| Basic Information | |
|---|---|
| Family ID | F021213 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 220 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKNADKCTCEKPLLQERSDQKGSSQSWCGRCKRPLALRPAGFRSAFA |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 220 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.64 % |
| % of genes near scaffold ends (potentially truncated) | 35.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.545 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.33% Coil/Unstructured: 82.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 220 Family Scaffolds |
|---|---|---|
| PF00909 | Ammonium_transp | 31.36 |
| PF00581 | Rhodanese | 24.09 |
| PF04402 | SIMPL | 5.45 |
| PF13649 | Methyltransf_25 | 5.00 |
| PF13847 | Methyltransf_31 | 4.09 |
| PF00027 | cNMP_binding | 1.82 |
| PF01872 | RibD_C | 1.82 |
| PF07732 | Cu-oxidase_3 | 1.82 |
| PF12697 | Abhydrolase_6 | 1.36 |
| PF06772 | LtrA | 1.36 |
| PF08241 | Methyltransf_11 | 1.36 |
| PF07731 | Cu-oxidase_2 | 1.36 |
| PF14279 | HNH_5 | 1.36 |
| PF14584 | DUF4446 | 0.91 |
| PF08031 | BBE | 0.91 |
| PF10294 | Methyltransf_16 | 0.45 |
| PF01844 | HNH | 0.45 |
| PF13365 | Trypsin_2 | 0.45 |
| PF01545 | Cation_efflux | 0.45 |
| PF01098 | FTSW_RODA_SPOVE | 0.45 |
| PF14342 | DUF4396 | 0.45 |
| PF00239 | Resolvase | 0.45 |
| PF03796 | DnaB_C | 0.45 |
| PF03372 | Exo_endo_phos | 0.45 |
| PF00211 | Guanylate_cyc | 0.45 |
| PF07705 | CARDB | 0.45 |
| PF10517 | DM13 | 0.45 |
| PF12297 | EVC2_like | 0.45 |
| PF12695 | Abhydrolase_5 | 0.45 |
| PF00120 | Gln-synt_C | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 220 Family Scaffolds |
|---|---|---|---|
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 31.36 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 5.45 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 5.45 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 5.45 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 3.18 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.82 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.82 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 1.36 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.91 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.45 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.45 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.45 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.45 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.45 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.45 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.45 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.45 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.55 % |
| Unclassified | root | N/A | 5.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01CYNI8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300000043|ARcpr5yngRDRAFT_c016767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11355839 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10161168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300000887|AL16A1W_10017573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300000891|JGI10214J12806_11780199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300000956|JGI10216J12902_100552026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1936 | Open in IMG/M |
| 3300000956|JGI10216J12902_103473943 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300000956|JGI10216J12902_110045016 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300001305|C688J14111_10200299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300001361|A30PFW6_1001480 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300001686|C688J18823_10137391 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300002568|C688J35102_118840450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300003321|soilH1_10169292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2395 | Open in IMG/M |
| 3300003911|JGI25405J52794_10111557 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300003990|Ga0055455_10071936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 982 | Open in IMG/M |
| 3300004114|Ga0062593_100377074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1255 | Open in IMG/M |
| 3300004114|Ga0062593_101231989 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300004156|Ga0062589_100329176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1199 | Open in IMG/M |
| 3300004479|Ga0062595_100502254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 911 | Open in IMG/M |
| 3300004479|Ga0062595_100731109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
| 3300004479|Ga0062595_100971085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300005093|Ga0062594_100342643 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005093|Ga0062594_102688291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300005093|Ga0062594_103284049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 508 | Open in IMG/M |
| 3300005105|Ga0066812_1018992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300005161|Ga0066807_1020563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300005166|Ga0066674_10207557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300005169|Ga0066810_10058297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 772 | Open in IMG/M |
| 3300005172|Ga0066683_10847329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300005175|Ga0066673_10170796 | Not Available | 1223 | Open in IMG/M |
| 3300005178|Ga0066688_10739772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300005187|Ga0066675_11278380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300005294|Ga0065705_10279371 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005332|Ga0066388_100032074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4967 | Open in IMG/M |
