Basic Information | |
---|---|
Family ID | F021164 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 220 |
Average Sequence Length | 43 residues |
Representative Sequence | VLERGYEGLVAKDPESPYVGGRTLKWLKVKQPRYREGERGWEPKGK |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 220 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 34.10 % |
% of genes near scaffold ends (potentially truncated) | 57.27 % |
% of genes from short scaffolds (< 2000 bps) | 84.09 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (68.636 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.364 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.727 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.41% β-sheet: 0.00% Coil/Unstructured: 94.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 220 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 15.00 |
PF01068 | DNA_ligase_A_M | 5.91 |
PF00072 | Response_reg | 2.27 |
PF00589 | Phage_integrase | 2.27 |
PF09992 | NAGPA | 1.36 |
PF03928 | HbpS-like | 1.36 |
PF02371 | Transposase_20 | 0.91 |
PF02563 | Poly_export | 0.91 |
PF05231 | MASE1 | 0.91 |
PF14534 | DUF4440 | 0.45 |
PF01895 | PhoU | 0.45 |
PF07642 | BBP2 | 0.45 |
PF13560 | HTH_31 | 0.45 |
PF13274 | DUF4065 | 0.45 |
PF00296 | Bac_luciferase | 0.45 |
PF12773 | DZR | 0.45 |
PF13460 | NAD_binding_10 | 0.45 |
PF01381 | HTH_3 | 0.45 |
PF00076 | RRM_1 | 0.45 |
PF01230 | HIT | 0.45 |
PF07769 | PsiF_repeat | 0.45 |
PF00512 | HisKA | 0.45 |
PF02518 | HATPase_c | 0.45 |
PF09360 | zf-CDGSH | 0.45 |
PF13557 | Phenol_MetA_deg | 0.45 |
PF00171 | Aldedh | 0.45 |
PF05494 | MlaC | 0.45 |
PF08334 | T2SSG | 0.45 |
PF13411 | MerR_1 | 0.45 |
PF12965 | DUF3854 | 0.45 |
PF07694 | 5TM-5TMR_LYT | 0.45 |
PF02585 | PIG-L | 0.45 |
PF02627 | CMD | 0.45 |
PF00582 | Usp | 0.45 |
PF16538 | FlgT_C | 0.45 |
PF03479 | PCC | 0.45 |
PF07578 | LAB_N | 0.45 |
PF01145 | Band_7 | 0.45 |
PF01979 | Amidohydro_1 | 0.45 |
PF03795 | YCII | 0.45 |
PF00534 | Glycos_transf_1 | 0.45 |
PF07995 | GSDH | 0.45 |
PF13276 | HTH_21 | 0.45 |
PF13432 | TPR_16 | 0.45 |
PF00535 | Glycos_transf_2 | 0.45 |
PF02801 | Ketoacyl-synt_C | 0.45 |
PF09900 | DUF2127 | 0.45 |
PF13714 | PEP_mutase | 0.45 |
PF04280 | Tim44 | 0.45 |
PF03435 | Sacchrp_dh_NADP | 0.45 |
PF01048 | PNP_UDP_1 | 0.45 |
PF12706 | Lactamase_B_2 | 0.45 |
COG ID | Name | Functional Category | % Frequency in 220 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 15.00 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 5.91 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 5.91 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.91 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.91 |
COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.91 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.45 |
COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.45 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.45 |
COG3952 | Uncharacterized N-terminal domain of lipid-A-disaccharide synthase | General function prediction only [R] | 0.45 |
COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.45 |
COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.45 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.45 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.45 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.45 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.45 |
COG1661 | Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domain | General function prediction only [R] | 0.45 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.45 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.45 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.45 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.64 % |
Unclassified | root | N/A | 31.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000891|JGI10214J12806_10282636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1237 | Open in IMG/M |
3300000956|JGI10216J12902_100194658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2678 | Open in IMG/M |
3300000956|JGI10216J12902_105295437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 738 | Open in IMG/M |
3300000956|JGI10216J12902_107914673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2433 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100364112 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101243965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 634 | Open in IMG/M |
3300004633|Ga0066395_10369159 | Not Available | 801 | Open in IMG/M |
3300005332|Ga0066388_100412054 | Not Available | 1996 | Open in IMG/M |
3300005332|Ga0066388_101063485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_2_69_58 | 1365 | Open in IMG/M |
3300005332|Ga0066388_107991638 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005332|Ga0066388_108386841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
3300005336|Ga0070680_100972137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 733 | Open in IMG/M |
3300005445|Ga0070708_100009776 | All Organisms → cellular organisms → Bacteria | 7744 | Open in IMG/M |
