSKKEMILEVAEEIGAQRWTPAEIDQLRRRLIAEHGDA |
| Ga0335077_106438281 | 3300033158 | Soil | MSTDLKNKKAMILETAREINVQSWTPAEIDQLRRRLIAEHGEAA |
| Ga0310914_107608521 | 3300033289 | Soil | MTETLETKRAMILRAAAAIGAEKWTPAEIDQLRRKLL |
| Ga0318519_100802763 | 3300033290 | Soil | MTEHNELKTKKAFILEAARDLGHQKWTTAEIDQLRRKLIADHGEAAKSGNDY |
| ⦗Top⦘ |