| 3300005332|Ga0066388_102644343 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005334|Ga0068869_100460102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1056 | Open in IMG/M |
| 3300005347|Ga0070668_100019584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5093 | Open in IMG/M |
| 3300005438|Ga0070701_11183564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300005451|Ga0066681_10333098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
| 3300005467|Ga0070706_100703794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300005539|Ga0068853_100935960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 833 | Open in IMG/M |
| 3300005540|Ga0066697_10136605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1443 | Open in IMG/M |
| 3300005545|Ga0070695_100144986 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300005545|Ga0070695_100700906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300005553|Ga0066695_10150119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1451 | Open in IMG/M |
| 3300005553|Ga0066695_10297508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1018 | Open in IMG/M |
| 3300005558|Ga0066698_10368584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300005560|Ga0066670_10054748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2083 | Open in IMG/M |
| 3300005560|Ga0066670_10087183 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300005574|Ga0066694_10567099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300005587|Ga0066654_10497254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300005713|Ga0066905_101821699 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005719|Ga0068861_102370963 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005764|Ga0066903_103641005 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006031|Ga0066651_10223885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300006031|Ga0066651_10674562 | Not Available | 554 | Open in IMG/M |
| 3300006032|Ga0066696_10026527 | All Organisms → cellular organisms → Bacteria | 3048 | Open in IMG/M |
| 3300006046|Ga0066652_101480890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 631 | Open in IMG/M |
| 3300006196|Ga0075422_10625462 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006573|Ga0074055_11721155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300006576|Ga0074047_11911449 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300006577|Ga0074050_11943374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1023 | Open in IMG/M |
| 3300006581|Ga0074048_13482574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 592 | Open in IMG/M |
| 3300006605|Ga0074057_12312982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
| 3300006755|Ga0079222_10325811 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300006755|Ga0079222_12524924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300006804|Ga0079221_10363894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
| 3300006804|Ga0079221_10790564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300006806|Ga0079220_10551458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300006847|Ga0075431_101299854 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300006847|Ga0075431_101900126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300006852|Ga0075433_10369280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1267 | Open in IMG/M |
| 3300006852|Ga0075433_11203347 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006853|Ga0075420_101596072 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006854|Ga0075425_101278934 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006914|Ga0075436_101073473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300006914|Ga0075436_101105233 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300009012|Ga0066710_101280403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
| 3300009090|Ga0099827_10603858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
| 3300009137|Ga0066709_100546305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300009147|Ga0114129_10291067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2179 | Open in IMG/M |
| 3300009148|Ga0105243_10439659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1221 | Open in IMG/M |
| 3300009162|Ga0075423_11269932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 787 | Open in IMG/M |
| 3300009162|Ga0075423_12670871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300009162|Ga0075423_12937513 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009176|Ga0105242_10487007 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300009840|Ga0126313_10030111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3709 | Open in IMG/M |
| 3300009840|Ga0126313_10068337 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300009840|Ga0126313_10242578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1396 | Open in IMG/M |
| 3300009840|Ga0126313_11588103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300010039|Ga0126309_10126350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1348 | Open in IMG/M |
| 3300010039|Ga0126309_10587916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300010039|Ga0126309_10681466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300010041|Ga0126312_10115385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1846 | Open in IMG/M |
| 3300010041|Ga0126312_10594830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300010042|Ga0126314_10000795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15021 | Open in IMG/M |
| 3300010139|Ga0127464_1227255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300010320|Ga0134109_10110047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