3300005445|Ga0070708_100021987 | All Organisms → cellular organisms → Bacteria | 5406 | Open in IMG/M |
3300005445|Ga0070708_100022784 | All Organisms → cellular organisms → Bacteria | 5317 | Open in IMG/M |
3300005467|Ga0070706_102170828 | Not Available | 501 | Open in IMG/M |
3300005468|Ga0070707_100022405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5972 | Open in IMG/M |
3300005468|Ga0070707_100056394 | All Organisms → cellular organisms → Bacteria | 3768 | Open in IMG/M |
3300005468|Ga0070707_100147603 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
3300005468|Ga0070707_100220053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1849 | Open in IMG/M |
3300005468|Ga0070707_100819436 | Not Available | 895 | Open in IMG/M |
3300005471|Ga0070698_100368040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1369 | Open in IMG/M |
3300005529|Ga0070741_11598360 | Not Available | 534 | Open in IMG/M |
3300005555|Ga0066692_10766423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
3300005764|Ga0066903_100595418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1914 | Open in IMG/M |
3300005764|Ga0066903_102163985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1072 | Open in IMG/M |
3300005764|Ga0066903_104030640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
3300005764|Ga0066903_106390053 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005937|Ga0081455_10533557 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300006047|Ga0075024_100011796 | All Organisms → cellular organisms → Bacteria | 3504 | Open in IMG/M |
3300006058|Ga0075432_10522403 | Not Available | 532 | Open in IMG/M |
3300006173|Ga0070716_100095096 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300006847|Ga0075431_101720326 | Not Available | 584 | Open in IMG/M |
3300006904|Ga0075424_101181830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 814 | Open in IMG/M |
3300006904|Ga0075424_101424832 | Not Available | 736 | Open in IMG/M |
3300006954|Ga0079219_11096333 | Not Available | 674 | Open in IMG/M |
3300007255|Ga0099791_10016009 | All Organisms → cellular organisms → Bacteria | 3191 | Open in IMG/M |
3300007255|Ga0099791_10062296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1681 | Open in IMG/M |
3300007255|Ga0099791_10253765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 834 | Open in IMG/M |
3300007255|Ga0099791_10478702 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
3300007265|Ga0099794_10606866 | Not Available | 580 | Open in IMG/M |
3300007265|Ga0099794_10654333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
3300009038|Ga0099829_10706929 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300009088|Ga0099830_11099262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 659 | Open in IMG/M |
3300009098|Ga0105245_10071160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3158 | Open in IMG/M |
3300009148|Ga0105243_10889577 | Not Available | 885 | Open in IMG/M |
3300009177|Ga0105248_11450826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 777 | Open in IMG/M |
3300009177|Ga0105248_11748174 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300009792|Ga0126374_10099132 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1648 | Open in IMG/M |
3300009819|Ga0105087_1013654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
3300010043|Ga0126380_11829270 | Not Available | 550 | Open in IMG/M |
3300010046|Ga0126384_12412123 | Not Available | 509 | Open in IMG/M |
3300010048|Ga0126373_10724047 | Not Available | 1054 | Open in IMG/M |
3300010048|Ga0126373_12253255 | Not Available | 606 | Open in IMG/M |
3300010358|Ga0126370_10157272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1665 | Open in IMG/M |
3300010358|Ga0126370_12616770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300010359|Ga0126376_10112975 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
3300010359|Ga0126376_10211265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1617 | Open in IMG/M |
3300010359|Ga0126376_10224317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1577 | Open in IMG/M |
3300010359|Ga0126376_11525063 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
3300010359|Ga0126376_12904412 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010360|Ga0126372_10881845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 895 | Open in IMG/M |
3300010360|Ga0126372_12067705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
3300010362|Ga0126377_11912304 | Not Available | 669 | Open in IMG/M |
3300010366|Ga0126379_10787315 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300010376|Ga0126381_101722379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 905 | Open in IMG/M |
3300010376|Ga0126381_102178499 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300010376|Ga0126381_102293103 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300010376|Ga0126381_102387566 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300010396|Ga0134126_12025895 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300010397|Ga0134124_10919868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
