| Basic Information | |
|---|---|
| Family ID | F021276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 219 |
| Average Sequence Length | 46 residues |
| Representative Sequence | EMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPAEA |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 219 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.65 % |
| % of genes near scaffold ends (potentially truncated) | 95.89 % |
| % of genes from short scaffolds (< 2000 bps) | 87.21 % |
| Associated GOLD sequencing projects | 156 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.543 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.288 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.489 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.078 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.38% β-sheet: 0.00% Coil/Unstructured: 71.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 219 Family Scaffolds |
|---|---|---|
| PF02811 | PHP | 44.75 |
| PF00578 | AhpC-TSA | 8.68 |
| PF13561 | adh_short_C2 | 2.28 |
| PF00198 | 2-oxoacid_dh | 1.83 |
| PF00106 | adh_short | 1.37 |
| PF08534 | Redoxin | 1.37 |
| PF00673 | Ribosomal_L5_C | 0.46 |
| PF07992 | Pyr_redox_2 | 0.46 |
| PF04552 | Sigma54_DBD | 0.46 |
| PF03706 | LPG_synthase_TM | 0.46 |
| PF03745 | DUF309 | 0.46 |
| PF03176 | MMPL | 0.46 |
| PF00753 | Lactamase_B | 0.46 |
| PF02441 | Flavoprotein | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 219 Family Scaffolds |
|---|---|---|---|
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 1.83 |
| COG0094 | Ribosomal protein L5 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.46 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.46 |
| COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 0.46 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.54 % |
| Unclassified | root | N/A | 0.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10003987 | All Organisms → cellular organisms → Bacteria | 5116 | Open in IMG/M |
| 3300002560|JGI25383J37093_10171892 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300002560|JGI25383J37093_10208138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300002912|JGI25386J43895_10008790 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
| 3300004633|Ga0066395_10586119 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005166|Ga0066674_10319278 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005171|Ga0066677_10436866 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005172|Ga0066683_10802097 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005175|Ga0066673_10092067 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300005175|Ga0066673_10235637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1056 | Open in IMG/M |
| 3300005176|Ga0066679_10083300 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300005177|Ga0066690_10015748 | All Organisms → cellular organisms → Bacteria | 4060 | Open in IMG/M |
| 3300005177|Ga0066690_10304415 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1077 | Open in IMG/M |
| 3300005178|Ga0066688_10158996 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300005178|Ga0066688_10613922 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005179|Ga0066684_11016480 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005179|Ga0066684_11064336 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005180|Ga0066685_10092834 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300005180|Ga0066685_10212243 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1329 | Open in IMG/M |
| 3300005340|Ga0070689_100653065 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005364|Ga0070673_102157059 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005436|Ga0070713_100369467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1334 | Open in IMG/M |
| 3300005444|Ga0070694_100552869 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005451|Ga0066681_10032075 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
| 3300005529|Ga0070741_11222136 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005545|Ga0070695_100287512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1210 | Open in IMG/M |
| 3300005545|Ga0070695_101446558 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005553|Ga0066695_10634367 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005555|Ga0066692_10224368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1182 | Open in IMG/M |
| 3300005556|Ga0066707_10260060 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300005558|Ga0066698_10331705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1052 | Open in IMG/M |
| 3300005566|Ga0066693_10072613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1196 | Open in IMG/M |
| 3300005568|Ga0066703_10409485 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005568|Ga0066703_10855618 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005569|Ga0066705_10327225 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300005569|Ga0066705_10586937 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005574|Ga0066694_10252368 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005575|Ga0066702_10508145 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005586|Ga0066691_10819210 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005718|Ga0068866_11368395 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005764|Ga0066903_100169398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3190 | Open in IMG/M |
| 3300005876|Ga0075300_1063461 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006031|Ga0066651_10730635 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006041|Ga0075023_100481603 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006049|Ga0075417_10231044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 882 | Open in IMG/M |