| 3300010336|Ga0134071_10761265 | Not Available | 516 | Open in IMG/M |
| 3300010337|Ga0134062_10201544 | Not Available | 907 | Open in IMG/M |
| 3300010337|Ga0134062_10340769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 720 | Open in IMG/M |
| 3300010373|Ga0134128_10582461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1246 | Open in IMG/M |
| 3300010396|Ga0134126_11773178 | Not Available | 677 | Open in IMG/M |
| 3300010396|Ga0134126_12445484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300010999|Ga0138505_100008416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300012200|Ga0137382_10507406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
| 3300012204|Ga0137374_10739094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300012350|Ga0137372_10045673 | All Organisms → cellular organisms → Bacteria | 3910 | Open in IMG/M |
| 3300012356|Ga0137371_10103315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2219 | Open in IMG/M |
| 3300012356|Ga0137371_10238734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1420 | Open in IMG/M |
| 3300012469|Ga0150984_116218671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300012476|Ga0157344_1030721 | Not Available | 514 | Open in IMG/M |
| 3300012489|Ga0157349_1011349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300012510|Ga0157316_1006642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 955 | Open in IMG/M |
| 3300012532|Ga0137373_11164322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300012897|Ga0157285_10002231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3288 | Open in IMG/M |
| 3300012915|Ga0157302_10081820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 981 | Open in IMG/M |
| 3300012916|Ga0157310_10026982 | Not Available | 1535 | Open in IMG/M |
| 3300012948|Ga0126375_11123125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300012976|Ga0134076_10433042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300012989|Ga0164305_11728039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300013100|Ga0157373_10538555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300014157|Ga0134078_10151150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300014497|Ga0182008_10627895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
| 3300015371|Ga0132258_10192972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4934 | Open in IMG/M |
| 3300015371|Ga0132258_10639095 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300015373|Ga0132257_100001113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23159 | Open in IMG/M |
| 3300015374|Ga0132255_102201483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300017792|Ga0163161_12067691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300017947|Ga0187785_10365351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300018027|Ga0184605_10016578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2900 | Open in IMG/M |
| 3300018027|Ga0184605_10086827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1369 | Open in IMG/M |
| 3300018027|Ga0184605_10110370 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300018032|Ga0187788_10110404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1003 | Open in IMG/M |
| 3300018061|Ga0184619_10088734 | Not Available | 1380 | Open in IMG/M |
| 3300018061|Ga0184619_10097158 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300018061|Ga0184619_10115197 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300018061|Ga0184619_10411189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300018074|Ga0184640_10195694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 912 | Open in IMG/M |
| 3300018081|Ga0184625_10275045 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300018431|Ga0066655_10763614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300018431|Ga0066655_10824784 | Not Available | 631 | Open in IMG/M |
| 3300018431|Ga0066655_10959043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300018433|Ga0066667_10910647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300018433|Ga0066667_11089708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300018482|Ga0066669_10101088 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300018482|Ga0066669_10132096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1801 | Open in IMG/M |
| 3300018482|Ga0066669_11409847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300019361|Ga0173482_10350754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300019767|Ga0190267_10119112 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300019867|Ga0193704_1008134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2093 | Open in IMG/M |
| 3300019867|Ga0193704_1072116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300021078|Ga0210381_10002011 | All Organisms → cellular organisms → Bacteria | 4137 | Open in IMG/M |
| 3300021344|Ga0193719_10121922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300021415|Ga0193694_1003217 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
| 3300021445|Ga0182009_10236566 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300022534|Ga0224452_1213680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300022756|Ga0222622_10225490 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300022756|Ga0222622_10966274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300022756|Ga0222622_11298896 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300022901|Ga0247788_1006806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1866 | Open in IMG/M |
| 3300024055|Ga0247794_10044379 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300025552|Ga0210142_1005224 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300025927|Ga0207687_11155216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300025942|Ga0207689_10455227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1070 | Open in IMG/M |