3300010398|Ga0126383_10294762 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300010398|Ga0126383_12589822 | Not Available | 591 | Open in IMG/M |
3300010400|Ga0134122_13126940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
3300011270|Ga0137391_10247373 | Not Available | 1546 | Open in IMG/M |
3300011270|Ga0137391_10263502 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300011270|Ga0137391_10274486 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1458 | Open in IMG/M |
3300011270|Ga0137391_10319707 | Not Available | 1337 | Open in IMG/M |
3300011270|Ga0137391_11458364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
3300011271|Ga0137393_10884471 | Not Available | 762 | Open in IMG/M |
3300011271|Ga0137393_11168561 | Not Available | 653 | Open in IMG/M |
3300011271|Ga0137393_11443122 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012034|Ga0137453_1010922 | Not Available | 1304 | Open in IMG/M |
3300012096|Ga0137389_10269561 | Not Available | 1435 | Open in IMG/M |
3300012096|Ga0137389_10972059 | Not Available | 728 | Open in IMG/M |
3300012096|Ga0137389_11210483 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300012096|Ga0137389_11668758 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
3300012174|Ga0137338_1032255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
3300012189|Ga0137388_10318897 | Not Available | 1428 | Open in IMG/M |
3300012202|Ga0137363_11629944 | Not Available | 537 | Open in IMG/M |
3300012203|Ga0137399_10263946 | Not Available | 1415 | Open in IMG/M |
3300012359|Ga0137385_10947792 | Not Available | 711 | Open in IMG/M |
3300012363|Ga0137390_10843059 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300012363|Ga0137390_11645667 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012363|Ga0137390_11701543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 565 | Open in IMG/M |
3300012685|Ga0137397_10397790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1026 | Open in IMG/M |
3300012685|Ga0137397_10905871 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
3300012917|Ga0137395_10132411 | Not Available | 1692 | Open in IMG/M |
3300012917|Ga0137395_10420108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 959 | Open in IMG/M |
3300012923|Ga0137359_10635442 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300012923|Ga0137359_11639565 | Not Available | 531 | Open in IMG/M |
3300012925|Ga0137419_11364413 | Not Available | 597 | Open in IMG/M |
3300012925|Ga0137419_11530848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 566 | Open in IMG/M |
3300012925|Ga0137419_11569193 | Not Available | 559 | Open in IMG/M |
3300012929|Ga0137404_11289762 | Not Available | 673 | Open in IMG/M |
3300012944|Ga0137410_11609266 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012948|Ga0126375_10851925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 727 | Open in IMG/M |
3300012971|Ga0126369_11012877 | Not Available | 918 | Open in IMG/M |
3300012971|Ga0126369_12231346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
3300015085|Ga0167632_1047942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
3300015241|Ga0137418_10291048 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300015241|Ga0137418_11304385 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300015245|Ga0137409_10607512 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 924 | Open in IMG/M |
3300015245|Ga0137409_10749363 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300015264|Ga0137403_10701273 | Not Available | 872 | Open in IMG/M |
3300017973|Ga0187780_10226295 | Not Available | 1307 | Open in IMG/M |
3300017973|Ga0187780_10294655 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Candidatus Latescibacteria bacterium | 1140 | Open in IMG/M |
3300017997|Ga0184610_1001455 | All Organisms → cellular organisms → Bacteria | 5331 | Open in IMG/M |
3300017997|Ga0184610_1052189 | Not Available | 1212 | Open in IMG/M |
3300017997|Ga0184610_1210297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
3300018052|Ga0184638_1054223 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300018052|Ga0184638_1067622 | Not Available | 1307 | Open in IMG/M |
3300018053|Ga0184626_10259698 | Not Available | 727 | Open in IMG/M |
3300018054|Ga0184621_10072308 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300018054|Ga0184621_10269750 | Not Available | 603 | Open in IMG/M |
3300018063|Ga0184637_10031104 | All Organisms → cellular organisms → Bacteria | 3233 | Open in IMG/M |
3300018071|Ga0184618_10088197 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1198 | Open in IMG/M |
3300018075|Ga0184632_10259059 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300018076|Ga0184609_10296790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 756 | Open in IMG/M |
3300018078|Ga0184612_10130215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 1317 | Open in IMG/M |
3300018078|Ga0184612_10413025 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
3300018089|Ga0187774_10330397 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 900 | Open in IMG/M |