| 3300006791|Ga0066653_10366635 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006794|Ga0066658_10755083 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006796|Ga0066665_10969556 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006797|Ga0066659_11491524 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006800|Ga0066660_11526893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300006854|Ga0075425_103047405 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006894|Ga0079215_11309368 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006903|Ga0075426_10052189 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
| 3300006914|Ga0075436_100126077 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300007255|Ga0099791_10246765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 846 | Open in IMG/M |
| 3300007258|Ga0099793_10622803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
| 3300007265|Ga0099794_10260492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 895 | Open in IMG/M |
| 3300009012|Ga0066710_100262269 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300009012|Ga0066710_100511672 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300009012|Ga0066710_102659939 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009089|Ga0099828_10164430 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300009090|Ga0099827_11865709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
| 3300009137|Ga0066709_100185139 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
| 3300009143|Ga0099792_10517748 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009162|Ga0075423_11276578 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009678|Ga0105252_10001433 | All Organisms → cellular organisms → Bacteria | 10688 | Open in IMG/M |
| 3300009683|Ga0116224_10654717 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009808|Ga0105071_1105039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
| 3300009813|Ga0105057_1082682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 572 | Open in IMG/M |
| 3300010159|Ga0099796_10175330 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 857 | Open in IMG/M |
| 3300010303|Ga0134082_10329018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 644 | Open in IMG/M |
| 3300010304|Ga0134088_10094721 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300010322|Ga0134084_10438366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
| 3300010322|Ga0134084_10458947 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010323|Ga0134086_10135975 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300010329|Ga0134111_10175119 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 859 | Open in IMG/M |
| 3300010329|Ga0134111_10389555 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
| 3300010333|Ga0134080_10297790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
| 3300010333|Ga0134080_10374980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 653 | Open in IMG/M |
| 3300010333|Ga0134080_10438411 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
| 3300010335|Ga0134063_10022183 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
| 3300010335|Ga0134063_10206765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 925 | Open in IMG/M |
| 3300010337|Ga0134062_10246021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 830 | Open in IMG/M |
| 3300010337|Ga0134062_10279555 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010399|Ga0134127_11849834 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 680 | Open in IMG/M |
| 3300010403|Ga0134123_11533670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 712 | Open in IMG/M |
| 3300011269|Ga0137392_10022238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4473 | Open in IMG/M |
| 3300012189|Ga0137388_10075530 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
| 3300012189|Ga0137388_11292983 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012189|Ga0137388_11702551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
| 3300012198|Ga0137364_11480015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300012199|Ga0137383_10185454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1525 | Open in IMG/M |
| 3300012200|Ga0137382_10173260 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300012200|Ga0137382_10364438 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300012203|Ga0137399_10139869 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300012204|Ga0137374_10320393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1263 | Open in IMG/M |
| 3300012206|Ga0137380_10034067 | All Organisms → cellular organisms → Bacteria | 4699 | Open in IMG/M |
| 3300012206|Ga0137380_11476061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
| 3300012206|Ga0137380_11577067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 541 | Open in IMG/M |
| 3300012207|Ga0137381_10862649 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012209|Ga0137379_11679283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 532 | Open in IMG/M |
| 3300012211|Ga0137377_10427803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1262 | Open in IMG/M |
| 3300012211|Ga0137377_10862969 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012285|Ga0137370_10326095 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012350|Ga0137372_10745462 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012351|Ga0137386_10535550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 843 | Open in IMG/M |
| 3300012351|Ga0137386_11255885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 516 | Open in IMG/M |