| 3300026075|Ga0207708_11451702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300026078|Ga0207702_10100416 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300026327|Ga0209266_1298507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300026330|Ga0209473_1051935 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300026330|Ga0209473_1102944 | Not Available | 1192 | Open in IMG/M |
| 3300026331|Ga0209267_1046369 | Not Available | 1980 | Open in IMG/M |
| 3300026343|Ga0209159_1135063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
| 3300026542|Ga0209805_1018685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3654 | Open in IMG/M |
| 3300026960|Ga0207582_1015854 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027453|Ga0207624_108709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300027476|Ga0207514_100389 | Not Available | 1080 | Open in IMG/M |
| 3300027765|Ga0209073_10350673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300027765|Ga0209073_10523215 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027775|Ga0209177_10282730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300027787|Ga0209074_10067432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1138 | Open in IMG/M |
| 3300027787|Ga0209074_10402925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300027907|Ga0207428_10821193 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300028704|Ga0307321_1034931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
| 3300028710|Ga0307322_10007265 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300028715|Ga0307313_10065012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1084 | Open in IMG/M |
| 3300028717|Ga0307298_10013691 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300028717|Ga0307298_10141401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300028720|Ga0307317_10078007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1084 | Open in IMG/M |
| 3300028720|Ga0307317_10078534 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300028744|Ga0307318_10012241 | All Organisms → cellular organisms → Bacteria | 2746 | Open in IMG/M |
| 3300028771|Ga0307320_10133313 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300028782|Ga0307306_10152057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300028799|Ga0307284_10290944 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300028807|Ga0307305_10205996 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300028824|Ga0307310_10574112 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300028828|Ga0307312_10867816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300028872|Ga0307314_10184147 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300028878|Ga0307278_10001492 | All Organisms → cellular organisms → Bacteria | 11659 | Open in IMG/M |
| 3300028880|Ga0307300_10078207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300028881|Ga0307277_10012256 | All Organisms → cellular organisms → Bacteria | 3304 | Open in IMG/M |
| 3300028881|Ga0307277_10023818 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300028881|Ga0307277_10171356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
| 3300028884|Ga0307308_10369046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
| 3300030336|Ga0247826_10884939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
| 3300030511|Ga0268241_10039800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
| 3300030905|Ga0308200_1169268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300031152|Ga0307501_10246450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300031152|Ga0307501_10271826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300031824|Ga0307413_11596449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300031901|Ga0307406_10170439 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300031903|Ga0307407_10640464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300031938|Ga0308175_100285434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1675 | Open in IMG/M |
| 3300031938|Ga0308175_100585624 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300031938|Ga0308175_102837787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300031996|Ga0308176_12630301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300032180|Ga0307471_101394794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
| 3300032770|Ga0335085_10007393 | All Organisms → cellular organisms → Bacteria | 17060 | Open in IMG/M |
| 3300033412|Ga0310810_11045760 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300034172|Ga0334913_056891 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.45% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.45% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.45% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.45% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.45% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027453 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-D (SPAdes) | Environmental | Open in IMG/M |
| 3300027476 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08.2A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_02217000 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MTNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA |
| ARcpr5yngRDRAFT_0167672 | 3300000043 | Arabidopsis Rhizosphere | LEVMKREKCHCDKPLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRSAFA* |
| ICChiseqgaiiFebDRAFT_113558392 | 3300000363 | Soil | MKNPEKCTCEKPLLRERSEQKGSSESWCGRCKRPLTLRPTVFRSAFS* |
| AF_2010_repII_A1DRAFT_101611681 | 3300000597 | Forest Soil | MTRDQKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPALFRSAFT* |