3300018422|Ga0190265_12111971 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300018429|Ga0190272_10172236 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300019881|Ga0193707_1090485 | Not Available | 926 | Open in IMG/M |
3300019883|Ga0193725_1023996 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
3300019886|Ga0193727_1054522 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300020001|Ga0193731_1167744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Sungbacteria → Candidatus Sungbacteria bacterium RIFCSPLOWO2_01_FULL_60_25 | 528 | Open in IMG/M |
3300020003|Ga0193739_1049528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1081 | Open in IMG/M |
3300020006|Ga0193735_1160405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
3300020579|Ga0210407_10239108 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia → unclassified Chlamydia → Chlamydia sp. 32-24 | 1414 | Open in IMG/M |
3300020580|Ga0210403_10630814 | Not Available | 863 | Open in IMG/M |
3300021073|Ga0210378_10034480 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_73_47 | 2015 | Open in IMG/M |
3300021078|Ga0210381_10157668 | Not Available | 773 | Open in IMG/M |
3300021081|Ga0210379_10236513 | Not Available | 791 | Open in IMG/M |
3300021086|Ga0179596_10358321 | Not Available | 733 | Open in IMG/M |
3300021178|Ga0210408_10140009 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
3300021178|Ga0210408_10572752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 895 | Open in IMG/M |
3300021178|Ga0210408_11215103 | Not Available | 575 | Open in IMG/M |
3300021178|Ga0210408_11362419 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300021344|Ga0193719_10431620 | Not Available | 538 | Open in IMG/M |
3300021432|Ga0210384_10216932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1721 | Open in IMG/M |
3300021432|Ga0210384_11106588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 695 | Open in IMG/M |
3300021560|Ga0126371_10102054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2860 | Open in IMG/M |
3300021560|Ga0126371_10215428 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2022 | Open in IMG/M |
3300021560|Ga0126371_10319606 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300021560|Ga0126371_11833065 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300022534|Ga0224452_1197793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
3300025910|Ga0207684_10010341 | All Organisms → cellular organisms → Bacteria | 8213 | Open in IMG/M |
3300025910|Ga0207684_10022055 | All Organisms → cellular organisms → Bacteria | 5438 | Open in IMG/M |
3300025910|Ga0207684_10085303 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2690 | Open in IMG/M |
3300025917|Ga0207660_10060146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2730 | Open in IMG/M |
3300025922|Ga0207646_10003299 | All Organisms → cellular organisms → Bacteria | 18386 | Open in IMG/M |
3300025922|Ga0207646_10048976 | All Organisms → cellular organisms → Bacteria | 3786 | Open in IMG/M |
3300025922|Ga0207646_10242299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1629 | Open in IMG/M |
3300025922|Ga0207646_10647387 | Not Available | 947 | Open in IMG/M |
3300025922|Ga0207646_10755484 | Not Available | 868 | Open in IMG/M |
3300025922|Ga0207646_11569632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
3300025927|Ga0207687_11756669 | Not Available | 531 | Open in IMG/M |
3300025939|Ga0207665_10103714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1989 | Open in IMG/M |
3300025941|Ga0207711_11491259 | Not Available | 619 | Open in IMG/M |
3300025941|Ga0207711_11533235 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300026358|Ga0257166_1006106 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300026369|Ga0257152_1004815 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1405 | Open in IMG/M |
3300026369|Ga0257152_1012473 | Not Available | 897 | Open in IMG/M |
3300026480|Ga0257177_1028936 | Not Available | 812 | Open in IMG/M |
3300026481|Ga0257155_1016791 | Not Available | 1025 | Open in IMG/M |
3300026482|Ga0257172_1103701 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300026490|Ga0257153_1115455 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300026494|Ga0257159_1053950 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
3300026498|Ga0257156_1107609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
3300026499|Ga0257181_1006947 | Not Available | 1402 | Open in IMG/M |
3300026499|Ga0257181_1099885 | Not Available | 512 | Open in IMG/M |
3300026508|Ga0257161_1050460 | Not Available | 840 | Open in IMG/M |
3300026514|Ga0257168_1002951 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
3300026514|Ga0257168_1012198 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
3300026514|Ga0257168_1074184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
3300026514|Ga0257168_1142360 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300026551|Ga0209648_10054323 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 3416 | Open in IMG/M |
3300026551|Ga0209648_10082835 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