| 3300012354|Ga0137366_10741835 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012356|Ga0137371_10652012 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012356|Ga0137371_10652013 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012357|Ga0137384_10027207 | All Organisms → cellular organisms → Bacteria | 4688 | Open in IMG/M |
| 3300012357|Ga0137384_10040102 | All Organisms → cellular organisms → Bacteria | 3861 | Open in IMG/M |
| 3300012357|Ga0137384_10591865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 906 | Open in IMG/M |
| 3300012359|Ga0137385_10067777 | All Organisms → cellular organisms → Bacteria | 3175 | Open in IMG/M |
| 3300012395|Ga0134044_1323301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 522 | Open in IMG/M |
| 3300012400|Ga0134048_1336464 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012918|Ga0137396_10144050 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1731 | Open in IMG/M |
| 3300012918|Ga0137396_10642286 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 784 | Open in IMG/M |
| 3300012918|Ga0137396_10898471 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012925|Ga0137419_10016297 | All Organisms → cellular organisms → Bacteria | 4213 | Open in IMG/M |
| 3300012925|Ga0137419_10076791 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300012927|Ga0137416_11158830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 695 | Open in IMG/M |
| 3300012948|Ga0126375_11079599 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012972|Ga0134077_10371390 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012975|Ga0134110_10190042 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 859 | Open in IMG/M |
| 3300012975|Ga0134110_10585493 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012976|Ga0134076_10200186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 837 | Open in IMG/M |
| 3300014150|Ga0134081_10025413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1689 | Open in IMG/M |
| 3300014150|Ga0134081_10122252 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300014157|Ga0134078_10034896 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300014166|Ga0134079_10070812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1273 | Open in IMG/M |
| 3300014166|Ga0134079_10387370 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300014300|Ga0075321_1094229 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300014873|Ga0180066_1123849 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300014874|Ga0180084_1015424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1370 | Open in IMG/M |
| 3300015356|Ga0134073_10237826 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300017656|Ga0134112_10316704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 630 | Open in IMG/M |
| 3300017657|Ga0134074_1127189 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300017659|Ga0134083_10448491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300017659|Ga0134083_10529024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 531 | Open in IMG/M |
| 3300018071|Ga0184618_10044078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1596 | Open in IMG/M |
| 3300018079|Ga0184627_10576212 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300018431|Ga0066655_10134304 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1444 | Open in IMG/M |
| 3300018433|Ga0066667_10294082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1259 | Open in IMG/M |
| 3300018468|Ga0066662_10021239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3648 | Open in IMG/M |
| 3300018468|Ga0066662_11851532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
| 3300018482|Ga0066669_11387183 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 637 | Open in IMG/M |
| 3300019882|Ga0193713_1143033 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300020015|Ga0193734_1047915 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 789 | Open in IMG/M |
| 3300020170|Ga0179594_10057659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1325 | Open in IMG/M |
| 3300021086|Ga0179596_10013334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2774 | Open in IMG/M |
| 3300021086|Ga0179596_10174299 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300021171|Ga0210405_10072442 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300021344|Ga0193719_10354348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
| 3300021559|Ga0210409_10529030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1044 | Open in IMG/M |
| 3300022195|Ga0222625_1287224 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 639 | Open in IMG/M |
| 3300025326|Ga0209342_10546264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 955 | Open in IMG/M |
| 3300025569|Ga0210073_1035368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1021 | Open in IMG/M |
| 3300025922|Ga0207646_10430221 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1191 | Open in IMG/M |
| 3300025922|Ga0207646_11561451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300026295|Ga0209234_1037933 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300026295|Ga0209234_1190515 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300026296|Ga0209235_1289779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300026297|Ga0209237_1011726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5198 | Open in IMG/M |
| 3300026300|Ga0209027_1099433 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300026301|Ga0209238_1213470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 567 | Open in IMG/M |
| 3300026309|Ga0209055_1057698 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300026310|Ga0209239_1234523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 637 | Open in IMG/M |