| AL16A1W_100175732 | 3300000887 | Permafrost | MSKHEKCSCEKPLLQERSEQKGSSESWCGRCKLPLGLRTTVLRSAFT* |
| JGI10214J12806_117801991 | 3300000891 | Soil | LEVMKREKCRCDKPLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRSAFA* |
| JGI10216J12902_1005520264 | 3300000956 | Soil | MKNDDRCTCEKPLLQERSDQKGSSQSWCGRCKRPLALRPAGFRSAFA* |
| JGI10216J12902_1034739432 | 3300000956 | Soil | MTNDKKCTCEKPLLQERSDQKGASQSWCGRCKRPLALRPAGFRSAFA* |
| JGI10216J12902_1100450162 | 3300000956 | Soil | VAKESCTCEKPLLLERSEQKGSSESWCGRRKLPLALRPGVFRSAFA* |
| C688J14111_102002992 | 3300001305 | Soil | GGSRMTKDACTCEKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAFA* |
| A30PFW6_10014803 | 3300001361 | Permafrost | EKCSCEKPLLQERSEQKGSSESWCGRCKLPLGLRTTVLRSAFT* |
| C688J18823_101373912 | 3300001686 | Soil | MTKDACTCEKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAFA* |
| C688J35102_1188404502 | 3300002568 | Soil | MKTDTCTCEKPLMRESSDQKGSSTSWCGRCKKPLSLRLAQFRSAFA* |
| soilH1_101692924 | 3300003321 | Sugarcane Root And Bulk Soil | MKSHEKCNCEKPLLQEQSDHKGSSQSWCGRCKRPLALRPAVFRSAFA* |
| JGI25405J52794_101115571 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MTNDKKCTCEKPLLRERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0055455_100719362 | 3300003990 | Natural And Restored Wetlands | MTKDACTCEKPLLRESSDQKGSSTSWCGRCKKPLALRLAQFRSAFA* |
| Ga0062593_1003770742 | 3300004114 | Soil | MTSQEKCTCEKPLLRERSDQKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0062593_1012319892 | 3300004114 | Soil | MTNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0062589_1003291762 | 3300004156 | Soil | MKTDHCTCEKPVLRERSDQKGSSTSWCGRCKKPLTLRLAQFRSAFA* |
| Ga0062595_1005022542 | 3300004479 | Soil | MKTDHCTCEKPVMRERSDQKGSSTSWCARCKKPLTLRLAQFRSAFA* |
| Ga0062595_1007311092 | 3300004479 | Soil | MKDVAKCSCEKPIPRERSDRKGSSESWCDRCKRPLTLRPG |
| Ga0062595_1009710852 | 3300004479 | Soil | MSNQEKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSA |
| Ga0062594_1003426433 | 3300005093 | Soil | RCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSSFRSAFA* |
| Ga0062594_1026882912 | 3300005093 | Soil | MKTEHCTCEKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAFA* |
| Ga0062594_1032840492 | 3300005093 | Soil | MKPDERCMCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA* |
| Ga0066812_10189922 | 3300005105 | Soil | MKTNEQCTCEKPLLRERSEQKGSSESWCARCKRPIGLRPAVFRSAFS* |
| Ga0066807_10205632 | 3300005161 | Soil | MKNHEQCSCEKPLLQERSEQKGSSESWCARCKRPIGLRPAVFRSAFS* |
| Ga0066674_102075572 | 3300005166 | Soil | MTKNDEKCTCEKPLLQERSEQKGSSQSWCGRCKRPLALRPANFRSAFA* |
| Ga0066810_100582972 | 3300005169 | Soil | MKSKEHCTCERPLLHERSEQKGSSESWCGRCKRPIALRPAVFRSAFT* |
| Ga0066683_108473292 | 3300005172 | Soil | MKSEDKCSCEKPLLQERSDQKGSSQSWCGRCKKPLSLRVTRFRSAFG* |
| Ga0066673_101707962 | 3300005175 | Soil | MKTDAKCTCDKPILRERSAQKGSSQSWCARCKRPLALRSSAFRSAFA* |
| Ga0066688_107397721 | 3300005178 | Soil | MKNEACTCEKPLLRERSDQKGSSTSWCGRCKKPLTLRLAQFRSAFA* |
| Ga0066675_112783802 | 3300005187 | Soil | MKTDAKCTCDKPILRERSDQKGSSQSWCARCKRPLALRSSAFRSGFA* |
| Ga0065705_102793712 | 3300005294 | Switchgrass Rhizosphere | MKDHEKCTCEKPLLQERSEQKGSSESWCGRCKRPITLRPTVFRSAFG* |
| Ga0066388_1000320746 | 3300005332 | Tropical Forest Soil | MKHEKCRCDKPLLQERSEQKGSSVSRCGRCKRPIDLRTGVFRSAFA* |
| Ga0066388_1026443432 | 3300005332 | Tropical Forest Soil | MTNDKKCTCEKPLLRERSDRKGASQSWCGRCKRPLTLRPAGFRSAFA* |
| Ga0068869_1004601022 | 3300005334 | Miscanthus Rhizosphere | MKPDERCTCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSSFRSAFAA* |
| Ga0070668_1000195845 | 3300005347 | Switchgrass Rhizosphere | MSKHEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSSFRSAFA* |
| Ga0070701_111835641 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPDERCTCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA* |
| Ga0066681_103330981 | 3300005451 | Soil | MTKDACTCEKPIMRERSDQKGSSQSWCGRCKKPLSLRPAQFRSAFA* |
| Ga0070706_1007037942 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDAEKCTCEKPLLRERSDQKGSSTNWCGRCKRPLTLRPGVFRSAFA* |
| Ga0068853_1009359602 | 3300005539 | Corn Rhizosphere | PDERCMCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA* |
| Ga0066697_101366051 | 3300005540 | Soil | MTKDACTCEKPIMRERSDQKGSSQSWCGRCKKPLSLRPATFRSAFG* |
| Ga0070695_1001449862 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHEKCRCDKPFLQERSEQKGSSVSRCGRCKRPLDLRPSSFRSAFA* |
| Ga0070695_1007009062 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDAEKCTCEKPLLRERSDQKGSSTNWCGRCKRPLTFRPGVFRSAFA* |
| Ga0066695_101501192 | 3300005553 | Soil | MKNADRCSCDKPVLQEHSDQKGSSQSWCGRCKKPLSLRIALFRSAFV* |
| Ga0066695_102975082 | 3300005553 | Soil | MKEPDKCTCEPLLREWSDQKGSSENWCGRCKRPLTIRPGVFRSAFA* |
| Ga0066698_103685842 | 3300005558 | Soil | MKTEDKCNCEKPLLQERSDQKGSSQSWCGRCKKPLSLRVALFRSAFA* |
| Ga0066670_100547482 | 3300005560 | Soil | MTKDACTCEKPILRERSDQKGSSQSWCARCKRPLALRSSAFRSGFA* |
| Ga0066670_100871831 | 3300005560 | Soil | MKTDAKCTCDKPILRERSAQKGSSQSWCARCKRPLAFRSSAFRSAFA* |
| Ga0066694_105670992 | 3300005574 | Soil | MKTEDKCTCEKPLLRERSDQKGSSQSWCGRCKKPLSLRPA |
| Ga0066654_104972542 | 3300005587 | Soil | MKTDAKCTCDKPILRERSDQKGSSQSWCARCKRPLAFRSSAFRSAFA* |
| Ga0066905_1018216991 | 3300005713 | Tropical Forest Soil | NDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0068861_1023709632 | 3300005719 | Switchgrass Rhizosphere | LHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0066903_1036410051 | 3300005764 | Tropical Forest Soil | MTDDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0066651_102238852 | 3300006031 | Soil | MKTEDKCTCEKPLLRERSDQKGSSQSWCGRCKKPLSLRIAPFRSAFA* |
| Ga0066651_106745622 | 3300006031 | Soil | MTKDACTCEKPILREHSDQKGSSQSWCGRCKKPLSLRPAQF |
| Ga0066696_100265271 | 3300006032 | Soil | MKTDAKCTCDKPILRERSDQKGSSQSWCARCKRPLALRSSAFRSAFA* |