3300027645|Ga0209117_1014518 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
3300027645|Ga0209117_1019398 | Not Available | 2208 | Open in IMG/M |
3300027645|Ga0209117_1028079 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
3300027655|Ga0209388_1073495 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 985 | Open in IMG/M |
3300027655|Ga0209388_1191043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
3300027727|Ga0209328_10018987 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
3300027894|Ga0209068_10020786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 3196 | Open in IMG/M |
3300028047|Ga0209526_10469096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 825 | Open in IMG/M |
3300028047|Ga0209526_10628533 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 684 | Open in IMG/M |
3300028673|Ga0257175_1005939 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300028719|Ga0307301_10159239 | Not Available | 728 | Open in IMG/M |
3300028771|Ga0307320_10396244 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300028803|Ga0307281_10132346 | Not Available | 863 | Open in IMG/M |
3300028906|Ga0308309_10304546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1348 | Open in IMG/M |
3300029636|Ga0222749_10008384 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4177 | Open in IMG/M |
3300029636|Ga0222749_10605783 | Not Available | 598 | Open in IMG/M |
3300031681|Ga0318572_10678778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
3300031720|Ga0307469_10055330 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
3300031740|Ga0307468_100257229 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
3300031740|Ga0307468_101206248 | Not Available | 682 | Open in IMG/M |
3300031820|Ga0307473_10190640 | Not Available | 1208 | Open in IMG/M |
3300031942|Ga0310916_10352566 | Not Available | 1250 | Open in IMG/M |
3300032059|Ga0318533_11004084 | Not Available | 612 | Open in IMG/M |
3300032063|Ga0318504_10264609 | Not Available | 811 | Open in IMG/M |
3300032180|Ga0307471_102767377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
3300032205|Ga0307472_101040344 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 770 | Open in IMG/M |
3300033433|Ga0326726_10434814 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1248 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.18% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.55% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.09% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.09% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.36% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.45% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.45% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.45% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_102826364 | 3300000891 | Soil | LVGKDEASPYVEGRTLSWLKVKVSKYREVERGFYKPE* |
JGI10216J12902_1001946585 | 3300000956 | Soil | VKPVLERGYEGFVAKDPRSSYVAGRALKWLKVKVPKYREEERGFSNPE* |
JGI10216J12902_1052954373 | 3300000956 | Soil | YEGYVGKDPASRNRGGRTLFWLKVRQPKYREGERGWEPTSKS* |
JGI10216J12902_1079146732 | 3300000956 | Soil | VLAGEGYVAKDPESPYKGGRTLSWLKVKQRDDRVEARGWDNLK* |
JGIcombinedJ26739_1003641122 | 3300002245 | Forest Soil | VAKDPEPPYVPGRTLRWLKVKQPAYREKERGFYKP* |
JGIcombinedJ26739_1012439652 | 3300002245 | Forest Soil | FEGVVAKNPESRYVPGRTLAWLKVKQSHYREGERGWEAKGKPSPT* |
Ga0066395_103691591 | 3300004633 | Tropical Forest Soil | YEGLVGKDESAPYRGGRTLLWLKVRQPNYRDGERGWDPKR* |
Ga0066388_1004120541 | 3300005332 | Tropical Forest Soil | VLERGYEGPVAKDPQSPYVGGRTLKWLKVKVPHYREGERGWEPSKK* |
Ga0066388_1010634852 | 3300005332 | Tropical Forest Soil | LRWQQVLDHAWEGLMAKDPQYLYVGGRTLKWLKVKVPLYREGERGWEARK* |
Ga0066388_1079916382 | 3300005332 | Tropical Forest Soil | LPAKYPASPYRGGRTLAWLKLKVPRYREGSRGWEASSNRG* |
Ga0066388_1083868412 | 3300005332 | Tropical Forest Soil | VERGYEGLVAKDPASLYRGGRTLAWLKVKVPNYREGERGWEAKSSDRG* |
Ga0070680_1009721371 | 3300005336 | Corn Rhizosphere | RGYEGLVGKDEASPYVEGRTLSWLKVKVPHYRDGERGWEPKKS* |
Ga0070708_10000977612 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLAELRQNVLVAKDPASAYVGGRNLKGLKVKQPKYREAERGWEPKGKS* |
Ga0070708_1000219874 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGYEGMVTNDPASPHRGWRTLAWLKMKQPRYREGERGWEPSRKS* |
Ga0070708_1000227849 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLARGYEGLVAKDPASPYVGGRTLKWLKVKQPAYREQERGFYKPE* |
Ga0070706_1021708282 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LQEVLARGYEGMVTKDPPSPHRGRRTLAWLKVKQPRHREGERGWEPKGKS* |
Ga0070707_1000224056 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKGYEGLVPKDPASPYSAGRTLSWLKVKVPHYRESERGWVPKR* |
Ga0070707_1000563941 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVVARGYEGLVAKDPESRYVSGRTPAWLKVKQTRHREGERGWEAKR* |
Ga0070707_1001476031 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | WEEVLARGYEGLVAKDPASPYVGGRTLAWLKVKQPRYREGERGWETKT* |
Ga0070707_1002200532 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VLARGYEGLVGKEEGSLSREDRTIAWLKVKQPRYREGQRGWETKT* |
Ga0070707_1008194362 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VERRCRGIVAKDPQSPYHVGQTLSWLKVKQPKYREVERGFCKP* |