| 3300026313|Ga0209761_1143260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1135 | Open in IMG/M |
| 3300026319|Ga0209647_1279624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 559 | Open in IMG/M |
| 3300026323|Ga0209472_1024440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2837 | Open in IMG/M |
| 3300026323|Ga0209472_1114530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1063 | Open in IMG/M |
| 3300026324|Ga0209470_1275192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 651 | Open in IMG/M |
| 3300026324|Ga0209470_1278530 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300026333|Ga0209158_1064468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1458 | Open in IMG/M |
| 3300026334|Ga0209377_1020715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3352 | Open in IMG/M |
| 3300026334|Ga0209377_1092853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1266 | Open in IMG/M |
| 3300026343|Ga0209159_1007508 | All Organisms → cellular organisms → Bacteria | 6762 | Open in IMG/M |
| 3300026343|Ga0209159_1133983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1014 | Open in IMG/M |
| 3300026527|Ga0209059_1203201 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300026528|Ga0209378_1097126 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1305 | Open in IMG/M |
| 3300026530|Ga0209807_1031565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2544 | Open in IMG/M |
| 3300026530|Ga0209807_1194928 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300026530|Ga0209807_1217706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 657 | Open in IMG/M |
| 3300026536|Ga0209058_1040786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2741 | Open in IMG/M |
| 3300026536|Ga0209058_1212024 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300026536|Ga0209058_1292371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300026542|Ga0209805_1117453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1259 | Open in IMG/M |
| 3300026548|Ga0209161_10555863 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026548|Ga0209161_10576831 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026551|Ga0209648_10264301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1263 | Open in IMG/M |
| 3300027577|Ga0209874_1135210 | Not Available | 565 | Open in IMG/M |
| 3300027669|Ga0208981_1084693 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300027725|Ga0209178_1418339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 512 | Open in IMG/M |
| 3300027775|Ga0209177_10094848 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 936 | Open in IMG/M |
| 3300027787|Ga0209074_10306611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 637 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10309600 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027882|Ga0209590_10108328 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300027882|Ga0209590_10486636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 797 | Open in IMG/M |
| 3300027882|Ga0209590_11009210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 519 | Open in IMG/M |
| 3300027903|Ga0209488_11094671 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027909|Ga0209382_10759467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1037 | Open in IMG/M |
| 3300027950|Ga0209885_1011361 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 918 | Open in IMG/M |
| 3300028720|Ga0307317_10177726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 717 | Open in IMG/M |
| 3300028791|Ga0307290_10219587 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300028878|Ga0307278_10092532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1360 | Open in IMG/M |
| 3300031226|Ga0307497_10158251 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031229|Ga0299913_11534339 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1113802 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031820|Ga0307473_11082163 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
| 3300031820|Ga0307473_11145635 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
| 3300031965|Ga0326597_10763043 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032174|Ga0307470_10126198 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300032180|Ga0307471_100633918 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1230 | Open in IMG/M |
| 3300032180|Ga0307471_103907789 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300032205|Ga0307472_100490090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1056 | Open in IMG/M |
| 3300032770|Ga0335085_11852637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 616 | Open in IMG/M |
| 3300032783|Ga0335079_11773656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 601 | Open in IMG/M |
| 3300033433|Ga0326726_12051379 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 13.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.46% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.46% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.46% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.46% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.46% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.46% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.46% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.46% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.46% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_1000398710 | 3300002558 | Grasslands Soil | ASRLPEEIKLEKRLQSLGTYASDAWELWTEVSLATPTEA* |
| JGI25383J37093_101718922 | 3300002560 | Grasslands Soil | TEFSESPTEMSHRAQASRLPEEITLERRLQSLGTYAPDAWELWTEVSLAAGAEA* |
| JGI25383J37093_102081381 | 3300002560 | Grasslands Soil | HRAQASRLPEEIKLETHLQSLVTYAPDAWELWTEVSLAAPTEA* |