| Ga0066652_1014808902 | 3300006046 | Soil | MTKDVCTCEKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAFA* |
| Ga0075422_106254621 | 3300006196 | Populus Rhizosphere | SPATVGRGGSMTNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLVLRPAGFRSAFA* |
| Ga0074055_117211552 | 3300006573 | Soil | MKTNEQCTCEKPLLRERSEQKGSSESWCARCKRPIGLRPAV |
| Ga0074047_119114492 | 3300006576 | Soil | MKNHEQCTCEKPLLQERSEQKGSSESWCARCKRPIGLRPAVFRSAFS* |
| Ga0074050_119433742 | 3300006577 | Soil | TVDRGGRMKTNEQCTCEKPLLRERSEQKGSSESWCARCKRPIGLRPAVFRSAFS* |
| Ga0074048_134825742 | 3300006581 | Soil | MKSKEHCTCERPLLHERSEQKGSSESWCGRCKRPIALQPAVFRSAFT* |
| Ga0074057_123129822 | 3300006605 | Soil | MKSKEHCTCERPLLHERSEQKGSSESWCGRCKRPIAIGLRPHAT* |
| Ga0079222_103258112 | 3300006755 | Agricultural Soil | MKNSEKCTCDKPILVEHSDKKGSSENWCGRCKRPLTLRPSVFRSAFA* |
| Ga0079222_125249241 | 3300006755 | Agricultural Soil | MNDAKCTCEKPLPKERSDHKGSSKSWCARCKRPLALRPGVVFRSAFG* |
| Ga0079221_103638942 | 3300006804 | Agricultural Soil | MNDAKCTCEKPLPKERSDQKGSSESWCARCKRPLALRPGVVFRSAFG* |
| Ga0079221_107905641 | 3300006804 | Agricultural Soil | MKPDERCTCEKPLLQERSEQKGSSKSSCGRCKRPLA |
| Ga0079220_105514582 | 3300006806 | Agricultural Soil | GGSRMKNSEKCTCDKPILVEHSDKKGSSENWCGRCKRPLTLRPSVFRSAFA* |
| Ga0075431_1012998541 | 3300006847 | Populus Rhizosphere | LEVMKREKCSCDKPLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRSAFA* |
| Ga0075431_1019001261 | 3300006847 | Populus Rhizosphere | MTKNYCTCEKPLLQERSDQKGSSESWCGRCKRSLSLRPAGFRSAFS* |
| Ga0075433_103692802 | 3300006852 | Populus Rhizosphere | MKSPETCRCDKPLLRERSDQKGSSLSWCGRCKRPLALRLAHFRSAFA* |
| Ga0075433_112033472 | 3300006852 | Populus Rhizosphere | KPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0075420_1015960721 | 3300006853 | Populus Rhizosphere | CEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0075425_1012789342 | 3300006854 | Populus Rhizosphere | LEVMKREKCRCDKPLLEERSEQKGSSVSRCGRCKRPIDLRPGVFRSAFA* |
| Ga0075436_1010734731 | 3300006914 | Populus Rhizosphere | MKSPETCRCDKPLLRERSDQKGSSLSWCGRCKRPLA |
| Ga0075436_1011052332 | 3300006914 | Populus Rhizosphere | PLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRSAFA* |
| Ga0066710_1012804032 | 3300009012 | Grasslands Soil | MKTEDKCTCEKPLLRERSDQKGSSQSWCGRCKKPLSLRVALFRSAFA |
| Ga0099827_106038582 | 3300009090 | Vadose Zone Soil | DRMKAEEKCACEKPVLQEQSDQKGSSVSWCGRCKRPLSLRPAVFRSAFA* |
| Ga0066709_1005463052 | 3300009137 | Grasslands Soil | MKNADRCSCDKPVLQEHSDQKGSSQSWCGRCKKPLSLRVALFRSAFV* |
| Ga0114129_102910671 | 3300009147 | Populus Rhizosphere | KCRCDKPLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRSAFA* |
| Ga0105243_104396591 | 3300009148 | Miscanthus Rhizosphere | GGRMKPDERCTCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA* |
| Ga0075423_112699322 | 3300009162 | Populus Rhizosphere | MKSPETCRCDKPLLRERSDQKGSSLSWCGRCKRPLELRLAHFRSAFA* |
| Ga0075423_126708712 | 3300009162 | Populus Rhizosphere | MCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA* |
| Ga0075423_129375132 | 3300009162 | Populus Rhizosphere | TNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0105242_104870073 | 3300009176 | Miscanthus Rhizosphere | MSKQEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA* |
| Ga0126313_100301111 | 3300009840 | Serpentine Soil | CRCDKPLLRERSKQKGSSQSWCGRCKRPLALRTGVFRSAFA* |
| Ga0126313_100683375 | 3300009840 | Serpentine Soil | MKNDARCTCEKPLLQERSDQKGSSQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0126313_102425783 | 3300009840 | Serpentine Soil | MKNDDRCTCEKPLLRERSDQKGSSRSWCGRCKRPLALRPAGFRSAFG* |
| Ga0126313_115881032 | 3300009840 | Serpentine Soil | MKNADKCTCEKPLLQERSDQKGSSQSWCGRCKRPLALRPAGFRSAFA |
| Ga0126309_101263503 | 3300010039 | Serpentine Soil | MKNHEKCTCEKPLLRERSEQKGSSESWCGRCKRPLALRPTVFRSAFS* |
| Ga0126309_105879162 | 3300010039 | Serpentine Soil | MTNAEKCTCEKPLLQERSDQKGSSESWRGRCKRPLALRPGVFRSAFA* |
| Ga0126309_106814662 | 3300010039 | Serpentine Soil | MQSNAKCRCEKPLLRERSKQKGSSQSWCGRCKRPLALRTGVFRSAFA* |
| Ga0126312_101153851 | 3300010041 | Serpentine Soil | MQSNAKCRCDKPLLRERSKQKGSSQSWCGRCKRPLALRTG |
| Ga0126312_105948301 | 3300010041 | Serpentine Soil | MKNDDRCTCEKPLLRERSDQKGSSRSWCGRCKRPLALRP |
| Ga0126314_100007959 | 3300010042 | Serpentine Soil | MQSNAKCRCDKPLLRERSKQKGSSQSWCGRCKRPLALRTGVFRSAFA* |
| Ga0127464_12272551 | 3300010139 | Grasslands Soil | MKTNAKCTCDKPILRERSDQKGSSQSWCARCKRPLALRSSAFRSGFA* |
| Ga0134109_101100472 | 3300010320 | Grasslands Soil | MKTDTCTCEKPILREHSDQKGSSTSWCGRCKKPLSLRVALFRSAFT* |
| Ga0134071_107612652 | 3300010336 | Grasslands Soil | GAIRRVHTMKNADRCSCDKPVLQEHSDQKGSSQSWCGRCKKPLSLRVALFRSAFV* |
| Ga0134062_102015442 | 3300010337 | Grasslands Soil | MKTEDKCTCEKPLLRERSDQKGSSQSWCGRCKKPLSLRVALFRSAFA* |
| Ga0134062_103407692 | 3300010337 | Grasslands Soil | MKEPDKCTCEKPLLREWSDQKGSSENWCGRCKRPLTIRLGVFRSAFA* |
| Ga0134128_105824613 | 3300010373 | Terrestrial Soil | MKTDHCTCEKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAFA* |
| Ga0134126_117731781 | 3300010396 | Terrestrial Soil | MSKQEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLD |
| Ga0134126_124454841 | 3300010396 | Terrestrial Soil | EKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAFA* |
| Ga0138505_1000084162 | 3300010999 | Soil | MSNQEKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFA* |
| Ga0137382_105074063 | 3300012200 | Vadose Zone Soil | MTKDACTCEKPIMRERFDKKGSSQSWCGRCKKPLSLRPATFRSAFG* |
| Ga0137374_107390941 | 3300012204 | Vadose Zone Soil | MEQERCTCEKPLLQERSEQKGSSESWCGRCKRPLSLRPTAF |
| Ga0137372_100456734 | 3300012350 | Vadose Zone Soil | MTNRDNCTCEKPLLQERSDRKGASTSRCGRCKRPITLRPAGFRSAFGLSK* |
| Ga0137371_101033153 | 3300012356 | Vadose Zone Soil | MTKNQDKCTCEKPLLRERSEQKGSSQSWCGRCKRPLALRPANFRSAFG* |