Ga0070698_1003680402 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AQVLERGYEGLVGKDEASPYREGRTLSWLKVKQPRYREGKRGWEPSHKS* |
Ga0070741_115983602 | 3300005529 | Surface Soil | MVAKDPESKYVGDRTLKWLKVKQPKYREEERGFYRPE* |
Ga0066692_107664232 | 3300005555 | Soil | VLEHGYEGLVAKDPESRYVGGRTLKWLKVKQPHYREGERGWEPKKED* |
Ga0066903_1005954182 | 3300005764 | Tropical Forest Soil | VWAQVVERGYEGLVARDPLSSHRGGRLLAWLKVKVPNHREAERGWEPEA* |
Ga0066903_1021639851 | 3300005764 | Tropical Forest Soil | WAQVLEGGYEGLVAKDLASPYRGGRPPAWLKIMPHYREGERCWEPKG* |
Ga0066903_1040306401 | 3300005764 | Tropical Forest Soil | ERGYEGLVAEDPASRYRGGRTLAWLKVRMPHYREGERGWEPPPSDRD* |
Ga0066903_1063900532 | 3300005764 | Tropical Forest Soil | LVAKDSASSYRAGRTVAWLKVKVARYLEGERGWEAKASSRG* |
Ga0081455_105335572 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VAKDPASPYRGERTLKWLKVKVPKYREGERGWNAE* |
Ga0075024_1000117965 | 3300006047 | Watersheds | MVGKDPASPYVAERSLKWLKVKIPKYREEERGFYKP* |
Ga0075432_105224031 | 3300006058 | Populus Rhizosphere | LRAGYEGLVAKDPAAPYVGGRTLKWLKVKQPKYREVERGFYKP* |
Ga0070716_1000950965 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLERGYEGMVGKDEASPYTEGRTPSWLKVKQPKYREGERGWEPKGK* |
Ga0075431_1017203261 | 3300006847 | Populus Rhizosphere | VERGYEGLVGKDEASPYREGRSLPWLKVKVPKYRAGERGRGPSR* |
Ga0075424_1011818302 | 3300006904 | Populus Rhizosphere | AWKEVMERGYEGLVAKDPASPYVGGRTLKWLKVKQVKYREEERGFYKP* |
Ga0075424_1014248322 | 3300006904 | Populus Rhizosphere | LAAKDPASPYVGGRSLKWLKVKQPKYREGERGFYKP* |
Ga0079219_110963333 | 3300006954 | Agricultural Soil | YVGKDPDSPYVAGRSLKWLKVRVPKYCEKEREFYKP* |
Ga0099791_100160091 | 3300007255 | Vadose Zone Soil | MMKLVAKDPASPYVGGRTLKWLKVKQPKYREVERGFYMP* |
Ga0099791_100622963 | 3300007255 | Vadose Zone Soil | VLECDYEGLVAKDPLSVYVGGRTLSWLKGKVPKYREGERGWEAKDKS* |
Ga0099791_102537652 | 3300007255 | Vadose Zone Soil | VLERGYEGLVAKDPASPYVGGRTLKWLKVKQPAYREAERGFYKP* |
Ga0099791_104787021 | 3300007255 | Vadose Zone Soil | EVLTRGYEGLVAKDPASPYVGGRALKWLKVKQPKYREAARGFYKP* |
Ga0099794_106068663 | 3300007265 | Vadose Zone Soil | AKDPASPYRGGRTLKWLKVKQPAYREKERGFYKP* |
Ga0099794_106543332 | 3300007265 | Vadose Zone Soil | VLERGYEGLVAKDPQSAYRAGRTLSWLKVKQRDYRVVERGWYR |
Ga0099829_107069291 | 3300009038 | Vadose Zone Soil | LTRGWEGYVAEDPTSPYVGGRTLKWLKVKQREYRVEARGFYKP* |
Ga0099830_110992622 | 3300009088 | Vadose Zone Soil | ARGFEGIVAKNPASRYVPGRTVAWLKVKQPHYREGERGWEPKQ* |
Ga0105245_100711606 | 3300009098 | Miscanthus Rhizosphere | WAQAVHKGYEGMVAKDPESPYAGGRTLRWLKVTQPHYREGERGWEPKR* |
Ga0105243_108895772 | 3300009148 | Miscanthus Rhizosphere | VHKGYEGMVAKDPESPYAGGRTLRWLKVTQPHYREGERGWEPKR* |
Ga0105248_114508262 | 3300009177 | Switchgrass Rhizosphere | VMVRGYEGLVAKDPASPYRGGRTLSWLKVKQPEYRVDERGWSQR* |
Ga0105248_117481741 | 3300009177 | Switchgrass Rhizosphere | MVRGYEGLVAKDPASPYRGSRTLSWLKVKQPDYRVEERGWSQR* |
Ga0126374_100991321 | 3300009792 | Tropical Forest Soil | EAWKEVLERGYEGLVGKDESAPYRGGRTLLWLKVRQPNYRDGERGWDSKR* |
Ga0105087_10136541 | 3300009819 | Groundwater Sand | MVERGYEGIMAKDPASPYVEGRSLLWLKVKQCDYRVEKRGWATERK* |
Ga0126380_118292701 | 3300010043 | Tropical Forest Soil | GLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPRR* |
Ga0126384_124121232 | 3300010046 | Tropical Forest Soil | EGLVAKDPESRYVGGRSLKWLKVKQLKDRKGERGWEPMKKS* |
Ga0126373_107240471 | 3300010048 | Tropical Forest Soil | KDASSPYRAGRTLAWLKVKVPNYREGERGWEAKGKR* |
Ga0126373_122532553 | 3300010048 | Tropical Forest Soil | VLERGYEGFVADPASSYRGGGTLAWLKVKVPRYREGERSWGSKPSGSLG* |
Ga0126370_101572721 | 3300010358 | Tropical Forest Soil | AWKEVLERGYEGLVGKDESAPYRGGRTLLWLKVRQPNYRDGERGWDSKR* |
Ga0126370_126167702 | 3300010358 | Tropical Forest Soil | VWREVLERGYEGLVGKDESAPCRGGRTLLWLKVRQPNYREGERGWDPKR* |
Ga0126376_101129753 | 3300010359 | Tropical Forest Soil | VLARGYEGLVAKDDSAAYVGGRTLRWLKVKQAKYREGERGWEPKR* |
Ga0126376_102112651 | 3300010359 | Tropical Forest Soil | LARGYEGLVAKDDSAAYVGGRTLRWLKVKQPRYREGERGWEASKK* |
Ga0126376_102243174 | 3300010359 | Tropical Forest Soil | EVLERGYEGLVGKDESAPYRGGRTLLWLKVRQPNYRDGERGWDSKR* |
Ga0126376_115250631 | 3300010359 | Tropical Forest Soil | EAWREVLERGYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR* |
Ga0126376_129044121 | 3300010359 | Tropical Forest Soil | MLKDDASPYVGGRALRWLKVKVPRYREGERGWEASR* |
Ga0126372_108818452 | 3300010360 | Tropical Forest Soil | GKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR* |
Ga0126372_120677051 | 3300010360 | Tropical Forest Soil | LKDDASPYVRGRALKWLKVKQPKYREGERGWESGKK* |
Ga0126377_119123042 | 3300010362 | Tropical Forest Soil | YEGMVAKDESSPYKGGRTLSWLKVKQPNYREGERGWEPTGKA* |
Ga0126379_107873152 | 3300010366 | Tropical Forest Soil | LERGYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPRQ* |
Ga0126381_1017223792 | 3300010376 | Tropical Forest Soil | CRGLVGKDSPSPYRGARTLAWLKVKVPNYREGERGWEQ* |
Ga0126381_1021784992 | 3300010376 | Tropical Forest Soil | RGYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR* |
Ga0126381_1022931032 | 3300010376 | Tropical Forest Soil | VLERGYEGFVADPASSYRGGGTLAWLKVKVPRYREGERGWESKPSGSLG* |