| JGI25386J43895_100087901 | 3300002912 | Grasslands Soil | SPTEMSHRAQASRLPEEIKLERRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0066395_105861191 | 3300004633 | Tropical Forest Soil | EMSHRAQASRLPEETKLEKKLQSLVTYAPDAWELWSEVSLAAGAEA* |
| Ga0066674_103192783 | 3300005166 | Soil | QLFTEFSESQTEMSHRAQASRLPEEIKLERRLQSLGTYAPDAWELWSEVSLAAPTEA* |
| Ga0066677_104368661 | 3300005171 | Soil | EMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPAEA* |
| Ga0066683_108020971 | 3300005172 | Soil | ESPTEMSHRAQASRLPEEIKLERRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0066673_100920671 | 3300005175 | Soil | PQLFTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPTEA* |
| Ga0066673_102356373 | 3300005175 | Soil | TEMSHRAQASRLPEELKLEKKLQTLATYAPDAWDLWTDVAIAAEAEG* |
| Ga0066679_100833001 | 3300005176 | Soil | PQLFTEFSESQTEMSHRAQASRLPEEIKLEKRLQGLGRYAPDAWELWTEVSLAAAAEA* |
| Ga0066690_100157488 | 3300005177 | Soil | PTEMSHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLAAAAEA* |
| Ga0066690_103044151 | 3300005177 | Soil | LFTEFSESQTEMSHRAQASRLPEEIKLERRLQSLGTYAPDAWELWSEVSLAAPTEA* |
| Ga0066688_101589964 | 3300005178 | Soil | FIEFSESPTEMSHRAQASRLPEEIKLERRLQALVTYAPDAWELWSEVPVATTSQA* |
| Ga0066688_106139221 | 3300005178 | Soil | AQASRLPEEIKLERRLQGLGTYAADAWELWSEVSLAAGAEA* |
| Ga0066684_110164802 | 3300005179 | Soil | ESPTEMSHRAQASRLPEEIQLEKKLKQLGTYAPDAWELWSEVPLGAGAEA* |
| Ga0066684_110643361 | 3300005179 | Soil | AQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPTEA* |
| Ga0066685_100928346 | 3300005180 | Soil | QTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWSEVSLAAPTEA* |
| Ga0066685_102122433 | 3300005180 | Soil | TEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPSEA* |
| Ga0070689_1006530653 | 3300005340 | Switchgrass Rhizosphere | FIEFSESPTEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0070673_1021570592 | 3300005364 | Switchgrass Rhizosphere | TEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0070713_1003694671 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SQTEMSHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLAAGAEA* |
| Ga0070694_1005528691 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ESPTEMSHRAQASRLPEELKLERKLQQLVTYAPDAWDLWNEVSVAVRPA* |
| Ga0066681_100320757 | 3300005451 | Soil | TEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAAAEA* |
| Ga0070741_112221361 | 3300005529 | Surface Soil | ESPTEMSHRAQASRLPEELKLERQLEKLATYAPDAWELWTEVPMGGGEDR* |
| Ga0070695_1002875121 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LFTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATATEA* |
| Ga0070695_1014465583 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FIEFSESPTEMSHRAQASRLPEEIQLEKRLQSLATYAPDAWELWSEVSLATPAR* |
| Ga0066695_106343673 | 3300005553 | Soil | QLFTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPAEA* |
| Ga0066692_102243681 | 3300005555 | Soil | PEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0066707_102600601 | 3300005556 | Soil | RAQASRLPEEIKLERRLQTIATYAPDAWELWSEVPVATASQA* |
| Ga0066698_103317051 | 3300005558 | Soil | AQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPAEA* |
| Ga0066693_100726133 | 3300005566 | Soil | SESRSEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVVATSEA* |
| Ga0066703_104094853 | 3300005568 | Soil | FSESPTEMSHRAQASRLPEEIKLEKRLQGLVTYAPDAWDLWTEVSLAAPAEA* |
| Ga0066703_108556181 | 3300005568 | Soil | RAQASRLPEEIKLERRLQSLGSYAPDAWELWTEVSLAAPAEA* |
| Ga0066705_103272251 | 3300005569 | Soil | EMSHRAQASRLPEEIKLERRLQGLGTYASDAWELWTEVSLAAGAEA* |
| Ga0066705_105869371 | 3300005569 | Soil | AQASRLPEEIKLEKRLQGLGTYAADAWELWTEVSLAAGAEA* |
| Ga0066694_102523681 | 3300005574 | Soil | LPEEIKLEKRLQSLGTYAPDAWELWTEVSIAAPTEA* |
| Ga0066702_105081453 | 3300005575 | Soil | QASRLPEEITLERRLQSLGTYAPDAWELWTEVSLAAGAEA* |
| Ga0066691_108192101 | 3300005586 | Soil | PTEMSHRAQASRLPEEIKLERRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0068866_113683952 | 3300005718 | Miscanthus Rhizosphere | HRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0066903_1001693987 | 3300005764 | Tropical Forest Soil | RLFIEFSESQTEMSHRAQASRLPEETKLEKRLQSLVTYAPDAWELWSEVSLAAGAEA* |
| Ga0075300_10634611 | 3300005876 | Rice Paddy Soil | SRLPEEIKLEKRLQNLVTYAPDAWELWSEVKFTAAAEA* |
| Ga0066651_107306351 | 3300006031 | Soil | QASRLPEEIKLERRLQSLETYAPDARELRSEVSVWPVAP* |
| Ga0075023_1004816031 | 3300006041 | Watersheds | EETKLEKRLQSLVTYAPDAWELWSEVSLTAEAEA* |
| Ga0075417_102310443 | 3300006049 | Populus Rhizosphere | IEFSESPTEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0066653_103666353 | 3300006791 | Soil | SQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPAEA* |
| Ga0066658_107550831 | 3300006794 | Soil | QASRLPEEIKLERRLQSLGTYAPDAWELWSEVSLAAPTEA* |
| Ga0066665_109695561 | 3300006796 | Soil | DPQLFTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPAEA* |
| Ga0066659_114915243 | 3300006797 | Soil | LPEEIKLERRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0066660_115268931 | 3300006800 | Soil | PTEMSHRAQASRLPEEIKLERRLQAVATYAPDAWELWSEVPVATASQT* |
| Ga0075425_1030474051 | 3300006854 | Populus Rhizosphere | RLFIEFSESPTEMSHRAQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0079215_113093683 | 3300006894 | Agricultural Soil | SRLPEEIKLEKRLQSLATYAPDAWELWSEVPVATASQA* |
| Ga0075426_100521897 | 3300006903 | Populus Rhizosphere | EFSESPTEMSHRAQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVTTTSQA* |
| Ga0075436_1001260776 | 3300006914 | Populus Rhizosphere | SRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0099791_102467651 | 3300007255 | Vadose Zone Soil | FSESPTEMSQRAQASRLPEEIKLEKRLQGLVTYAPDAWDLWTEVSLAAPAEA* |
| Ga0099793_106228033 | 3300007258 | Vadose Zone Soil | EEIKLEKRLQSLGTYAPDAWELWTEVSLAAATEA* |
| Ga0099794_102604923 | 3300007265 | Vadose Zone Soil | ESPTEMSHRAQASRLPEEIKLEKRLQGLVTYAPDAWDLWTEVSLTAPAEA* |