| Ga0137371_102387342 | 3300012356 | Vadose Zone Soil | MKTTDKCNCEKPVLQEHSDQKGSSQSWCGRCKKPLSLRVALFRSAFA* |
| Ga0150984_1162186711 | 3300012469 | Avena Fatua Rhizosphere | MKTDTCTCEKPLMRESSDQKGSSTSWCGRCKKPLSLRLAQFRSA |
| Ga0157344_10307211 | 3300012476 | Arabidopsis Rhizosphere | LEVMKREKCHCDKPLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRS |
| Ga0157349_10113491 | 3300012489 | Unplanted Soil | KPLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRSAFA* |
| Ga0157316_10066422 | 3300012510 | Arabidopsis Rhizosphere | APSGRTATIDRGGRMSKRQTCSCEEPLLRERSDQKGSSQSWCARCKLPLGLRPAGFRSAFS* |
| Ga0137373_111643222 | 3300012532 | Vadose Zone Soil | MTNRDNCTCEKPLLQERSDRKGASTSRCGRCKRPITLRPAGFRSAFG |
| Ga0157285_100022316 | 3300012897 | Soil | MTNDKKCTCEKPLLHERCDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0157302_100818203 | 3300012915 | Soil | LRERSDQKGSSTSWCGRCKKPLTLRLARFRSAFA* |
| Ga0157310_100269822 | 3300012916 | Soil | MTNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFR |
| Ga0126375_111231252 | 3300012948 | Tropical Forest Soil | MTNDQKCTCEKPLLRERSDRKGASQSWCGRCKRPLALRPAGFRSAFA* |
| Ga0134076_104330422 | 3300012976 | Grasslands Soil | MKSEDKCSCEKPLLQERSDQKGSSQSWCGRCKKPLSLRVALFRSAFV* |
| Ga0164305_117280391 | 3300012989 | Soil | MKTDHCTCEKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAF |
| Ga0157373_105385552 | 3300013100 | Corn Rhizosphere | MKTDEKCACEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA* |
| Ga0134078_101511501 | 3300014157 | Grasslands Soil | VKTEDKCTCEKPLLRERSDQKGSSQSWCGRCKKPLSLRVALFRSAFA* |
| Ga0182008_106278952 | 3300014497 | Rhizosphere | MKTEDKCTCEKPLLQEQSDQKGSSQSWCGRCKKPLSLRVALFRSAFA* |
| Ga0132258_101929724 | 3300015371 | Arabidopsis Rhizosphere | MSKRETCSCEKPLLRERSDQKGSSQSWCARCKLPLGLRPAGFRSAFA* |
| Ga0132258_106390951 | 3300015371 | Arabidopsis Rhizosphere | MSKRQTCSCEKPLLRERSDQKGSSQSWCARCKLPLGLRPAGFRSAFS* |
| Ga0132257_10000111316 | 3300015373 | Arabidopsis Rhizosphere | MKREKCHCDKPLLQERSEQKGSSVSRCGRCKRPIDLRPGAFRSAFA* |
| Ga0132255_1022014832 | 3300015374 | Arabidopsis Rhizosphere | MSKRETCSCEKPLLRERSDQKGSSQSWCARCKLPLGLRPAGFRSAFS* |
| Ga0163161_120676911 | 3300017792 | Switchgrass Rhizosphere | MKTEHCTCEKPLLRESSDQKGSSQSWCGRCKKPLTLRLAQFRSAFA |
| Ga0187785_103653512 | 3300017947 | Tropical Peatland | MKNVEHCTCEKPVLRERSEQKGSSESWCGRCKRPIGLRPAAVRSAFS |
| Ga0184605_100165782 | 3300018027 | Groundwater Sediment | MNSQEKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFA |
| Ga0184605_100868271 | 3300018027 | Groundwater Sediment | RAPSAGAARVDRGGRMNSQEKCTCEKPLLQERSDQKGSSESWCGRCKRPLALRPAGFRSAFA |
| Ga0184605_101103702 | 3300018027 | Groundwater Sediment | MNSQEKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFG |
| Ga0187788_101104042 | 3300018032 | Tropical Peatland | MKSKEHCTCERPLLRERSEQKGSGETWCGRCKRPIGLRPAVFRSAFS |
| Ga0184619_100887342 | 3300018061 | Groundwater Sediment | MNSQEKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAF |
| Ga0184619_100971583 | 3300018061 | Groundwater Sediment | MKNADKCTCEKPLLQERSDQKGSSESWCGRCKRPLALRPAGFRSAFA |
| Ga0184619_101151971 | 3300018061 | Groundwater Sediment | HEKCTCEKPIMQERSEQKGSTESWCGRCKRPLALRPAVFRSAFG |
| Ga0184619_104111891 | 3300018061 | Groundwater Sediment | CTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFG |
| Ga0184640_101956942 | 3300018074 | Groundwater Sediment | AKCLQMSKQEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSAFRSAFA |
| Ga0184625_102750452 | 3300018081 | Groundwater Sediment | MSKHEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSAFRSAFA |
| Ga0066655_107636141 | 3300018431 | Grasslands Soil | MKTDAKCTCDKPILRERSDQKGSSQSWCARCKRPLA |
| Ga0066655_108247842 | 3300018431 | Grasslands Soil | CSCEKPLLQERSDQKGSSQSWCGRCKKPLSLRVTRFRSAFG |
| Ga0066655_109590432 | 3300018431 | Grasslands Soil | MTKDACTCEKPIMRERSDQKGSSQSWCGRCKKPLTLRPAQFRSAFA |
| Ga0066667_109106472 | 3300018433 | Grasslands Soil | MKTDAKCTCDKPILRERSDQKGSSQSWCARCKRPLALRSSAFRSGFA |
| Ga0066667_110897081 | 3300018433 | Grasslands Soil | MKNADRCSCDKPVLQEHSDQKGSSQSWCGRCKKPLSLRVALFRSAFV |
| Ga0066669_101010883 | 3300018482 | Grasslands Soil | MTKDACTCEKPIMRERSDQKGSSQSWCGRCKKPLSLRPAQFRSAFA |
| Ga0066669_101320962 | 3300018482 | Grasslands Soil | MKTNAKCTCDKPILRERSDQKGSSQSWCARCKRPLALRSSAFRSGFA |
| Ga0066669_114098472 | 3300018482 | Grasslands Soil | MKTEDKCTCEKPLLRERSDQKGSSQSWCGRCKKPLSLRIAPFRSAFA |
| Ga0173482_103507542 | 3300019361 | Soil | MKTDHCTCEKPVLRERSDQKGSSTSWCGRCKKPLTLRLARFRSAFA |
| Ga0190267_101191122 | 3300019767 | Soil | MNSQEKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFP |
| Ga0193704_10081342 | 3300019867 | Soil | MTNPEKCTCDKPLLQERSEQKGSSESWCGRCKRPLTLRPTVFRSAFS |
| Ga0193704_10721162 | 3300019867 | Soil | KPLLRERSEQKGSSESWCGRCKRPLALRTTVFRSAFS |
| Ga0210381_100020111 | 3300021078 | Groundwater Sediment | MTNPEKCTCDKPLLQERSEQKGSSESWCGRCKRPLTLRPTVFR |
| Ga0193719_101219221 | 3300021344 | Soil | CLLMSKQEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA |
| Ga0193694_10032174 | 3300021415 | Soil | MTKDACTCEKPILRESSDQKGSSQSWCGRCKKPLSLRLAQFRSAFA |
| Ga0182009_102365662 | 3300021445 | Soil | MKTDDTCRCDKPVLRERSDQKGSSLSWCGRCKKPLSLRLARFRSAFA |
| Ga0224452_12136801 | 3300022534 | Groundwater Sediment | SWMSKLEKCTCEKPLLRERSEQKGSSESWCGRCKRPLALRTTVFRSAFS |
| Ga0222622_102254902 | 3300022756 | Groundwater Sediment | MSKQEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA |
| Ga0222622_109662741 | 3300022756 | Groundwater Sediment | ILRERSDQKGSSQSWCGRCKKPLSLRLAQFRSAFA |
| Ga0222622_112988961 | 3300022756 | Groundwater Sediment | PLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFA |
| Ga0247788_10068064 | 3300022901 | Soil | TNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA |
| Ga0247794_100443792 | 3300024055 | Soil | MTSQEKCTCEKPLLRERSDQKGASQSWCGRCKRPLALRPAGFRSAFA |