Ga0126381_1023875661 | 3300010376 | Tropical Forest Soil | VIESGYEGLVAKDSASPYPAGRTLACLKVKVPNYREGERGWEAKATG* |
Ga0134126_120258951 | 3300010396 | Terrestrial Soil | VRGYEGLVAKDPESPYCAGRTLSWLKIKQPKYREVERGFYKP* |
Ga0134124_109198681 | 3300010397 | Terrestrial Soil | AGYEGLVAKDPASPYVGGRTLKWLKVKEPKYREGERRWEPKGKS* |
Ga0126383_102947622 | 3300010398 | Tropical Forest Soil | VTRQDVEAAAWREVLARGYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWD |
Ga0126383_125898222 | 3300010398 | Tropical Forest Soil | VAKDATSAYQAGRTLTWLKVKVPNYREGERGWEVNPRNRGHVPRVRP* |
Ga0134122_131269402 | 3300010400 | Terrestrial Soil | VLERGYEGLVGKDEASPYMEGRTLSWLKAKVPHYREGERGWEPKI* |
Ga0137391_102473733 | 3300011270 | Vadose Zone Soil | EHGYEGLVAKDPASLYVGGRTLRWLKVKVSKYREAERGFYKP* |
Ga0137391_102635022 | 3300011270 | Vadose Zone Soil | LTRGWEGYVAEDPTSPYVGGRTLKWLKVKQPAYCVEERGFYKP* |
Ga0137391_102744863 | 3300011270 | Vadose Zone Soil | VIERGYEGLVAKDPASPYVGGRTLSWLKVKQRGYRVEERGW* |
Ga0137391_103197072 | 3300011270 | Vadose Zone Soil | VGEVLKRGSEGLVGKDEASVYVEARTLSWLKVKQARYREGERGWEPKT* |
Ga0137391_114583641 | 3300011270 | Vadose Zone Soil | MVAKDPASPYVGGRTLTWLKVKQPEYRVEARAFYKP* |
Ga0137393_108844711 | 3300011271 | Vadose Zone Soil | DPQSPYRAGRTLSWLKVKQRDYRVVERGWYKPSARA* |
Ga0137393_111685612 | 3300011271 | Vadose Zone Soil | VGRRGSERHEGLVAKDPASAYVGGRSLKGLKVKQPKYREVERGFYKP* |
Ga0137393_114431222 | 3300011271 | Vadose Zone Soil | VAKDPESRYVGGRSLKWLKVKQPHYREGERGWEPKG* |
Ga0137453_10109222 | 3300012034 | Soil | MLERGYEGLVGKDETSPYVEGRTLSWLKVKVPRYREGER |
Ga0137389_102695611 | 3300012096 | Vadose Zone Soil | GYEGMVGKDPESPYVGGRTLSWLKVKQAEYRVIERGWSNA* |
Ga0137389_109720591 | 3300012096 | Vadose Zone Soil | HRGWEGYVAKDPASPYVGGRTLKWLTVKQREYRVEARGFYKP* |
Ga0137389_112104832 | 3300012096 | Vadose Zone Soil | MSPNQDPASPYRGGRTLSWLKVKQPHYRGGERGWEAKGKP* |
Ga0137389_116687582 | 3300012096 | Vadose Zone Soil | VAKDPTSSYVGGRSLKWLKVKQPKYREGERGWETKP* |
Ga0137338_10322553 | 3300012174 | Soil | VLHRGYEGIVAKDPESPCVAGRTLRWLKVKQAKYREEERGFYKP* |
Ga0137388_101430182 | 3300012189 | Vadose Zone Soil | MVGKDPESPYVGGRTLSWLKVKQAEYRVIERGWSNA* |
Ga0137388_103188971 | 3300012189 | Vadose Zone Soil | SDRLPESRKGLVAKDPGPSYVDGRTLKWLKVKQPKYREGERGWEPKGK* |
Ga0137363_116299441 | 3300012202 | Vadose Zone Soil | VANDPLSASVGGRTFSWLKVKVPKYREGERGWEPKG |
Ga0137399_102639463 | 3300012203 | Vadose Zone Soil | MVAKDPESPYVAGRTLKWLKVKVRNYRVKERGWE* |
Ga0137385_109477922 | 3300012359 | Vadose Zone Soil | VIAQGYEGLVAKDPASKYVAGRTLQWFKVKHPQYRVGERGWEPTR* |
Ga0137390_108430592 | 3300012363 | Vadose Zone Soil | VIEHGYEGLVAKDPASLYVGGRTLRWLKVKVSKYREAARGWHR* |
Ga0137390_116456672 | 3300012363 | Vadose Zone Soil | EHGYEGLVAKDPASPYAGGRTLRWLKVKQPRYREGARG* |
Ga0137390_117015432 | 3300012363 | Vadose Zone Soil | VLERGYEGLVGKDESAPYRRGRALSWLKVRQRDYRVEERGWDPRGK |
Ga0137397_103977902 | 3300012685 | Vadose Zone Soil | AEVLECDYEGLVAKDPLSVYVGGRTLSWLKGKVPKYREGERGWEAKDKS* |
Ga0137397_109058711 | 3300012685 | Vadose Zone Soil | VLEHGHEGLVAKDPASPYVGGRTLKWLKVKQLEYRVEERG |
Ga0137395_101324112 | 3300012917 | Vadose Zone Soil | VLECDYEGLVAKDPLSVYVGGRTLSWLKRKVPKYREGERGWEAKDKS* |
Ga0137395_104201082 | 3300012917 | Vadose Zone Soil | GLGEVLEHGYEGLVAKDPRSPYVGGRTLKWLKVKQPKYREVERGFYKP* |
Ga0137359_106354421 | 3300012923 | Vadose Zone Soil | EVLERGYEGLVAKDPQSPYVGGRTLKWLKVKQPHYREGERGWEPKGT* |
Ga0137359_116395651 | 3300012923 | Vadose Zone Soil | GLVAKDPASPYRAGRTLAWLKVKQREYRVEARGFYNKP* |
Ga0137419_113644132 | 3300012925 | Vadose Zone Soil | ERGYEGLVGKDEASPYVEGRTLSWLKVKVPRYREGERGWEPK* |
Ga0137419_115308482 | 3300012925 | Vadose Zone Soil | VIERGYEGLVGKDEASPYREGRSLSWLKVKVPKYREGERG* |
Ga0137419_115691931 | 3300012925 | Vadose Zone Soil | EGLVGKDPESPYVGGRTLKWLKVKVPKYREVERAFYKP* |
Ga0137404_112897622 | 3300012929 | Vadose Zone Soil | VLRRGYEGLVAKDERSAYVEGRTRAWRKVKVPKYREVERGFYK* |
Ga0137410_116092661 | 3300012944 | Vadose Zone Soil | KGYEGLVAKDPESPYVGGRTLKWLKVKVPHYRAGERGWESKQ* |
Ga0126375_108519252 | 3300012948 | Tropical Forest Soil | MKEWVAKDEASPYKGGRTLSWLKVRQPNYREGERGWEPTGKS* |
Ga0126369_110128771 | 3300012971 | Tropical Forest Soil | EGLVAKDAASPYRGGRTLAWLKVKVQHYRKGERGWVPKPSDRG* |
Ga0126369_122313463 | 3300012971 | Tropical Forest Soil | ERGYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR* |
Ga0167632_10479422 | 3300015085 | Glacier Forefield Soil | MVGKDPASPYVAGRSLKWLKVKVPKYREMERGFYKP* |
Ga0137418_102910482 | 3300015241 | Vadose Zone Soil | VLERGYEGMIGKDEASPYREGRTLAWLKVKVPRYREGERGWEPSQKS* |
Ga0137418_113043851 | 3300015241 | Vadose Zone Soil | VIERGYEGLVGKDEASPYREGRSLSWLKVKVPKYHEGERGWDPKR* |
Ga0137409_106075122 | 3300015245 | Vadose Zone Soil | VLERGYEGLVTKDPVSPYVGGRTLKWLKVKQPKYREVERAFYKP* |
Ga0137409_107493632 | 3300015245 | Vadose Zone Soil | VLRRGYEGLVAKDERSSYVEGRTRAWRKVKVPKYREVERGFYK* |
Ga0137403_107012731 | 3300015264 | Vadose Zone Soil | VLERGYDGMMIGKDEASPYREGRTLAWLKVKVPRYREGERGWEPKT* |
Ga0187780_102262953 | 3300017973 | Tropical Peatland | AKDPASLYVAGRTLRWLKVKVAKYREGERGWESAKK |
Ga0187780_102946551 | 3300017973 | Tropical Peatland | GVVAKDPQSLYVGGRTLRWLKVKQLQYREGKRGWEARK |
Ga0184610_10014554 | 3300017997 | Groundwater Sediment | MVGKDPESPYVGGRTLKWLKVKVPKYREEERGFYKP |