| Ga0066710_1002622691 | 3300009012 | Grasslands Soil | ESQTEMSHRAQASRLPEEIKLERRLQGLGTYASDAWELWTEVSLAAGAEA |
| Ga0066710_1005116726 | 3300009012 | Grasslands Soil | PRLFIEFSESPTEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0066710_1026599393 | 3300009012 | Grasslands Soil | QLFTEFSESQTEMSHRAQASRLPEEIKLERRLQGLGTYAADAWELWSEVSLAAGAEA |
| Ga0099828_101644302 | 3300009089 | Vadose Zone Soil | MSHRAQASRLPEEIKLEKRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0099827_118657093 | 3300009090 | Vadose Zone Soil | LFTEFSESLTEMSHRAQASRLPEEIKLEKRLQSLGAYAPDAWELWTEVSLATPTEA* |
| Ga0066709_1001851391 | 3300009137 | Grasslands Soil | RLPEELKLEKKLQSLATYAPDAWDLWTDVALAAEAEA* |
| Ga0099792_105177481 | 3300009143 | Vadose Zone Soil | QTEMSHRAQASRLPEEIKLEKRLQSLGTYASDAWELWTEVSLATPTEA* |
| Ga0075423_112765781 | 3300009162 | Populus Rhizosphere | PEEIQLEKRLQSLATYAPDAWDLWSEVSLAAPAR* |
| Ga0105252_1000143318 | 3300009678 | Soil | PTEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0116224_106547172 | 3300009683 | Peatlands Soil | SHRAQASRLPEELKLEAHLQRTVTYAPDAWDLWTEVPLEAPPAA* |
| Ga0105071_11050392 | 3300009808 | Groundwater Sand | SESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPTEA* |
| Ga0105057_10826823 | 3300009813 | Groundwater Sand | FSESPTEMSHRAQASRLPEETKLEKKLQSLVTYAPDAWELWTEVSLATPAEA* |
| Ga0099796_101753301 | 3300010159 | Vadose Zone Soil | TEMSHRAQASRLPEEIKLEKRLLALATYAPDAWELWSEVPVTTTSQA* |
| Ga0134082_103290181 | 3300010303 | Grasslands Soil | QASRLPEEIKLEKRLQGLGTYALDAWELWTEVSLAAGAEA* |
| Ga0134088_100947211 | 3300010304 | Grasslands Soil | MSHRAQASRLPEEIKLERRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0134084_104383661 | 3300010322 | Grasslands Soil | RAQASRLPEEIKLERRLQGLGTYAPDAWELWTEVSLAAAAEA* |
| Ga0134084_104589471 | 3300010322 | Grasslands Soil | RAQASRLPEEIQLEKRLQSLATYAPDAWELWSEVSIPAPAR* |
| Ga0134086_101359753 | 3300010323 | Grasslands Soil | EFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPAEA* |
| Ga0134111_101751191 | 3300010329 | Grasslands Soil | ITLEKRLQSIATYAPDAWELWSEVSLTAPWPDAR* |
| Ga0134111_103895553 | 3300010329 | Grasslands Soil | AQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0134080_102977901 | 3300010333 | Grasslands Soil | QASRLPEEIKLERRLQALATYAPDAWELWSEVPVATASQA* |
| Ga0134080_103749801 | 3300010333 | Grasslands Soil | ESPTEMSHRAQASRLPEEITLERRLQSLATYAPDAWELWSEVSVWPVAP* |
| Ga0134080_104384113 | 3300010333 | Grasslands Soil | RAQASRLPEEIKLEKRLQSLGTYASDAWELWTEVSLATPTEA* |
| Ga0134063_100221837 | 3300010335 | Grasslands Soil | EEIKLEKRLQSLGTYAPDAWELWTEVSLAAPSEA* |
| Ga0134063_102067651 | 3300010335 | Grasslands Soil | LFTEFSESPTEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATASQA* |
| Ga0134062_102460211 | 3300010337 | Grasslands Soil | ASRLPEEIKLEKRLQGLGTYAADAWELWTEVSLAAGAEA* |
| Ga0134062_102795553 | 3300010337 | Grasslands Soil | ESPTEMSHRAQSSRLPEELKLEKRLQSLGAYAPDAWELWTEVSLAAPTEA* |
| Ga0134127_118498341 | 3300010399 | Terrestrial Soil | FSESPTEMSHRAQASRLPEEIKLEKRLEALATYAPDAWELWSEVPVATTSQA* |
| Ga0134123_115336701 | 3300010403 | Terrestrial Soil | ESPTEMSHRAQASRLPEEIQLEKRLQSLATYAPDAWELWSEVSLATPAV* |
| Ga0137392_100222381 | 3300011269 | Vadose Zone Soil | LPEEIKLERRLQALATYAPDAWELWSEVPVTTTSQA* |
| Ga0137388_100755307 | 3300012189 | Vadose Zone Soil | HRAQASRLPEEIKLEKRLQGLVTYAPDAWDLWTEVSLAATAEA* |
| Ga0137388_112929831 | 3300012189 | Vadose Zone Soil | QLFIEFSESPTEMSHRAQASRLPEEIKLEKRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0137388_117025512 | 3300012189 | Vadose Zone Soil | TEMSHRAQASRLPEEIKLEKRLQSLGIYAPDAWELWTEVSLATPAEA* |
| Ga0137364_114800151 | 3300012198 | Vadose Zone Soil | LFIEFSESPTEMSHRAQASRLPEEIKLEKHLQSIVTYAPDAWDLWTEVSLEAPTQA* |
| Ga0137383_101854541 | 3300012199 | Vadose Zone Soil | IEFSESPTEMSHRAQASRLPEEIKLEKHLQSIVTYAPDAWDLWTEVSLEAPTQA* |
| Ga0137382_101732604 | 3300012200 | Vadose Zone Soil | FIEFSESPTEMSHRAQASRLPEEIQLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0137382_103644383 | 3300012200 | Vadose Zone Soil | EEIKLEKRLQSLGTYAPDAWELWSEVSLAAPTEA* |
| Ga0137399_101398696 | 3300012203 | Vadose Zone Soil | PEEIQLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0137374_103203931 | 3300012204 | Vadose Zone Soil | SRLPEEIKLAKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0137380_100340671 | 3300012206 | Vadose Zone Soil | EFSESPTEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATASQA* |
| Ga0137380_114760613 | 3300012206 | Vadose Zone Soil | SRLPEEIKLEKRPQAFATYAPDAWELWSEVPVATTSQA* |
| Ga0137380_115770672 | 3300012206 | Vadose Zone Soil | FTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYASDAWELWTEVSLATPTEA* |
| Ga0137381_108626491 | 3300012207 | Vadose Zone Soil | MSHRAQASRLPEEIKLEKRLQSLGTYASDAWELWTEVSLATPTEA* |
| Ga0137379_116792832 | 3300012209 | Vadose Zone Soil | SHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLAAPAGA* |
| Ga0137377_104278031 | 3300012211 | Vadose Zone Soil | SPTEMSHRAQASRLPEEIKLEKHLQSIVTYAPDAWDLWTAVSLEAPTQA* |
| Ga0137377_108629693 | 3300012211 | Vadose Zone Soil | FTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAATEA* |
| Ga0137370_103260953 | 3300012285 | Vadose Zone Soil | MSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPSEA* |
| Ga0137372_107454623 | 3300012350 | Vadose Zone Soil | EEIKLERQLQSLGTYAPDAWELWTEVSLAAPTGA* |
| Ga0137386_105355503 | 3300012351 | Vadose Zone Soil | LEFSESATEMSHRAQASRLPEELKLEKKLQALATYAPDAWDLWTDVAFAAEAEA* |
| Ga0137386_112558851 | 3300012351 | Vadose Zone Soil | PEEIKLERRLQGLGTYASDAWELWTEVSLAAAAEA* |
| Ga0137366_107418351 | 3300012354 | Vadose Zone Soil | ALRLPEEIKREKRLQGLGTYAPDAWELWTEVSLAAPTEA* |
| Ga0137371_106520123 | 3300012356 | Vadose Zone Soil | SHRAQASRLPEELKLEKRLQSLGAYAPDAWELWTEVSLAAPAEA* |