| Ga0210142_10052242 | 3300025552 | Natural And Restored Wetlands | MTKDACTCEKPLLRESSDQKGSSTSWCGRCKKPLALRLAQFRSAFA |
| Ga0207687_111552161 | 3300025927 | Miscanthus Rhizosphere | KCLQMSKQEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA |
| Ga0207689_104552272 | 3300025942 | Miscanthus Rhizosphere | MKPDERCTCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSSFRSAFAA |
| Ga0207708_114517021 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | KCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA |
| Ga0207702_101004165 | 3300026078 | Corn Rhizosphere | MKTDHCTCEKPVLRERSDQKGSSTSWCGRCKKPLTLRLAQFRSAFA |
| Ga0209266_12985071 | 3300026327 | Soil | MKSEDKCSCEKPLLQERSDQKGSSQSWCGRCKKPLSLRVTRFRSAFG |
| Ga0209473_10519351 | 3300026330 | Soil | MTKDACTCEKPIMRERSDQKGSSQSWCGRCKKPLSLRPATFRSAFG |
| Ga0209473_11029442 | 3300026330 | Soil | MKTDAKCTCDKPILRERSDQKGSSQSWCARCKRPLALRSSAFRSAFA |
| Ga0209267_10463694 | 3300026331 | Soil | MKNEACTCEKPLLRERSDQKGSSTSWCGRCKKPLTLRLAQFRS |
| Ga0209159_11350632 | 3300026343 | Soil | MKNADRCSCDKPVLQEHSDQKGSSQSWCGRCKKPLSLRIALFRSAFV |
| Ga0209805_10186852 | 3300026542 | Soil | MKNEACTCEKPLLRERSDQKGSSTSWCGRCKKPLTLRLAQFRSAFA |
| Ga0207582_10158541 | 3300026960 | Soil | ATVGRGGCMTNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA |
| Ga0207624_1087092 | 3300027453 | Soil | MTNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPIALRPAGFRSAFA |
| Ga0207514_1003891 | 3300027476 | Soil | MTNDKKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPA |
| Ga0209073_103506731 | 3300027765 | Agricultural Soil | EKCTCDKPILVEHSDKKGSSENWCGRCKRPLTLRPSVFRSAFA |
| Ga0209073_105232152 | 3300027765 | Agricultural Soil | MNDAKCTCEKPLPKERSDQKGSSESWCARCKRPLALRPGVVFRSAFG |
| Ga0209177_102827301 | 3300027775 | Agricultural Soil | MKNSEKCTCDKPILVEHSDKKGSSENWCGRCKRPLTLRPSVFRSAFA |
| Ga0209074_100674321 | 3300027787 | Agricultural Soil | SACAAPVVGGGRMKPDERCMCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA |
| Ga0209074_104029251 | 3300027787 | Agricultural Soil | MKPDERCTCEKPLLQERSEQKGSSKSWCGRCKRPLALQPSPFRSAFAA |
| Ga0207428_108211931 | 3300027907 | Populus Rhizosphere | KKCTCEKPLLHERSDRKGASQSWCGRCKRPLALRPAGFRSAFA |
| Ga0307321_10349311 | 3300028704 | Soil | SKQEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA |
| Ga0307322_100072654 | 3300028710 | Soil | MTNPEKCTCDKPLLQERSEQKGSSESWCGRCKRPLTLRPTVF |
| Ga0307313_100650121 | 3300028715 | Soil | GSMKNPEKCTCEKPLLRERSEQKGSSESWCGRCKRPLTLRPTVFRSAFS |
| Ga0307298_100136914 | 3300028717 | Soil | PILRESSDQKGSSQSWCGRCKKPLSLRLAQFRSAFA |
| Ga0307298_101414011 | 3300028717 | Soil | LQMSKHEKCRCDKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA |
| Ga0307317_100780072 | 3300028720 | Soil | MKNPEKCRCEKPLLRERSEQKGSSESWCGRCKRPLALRTTVFRSAFS |
| Ga0307317_100785342 | 3300028720 | Soil | MTKDACTCQKPILRERSDQKGSSQSWCGRCKKPLSLRLAQFRSAFA |
| Ga0307318_100122412 | 3300028744 | Soil | VNSHEKCTCEKPLLKERSDQKGSSESWCGRCKRPISLRPAGFRSAFA |
| Ga0307320_101333131 | 3300028771 | Soil | KCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFA |
| Ga0307306_101520571 | 3300028782 | Soil | MKNPAKCTCAKPLLQERSEQKGSSESWCGRCKLPLTLRPTVFRSAFG |
| Ga0307284_102909441 | 3300028799 | Soil | ADKCTCEKPLLQERSDQKGSSESWCGRCKRPLALRPAGFRSAFA |
| Ga0307305_102059962 | 3300028807 | Soil | NSQEKCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFA |
| Ga0307310_105741122 | 3300028824 | Soil | MHAMKIVDQCTCEKPLLRERSEQKGSSESWCGRCKRPLALRPAGFRSAFA |
| Ga0307312_108678162 | 3300028828 | Soil | MKDEAKCTCEKPLPRERSDRKGSSESWCARCKRPLTLRPGVVFRSAFA |
| Ga0307314_101841471 | 3300028872 | Soil | RGGGSMKNPAKCTCAKPLLQERSEQKGSSESWCGRCKLPLTLRPTVFRSAFG |
| Ga0307278_100014925 | 3300028878 | Soil | MKNQEKCTCEKPLLRERSEQKGSSESWCGRCKRPLALRTAVFRSAFA |
| Ga0307300_100782072 | 3300028880 | Soil | MKNHEKCTCEKPLLRERSEQKGSSESWCGRCKRPLALRPTVFRSAFS |
| Ga0307277_100122565 | 3300028881 | Soil | VKDQAKCTCQKPLLRERSDRKGSSESWCARCKRPLTLRPGVVFRSAFA |
| Ga0307277_100238184 | 3300028881 | Soil | MSEKTEKCICEKPLLQERSEQKGSSQSWCGRCKRPLALRPATFRSAFG |
| Ga0307277_101713561 | 3300028881 | Soil | KCTCEKPLLQERSDQKGSSESWCGRCKRPIALRPAGFRSAFG |
| Ga0307308_103690461 | 3300028884 | Soil | MKNADKCTCEKPLLQERSDQKGSSESWCGRCKRPLALR |
| Ga0247826_108849392 | 3300030336 | Soil | MSNHEKCTCEKPLLQERSDQKGSSESRCGRCKRPIALRPAGFRSAFA |
| Ga0268241_100398002 | 3300030511 | Soil | MKTTLRCTCEKPLLRERSDQKGSSTSWCGRCKRAIALRPAVFRSAFS |
| Ga0308200_11692682 | 3300030905 | Soil | MKNPPKCTFAKPLLQERSEQKGSSESWCGRCKRPLALRPTVFRSAFG |
| Ga0307501_102464502 | 3300031152 | Soil | MNNPEKCTCEKPLLRERSEQKGSSESWCGRCKRPLTLRPTVFRSAFS |
| Ga0307501_102718262 | 3300031152 | Soil | MNSQEKCTCEKPLLQERSDQKGSSESWCGRCKRPLALRPAGFRSAFA |
| Ga0307413_115964492 | 3300031824 | Rhizosphere | KPLLHERSDRKGVSESWCGRCKRPLALRPATFRSAFA |
| Ga0307406_101704392 | 3300031901 | Rhizosphere | MKNDARCTCEKPLLQERSDQKGSSQSWCGRCKRPLALRPAGFRSAFA |
| Ga0307407_106404642 | 3300031903 | Rhizosphere | MKTNEKCTCEKPLLHERSDRKGVSESWCGRCKRPLALRPATFRSAFA |
| Ga0308175_1002854341 | 3300031938 | Soil | DKPLLQERSEQKGSSVSRCGRCKRPLDLRPSVFRSAFA |
| Ga0308175_1005856242 | 3300031938 | Soil | MTNDKKCTCEKPLLQERSDRKGASQSWCGRCKRPLALRPAGFRSAFA |
| Ga0308175_1028377871 | 3300031938 | Soil | MKTDHCTCEKPVLRESSDQKGSSTSWCGRCKKPLTLRLAQFRSAFA |
| Ga0308176_126303012 | 3300031996 | Soil | MKNDVRCTCEKPLLRERSDQKGSSQSWCGRCKRPLALRPAGFRSAFA |
| Ga0307471_1013947942 | 3300032180 | Hardwood Forest Soil | MKSPETCRCDKPLLRERSDQKGSSLSWCGRCKRPLALRLAHFRSAFA |
| Ga0335085_1000739316 | 3300032770 | Soil | MKSEKHCTCERPVLRERSEQKGSGESWCGRCKRPIGLRPAIFRSAFS |
| Ga0310810_110457602 | 3300033412 | Soil | MKTDRCTCEKPVLRERSDQKGSSTSWCGRCKKPLTLRLAQFRSAFA |
| Ga0334913_056891_158_301 | 3300034172 | Sub-Biocrust Soil | MKSDEKCICEKPLLRERSDQKGSSESWCGRCKRPLTLRPAVFRSAFA |
| ⦗Top⦘ |