| Ga0137371_106520133 | 3300012356 | Vadose Zone Soil | SHRAQASRLPEELKLEKRLQSLGAYAPDAWELWTEVSLAAPTEA* |
| Ga0137384_100272073 | 3300012357 | Vadose Zone Soil | MSHRAQASRLPEEIQLEKRLQSLATYAPDAWELWSEVSLTAPSKA* |
| Ga0137384_100401021 | 3300012357 | Vadose Zone Soil | HRAQASRLPEEIKLERRLQGLGTYAPDAWELWTEVSLAAPAGA* |
| Ga0137384_105918651 | 3300012357 | Vadose Zone Soil | RAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPAEA* |
| Ga0137385_100677771 | 3300012359 | Vadose Zone Soil | TEMSHRAQASRLPEEIKLERRLQAIATYAPDAWDLWSEVPVATASQA* |
| Ga0134044_13233011 | 3300012395 | Grasslands Soil | EMSHRAQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0134048_13364641 | 3300012400 | Grasslands Soil | PEEIKLEKRLQSLGTYAPDAWELWTEGSLATPAEA* |
| Ga0137396_101440505 | 3300012918 | Vadose Zone Soil | QASRLPEEIKLEKRLQALGTYAPDAWELWTEVPLTAAAEA* |
| Ga0137396_106422863 | 3300012918 | Vadose Zone Soil | SRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0137396_108984712 | 3300012918 | Vadose Zone Soil | ASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAATEA* |
| Ga0137419_100162971 | 3300012925 | Vadose Zone Soil | RAQASRLPEEIKLEKRLQSLGIYAPDAWELWTEVSLATPAEA* |
| Ga0137419_100767916 | 3300012925 | Vadose Zone Soil | EEIKLEKRLQALATYAPDAWELWSEVPVATTSQA* |
| Ga0137416_111588301 | 3300012927 | Vadose Zone Soil | SPTEMSHRAQASRLPEEITLERRLQALATYAPDAWELWSEVPVATASQA* |
| Ga0126375_110795991 | 3300012948 | Tropical Forest Soil | ESQTEMSHRAQASRLPEEIKLERRLQSLGTYAPDAWELWTEVSLAAPSEA* |
| Ga0134077_103713903 | 3300012972 | Grasslands Soil | EFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPTEA* |
| Ga0134110_101900423 | 3300012975 | Grasslands Soil | HRAQASRLPEEIKLEKRLQGLGTYAADAWELWTEVSLAAGAEA* |
| Ga0134110_105854931 | 3300012975 | Grasslands Soil | LPEEIKLEKRLQGLGTYAPDAWELWTEVSLAAAAEA* |
| Ga0134076_102001863 | 3300012976 | Grasslands Soil | SHRAQASRLPEEITLERRLQSLATYAPDAWELWSEVSVWPVAP* |
| Ga0134081_100254135 | 3300014150 | Grasslands Soil | EFSESQTEMSHRAQASRLPEEIKLEKRLQGLGTYAADAWELWTEVSLAAGAEA* |
| Ga0134081_101222521 | 3300014150 | Grasslands Soil | QLFTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPSEA* |
| Ga0134078_100348961 | 3300014157 | Grasslands Soil | QTEMSHRAQASRLPEEIKLERRLQGLGTYASDAWELWTEVSLAAGAEA* |
| Ga0134079_100708121 | 3300014166 | Grasslands Soil | TEMSHRAQASRLPEEIKLEKRLQGLGTYALDAWELWTEVSLAAAAEA* |
| Ga0134079_103873701 | 3300014166 | Grasslands Soil | QASRLPEEIKLERRLQGLGTYAPDAWELWTEVSLAAAAEA* |
| Ga0075321_10942291 | 3300014300 | Natural And Restored Wetlands | QASRLPEELTLERRLQGIATYAPDAWELWSEVPLAASTEE* |
| Ga0180066_11238491 | 3300014873 | Soil | PEETKLEKRLQSLVTYAPDAWELWTEVSLATPAEA* |
| Ga0180084_10154241 | 3300014874 | Soil | QLFIEFSESATEMSHRAQASRLPEEITLERRLEGIATYAPDAWELWTEVPLAAPADA* |
| Ga0134073_102378263 | 3300015356 | Grasslands Soil | LFTEFSESPTEMSHRAQSSRLPEELKLEKRLQSLGAYAPDAWELWTEVSLAAPTEA* |
| Ga0134112_103167041 | 3300017656 | Grasslands Soil | IEFSESPTEMSHRAQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0134074_11271891 | 3300017657 | Grasslands Soil | EMSHRAQASRLPEEIKLEKQLQALATYAPDAWELWSEVSVWPAERSQ |
| Ga0134083_104484912 | 3300017659 | Grasslands Soil | PEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0134083_105290242 | 3300017659 | Grasslands Soil | LPEEIKLERRLQAIATYAPDAWELWSEVPVATASQA |
| Ga0184618_100440781 | 3300018071 | Groundwater Sediment | HRAQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0184627_105762122 | 3300018079 | Groundwater Sediment | MSHRAQASRLPEEIQLEKRLQSLATYAPDAWELWSEVSLTAPSKA |
| Ga0066655_101343041 | 3300018431 | Grasslands Soil | SRLPEEIKLERRLQGLGTYASDAWELWTEVSLAAGAEA |
| Ga0066667_102940821 | 3300018433 | Grasslands Soil | EMSHRAQASRLPEEIKLERRLQAVATYAPDAWELWSEVPVATASQT |
| Ga0066662_100212398 | 3300018468 | Grasslands Soil | HRAQASRLPEELELEKKLQALATYSPDAWDLWTDVALAAEAEA |
| Ga0066662_118515323 | 3300018468 | Grasslands Soil | PEEIKLETHLQSLVTYAPDAWDLWTEVSLEAPTEA |
| Ga0066669_113871833 | 3300018482 | Grasslands Soil | HRAQASRLTEEIQLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0193713_11430331 | 3300019882 | Soil | MSHRAQASRLPEEITLERRLQGIATYAPDAWELWSEVPLAAPTEA |
| Ga0193734_10479151 | 3300020015 | Soil | RAQASRLPEEIQLEKRLQSLATYAPDAWELWSEVSLAAPVR |
| Ga0179594_100576591 | 3300020170 | Vadose Zone Soil | RAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAATEA |
| Ga0179596_100133341 | 3300021086 | Vadose Zone Soil | QASRLPEEIKLEKRLQSLGIYAPDAWELWTEVSLATPTEA |
| Ga0179596_101742991 | 3300021086 | Vadose Zone Soil | TEMSHRAQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0210405_100724425 | 3300021171 | Soil | EMSHRAQASRLPEEIKLEKKLQGLVTYAPDAWELWSAVPLTAAAEA |
| Ga0193719_103543482 | 3300021344 | Soil | ESPTEMSHRAQASRLPEEIQLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0210409_105290303 | 3300021559 | Soil | LFIEFSESPTEMSHRAQASRLPEEIQLEKKLKQLGTYAPDAWELWSEVPLAAGAEA |
| Ga0222625_12872241 | 3300022195 | Groundwater Sediment | TEMSHRAQASRLPEEIQLEKRLQSLATYAPDAWELWSEVSLATPAR |
| Ga0209342_105462641 | 3300025326 | Soil | PEEIQLERKLQTLVTYAPDAWDLWTEVSFAASREA |
| Ga0210073_10353681 | 3300025569 | Natural And Restored Wetlands | IEFSESRSEMSHRAQASRLPEEIKLEKKLQSLVTYAPDAWDLWTEVPLGAATEA |
| Ga0207646_104302211 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EMSHRAQASQLPEETKLEKKLQSLVTYAPDAWELWSEVSLAAGAEA |
| Ga0207646_115614512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TEFSESQTEMSHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLGAAAEA |
| Ga0209234_10379336 | 3300026295 | Grasslands Soil | FTEFSESPTEMSHRAQASRLPEEIKLEKRLQGLGTYAADAWELWTEVSLAAAAEA |
| Ga0209234_11905151 | 3300026295 | Grasslands Soil | FTEFSESPTEMSHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLAATAEA |
| Ga0209235_12897792 | 3300026296 | Grasslands Soil | MSHRAQASRLPEEIKLERRLQGLATYAPDAWELWSEVSLPAPAGA |
| Ga0209237_101172610 | 3300026297 | Grasslands Soil | SESATEMSHRAQASRLPEEIKLERRLQSLGTYASDAWELWTEVSLAAPAEA |
| Ga0209027_10994333 | 3300026300 | Grasslands Soil | FTEFSESQTEMSHRAQASRLPEEIKLERRLQGLGTYAPDAWELWTEVSLAAAAEA |
| Ga0209238_12134703 | 3300026301 | Grasslands Soil | ASRLPEEIKLERRLQALATYAPDAWELWSEVSVATTSQA |
| Ga0209055_10576981 | 3300026309 | Soil | SHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPSEA |
| Ga0209239_12345231 | 3300026310 | Grasslands Soil | SHRAQASRLPEEIKLERRLQGLGTYASDAWELWTEVSLVAGAEA |
| Ga0209761_11432603 | 3300026313 | Grasslands Soil | SESATEMSHRAQASRLPEELKLEKKLQTLATYAPDAWDLWTDVALAAEAEA |
| Ga0209647_12796243 | 3300026319 | Grasslands Soil | EPLLQLDLRAQASRLPEEIQLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0209472_10244401 | 3300026323 | Soil | EMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAAAEA |
| Ga0209472_11145301 | 3300026323 | Soil | HRAQASRLPEEIKLEKRLQGLGTYAADAWELWTEVSLAAGAEA |
| Ga0209470_12751921 | 3300026324 | Soil | RAQASRLPEEIKLEKRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0209470_12785301 | 3300026324 | Soil | SESPTEMSHRAQASRLPEEIKLERRLQAVGTYAPDAWELWTEVPLTAAAEA |
| Ga0209158_10644684 | 3300026333 | Soil | HRAQASRLPEEIKLERRLQTIATYAPDAWELWSEVPVATASQA |
| Ga0209377_10207153 | 3300026334 | Soil | MSHRAQASRLPEEIRLEKRLQGLVTYAPDAWDLWTEVSLAAAAEA |
| Ga0209377_10928533 | 3300026334 | Soil | RLPEEIKLERRLQAIATYAPDAWELWSEVPVATASQA |
| Ga0209159_100750813 | 3300026343 | Soil | RLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPAEA |
| Ga0209159_11339831 | 3300026343 | Soil | LPEEIKLETHLQSLVTYAPDAWELWTEVSLAAPTEA |
| Ga0209059_12032013 | 3300026527 | Soil | TEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPAEA |
| Ga0209378_10971263 | 3300026528 | Soil | SESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATPTEA |
| Ga0209807_10315651 | 3300026530 | Soil | PEEIKLERRLQGLGTYASDAWELWTEVSLAAGAEA |
| Ga0209807_11949281 | 3300026530 | Soil | LFTEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPTEA |
| Ga0209807_12177061 | 3300026530 | Soil | MSHRAQASRLPEELKLEKKLQTLATYAPDAWDLWTDVAIAAEAEG |
| Ga0209058_10407861 | 3300026536 | Soil | TEFSESQTEMSHRAQASRLPEEIKLERRLQSLGTYAPDAWELWSEVSLAAPTEA |
| Ga0209058_12120241 | 3300026536 | Soil | QTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPSEA |
| Ga0209058_12923711 | 3300026536 | Soil | SESPTEMSHRAQASRLPEEIKLEKQLQALATYAPDAWELWSEVSVWPAERSQ |
| Ga0209805_11174532 | 3300026542 | Soil | SPTEMSHRAQASRLPEEIKLERRLQAVATYAPDAWELWSEVPVAAASQT |
| Ga0209161_105558631 | 3300026548 | Soil | FSESPTEMSHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLAAAAEA |
| Ga0209161_105768311 | 3300026548 | Soil | SPTERSHRAQASRLPEEIKLEKRLQALGTYAPDAWELWTEVPLTAGAEA |
| Ga0209648_102643013 | 3300026551 | Grasslands Soil | HRAQASRLPEEIKLEKRLQALGTYATDAWELWTEVSLAAPAAT |
| Ga0209874_11352102 | 3300027577 | Groundwater Sand | SRLPEETKLEKRLQGLATYAPDAWELWSEVSLATPSEA |
| Ga0208981_10846931 | 3300027669 | Forest Soil | EMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLAAPTEA |
| Ga0209178_14183391 | 3300027725 | Agricultural Soil | QASRLPEEIKLERRLQSLGQYAPDAWELWTEVSLTAGREA |
| Ga0209177_100948481 | 3300027775 | Agricultural Soil | LFTEFSESQTEMSHRAQASRLPEEIKLERRLQSLGQYAPDAWELWTEVSLTAGREA |
| Ga0209074_103066112 | 3300027787 | Agricultural Soil | SPTEMSHRAQASRLPEEIKLEKKLQNLVTYAPDAWELWSEVSLAATAEA |
| (restricted) Ga0233416_103096001 | 3300027799 | Sediment | RAQASRLPEEIKLEKKLQSLVTYAPDAWDLWNEVPLGAATEA |
| Ga0209590_101083281 | 3300027882 | Vadose Zone Soil | SRLPEEIKLEKRLQSLGIYAPDAWELWTEVSLATPTEA |
| Ga0209590_104866363 | 3300027882 | Vadose Zone Soil | ASRLPEEIKLERRLQGLGTYAPDAWELWTEVSFAAPAEA |
| Ga0209590_110092101 | 3300027882 | Vadose Zone Soil | TEFSESQTEMSHRAQASRLPEEIKLEKRLQSLGTYAPDAWELWTEVSLATATEA |
| Ga0209488_110946713 | 3300027903 | Vadose Zone Soil | SESATEMSHRAQASRLPEEITLERRLEGIATYAPDAWELWTEVPLAAPTEA |
| Ga0209382_107594673 | 3300027909 | Populus Rhizosphere | SPTEMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0209885_10113613 | 3300027950 | Groundwater Sand | MSHRAQASRLPEETKLEKKLQSLVTYAPDAWELWTEVSLATPAEA |
| Ga0307317_101777263 | 3300028720 | Soil | ASRLPEEIQLEKRLQSLATYAPDAWELWSEVSIPAPAR |
| Ga0307290_102195873 | 3300028791 | Soil | RLPEEIQLEKRLQSLATYAPDAWELWSEVSIPAPAR |
| Ga0307278_100925321 | 3300028878 | Soil | SHRAQASRLPEEIKLEKRLQSLGTYASDAWELWTEVSLAAPAEA |
| Ga0307497_101582513 | 3300031226 | Soil | ATEMSHRAQASRLPEEITLERRLEGIATYAPDAWELWTEVPLAAPADA |
| Ga0299913_115343391 | 3300031229 | Soil | EFSESPTEMSHRAHATRLPEEIKLERRLQALVTYAPDAWELWTEVPLAAPTEA |
| (restricted) Ga0255312_11138021 | 3300031248 | Sandy Soil | SRLPEETKLEKKLQSLVTYAPDAWELWSEVSLAAGAEA |
| Ga0307473_110821631 | 3300031820 | Hardwood Forest Soil | FLEFSESRSEMSHRAQASRLPEEIKLERRLQTLATYAPDAWELWSEVPVAATSEA |
| Ga0307473_111456352 | 3300031820 | Hardwood Forest Soil | ESQTEMSHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLGAAAEA |
| Ga0326597_107630433 | 3300031965 | Soil | IEFSESPTEMSHRAQASRLPEEIQLEKRLQTLATYAPDAWELWSEVSLASASPA |
| Ga0307470_101261985 | 3300032174 | Hardwood Forest Soil | ASRLPEEIKLERRLQSLGTYAPDAWELWTQVSLEAGSEA |
| Ga0307471_1006339181 | 3300032180 | Hardwood Forest Soil | HRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVATTSQA |
| Ga0307471_1039077892 | 3300032180 | Hardwood Forest Soil | TEMSHRAQASRLPEEIKLEKRLQGLGTYAPDAWELWTEVSLAAGAEA |
| Ga0307472_1004900901 | 3300032205 | Hardwood Forest Soil | EMSHRAQASRLPEEIKLERRLQALATYAPDAWELWSEVPVASTSQA |
| Ga0335085_118526373 | 3300032770 | Soil | RAQASRLPEETKLEKRLQTLVTYAPDAWELWSEVSFAAPAEA |
| Ga0335079_117736563 | 3300032783 | Soil | LPEEIKLEKKLQNLVTYAPDAWELWSEVSLTSPAEA |
| Ga0326726_120513791 | 3300033433 | Peat Soil | SPTEMSHRAQASRLPEETKLEKRLQSLVTYAPDAWELWSEVSYEAPAET |
| ⦗Top⦘ |