Ga0184610_10521892 | 3300017997 | Groundwater Sediment | VLERGYEGLVGKDEASPYREGRALSWLKVKQPRYREGERGWEPQKS |
Ga0184610_12102972 | 3300017997 | Groundwater Sediment | ERGYEGLVGKDEASPYREGRTLAWLKVKVPHYREGERGWEPQKS |
Ga0184638_10542231 | 3300018052 | Groundwater Sediment | VLERGYEGLVGKDEASPYREGRTLSWLKVKQRDYRVAERGWDPKH |
Ga0184638_10676221 | 3300018052 | Groundwater Sediment | MVGKDDSSPYREGRTLSWLKVKQLHYREGERGWEPKR |
Ga0184626_102596981 | 3300018053 | Groundwater Sediment | ARLRGLVGKDEASSYREGRTLAWLKVKVPHYREGERGWEPQKS |
Ga0184621_100723082 | 3300018054 | Groundwater Sediment | GWEGYVAKDPTSPYVGGRTLKWLKVKQAKYREEERGFYKP |
Ga0184621_102697503 | 3300018054 | Groundwater Sediment | GLVGKDKGSAYAEGRTLAWLKVKQPKYREGERGWEPKT |
Ga0184637_100311041 | 3300018063 | Groundwater Sediment | QVLERGYEGMVGKDDSSPYREGRTLSWLKVKQPNYREGERGWESRH |
Ga0184618_100881972 | 3300018071 | Groundwater Sediment | VLRRGYEGLVAKDPASPYVEGRTLAWRKVKVKDYRVQERGFYKST |
Ga0184632_102590592 | 3300018075 | Groundwater Sediment | VLERGYEGLVGKDEASPYREGRTLSWLKVKQRDYRVEERGWTPGNKS |
Ga0184609_102967902 | 3300018076 | Groundwater Sediment | FEAWAQVLERGYEGLVGKDEASPYREGRTLSWLKVKQPKYREGERGWEPQKS |
Ga0184612_101302152 | 3300018078 | Groundwater Sediment | YEGLVGKDEASPYTEGRTLSWLKVKVPHYREGERGWEPKRARV |
Ga0184612_104130251 | 3300018078 | Groundwater Sediment | WQEAMEKGYEGLVAKDPASPYVGGRTLKWLKVKQRDYRVAERGWDPKH |
Ga0187774_103303971 | 3300018089 | Tropical Peatland | LVERGYEGLVAKNAGPPYRGGRTLAWLKVKVPRYREGERGWEARPASDRG |
Ga0190265_121119711 | 3300018422 | Soil | HKGYEGLVGKDPESPYLGGRTLNWLKVKQPAYREGERGWEPRRERT |
Ga0190272_101722361 | 3300018429 | Soil | RSSGGRPLLGKDEASAYMESRTLSWLKVKVPHYREGERGWEPKKS |
Ga0193707_10904852 | 3300019881 | Soil | MVGKDPEAPYVGGRTLKWLKVKIPKYREQERGFYKP |
Ga0193725_10239962 | 3300019883 | Soil | LTRGWEGYVAEDPTSPYVGGRTLKWLKVKQPAYCVEERGFYKP |
Ga0193727_10545222 | 3300019886 | Soil | VLERGYEGLVGKDEASAYVEGRTLAWLKVTVPHCREGERGWESKTS |
Ga0193731_11677441 | 3300020001 | Soil | LLRGAEVLHRGYEGMVAKDPESKYVGGRTLKWLKVKQPHYREGERGWEPK |
Ga0193739_10495282 | 3300020003 | Soil | VLERGYEGLVGKDEASPHREGRTLSWLKVKQPRYREGERAGS |
Ga0193735_11604051 | 3300020006 | Soil | FEGIVAKNPEALYVSGRTLAWIKVKQPHYREGERGWEPKGKS |
Ga0210407_102391082 | 3300020579 | Soil | VLERGYEGLVAKDPESLYVGGRTLKWLKVKQPHYREGERGWEAKK |
Ga0210403_106308142 | 3300020580 | Soil | GIVAKNPESRYVPGRSLAWLKVKQPHYREGERGWEAKRVAG |
Ga0210378_100344801 | 3300021073 | Groundwater Sediment | GYVGLVGKDEASPYREGRTLSWLKVKQPRYREGERGWEPQKS |
Ga0210381_101576681 | 3300021078 | Groundwater Sediment | VHKGYEGLVGKDPESPYVGGRTLKWLKVKVPHYREGERGWEPKDRS |
Ga0210379_102365132 | 3300021081 | Groundwater Sediment | RGYEGLVGKDEASPYVEGRTLSWLKVKVPHYREGERGWEPTRGRA |
Ga0179596_103583212 | 3300021086 | Vadose Zone Soil | VVHRGWEAYVAKDPASPSVGGRTLKWLKVKQPKCREGERCCEPKKS |
Ga0210408_101400093 | 3300021178 | Soil | WKDVLRAGYEGLVAKDPASPYVGGRTLKWLKVKQPKYREVERGF |
Ga0210408_105727522 | 3300021178 | Soil | VIERGYEGLVAKDPQSAYVGGRTLKWLKVKQPHYREGERGGEPQGKS |
Ga0210408_112151032 | 3300021178 | Soil | AKDPESPYVGGRTLKWLKVKVPHYREGERGWEPTR |
Ga0210408_113624192 | 3300021178 | Soil | VTKDNASRYVDGRTLKWLKVKQPKYREGERGWEPAKK |
Ga0193719_104316202 | 3300021344 | Soil | LERGYEGLLAKDESSPYRGGRTLSWITVRQRAYRVVERGWELEGSR |
Ga0210384_102169322 | 3300021432 | Soil | VLARGYEGLVAKDPASVYVGGRTLNWLKVKVPKYREGERGWEATRR |
Ga0210384_111065881 | 3300021432 | Soil | VLEHGHEGLVAKDPASPYVGGRTLKWLKVKQSHYREGERGWEPKEQIVAHLSRVM |
Ga0126371_101020547 | 3300021560 | Tropical Forest Soil | RGYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR |
Ga0126371_102154281 | 3300021560 | Tropical Forest Soil | VLERGYEGFVADPASSYRGGGTLAWLKVKVPRYREGERGWESKPSGSLC |
Ga0126371_103196064 | 3300021560 | Tropical Forest Soil | LVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPRQ |
Ga0126371_118330651 | 3300021560 | Tropical Forest Soil | YEGLVAKDPASPYRSGRTVAWLKVKVPNYREGERGWEPKG |
Ga0224452_11977932 | 3300022534 | Groundwater Sediment | MVAKDPESKYVGGRTLKWLKVKQPHYREGARGWEPK |
Ga0207684_100103411 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLARGYEGLVGKEEGSLSREDRTIAWLKVKQPRYREGQRGWETKT |
Ga0207684_100220559 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLARGYEGLVAKDPASPYVGGRTLKWLKVKQPAYREQERGFYKPE |
Ga0207684_100853031 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | WVAKDPESPYVGGRTLKWLKFKQPKYREVERGFYKP |
Ga0207660_100601465 | 3300025917 | Corn Rhizosphere | VLERGYEGLVGKDEASPYVEGRTLSWLKVKVPHYRDGERGWEPKKS |
Ga0207646_100032996 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKGYEGLVPKDPASPYSAGRTLSWLKVKVPHYRESERGWVPKR |
Ga0207646_100489761 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVARGYEGLVAKDPESRYVSGRTPAWLKVKQTRHREGERGWEAKR |
Ga0207646_102422991 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIERGYEGLVAKDPQTAYVGGRTLKWLKVKQPHYREGERGWEPQGKS |
Ga0207646_106473873 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VARGFEGIVAKNSESRYVPGRTLAWLKVKQPHYREGKRGWEAKSKS |
Ga0207646_107554842 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEKGFEGLVVKGPHMSPYVGVRTLKWLKVKQPRYREGERGWEPKK |
Ga0207646_115696322 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LERGYEGLVAKDPASPYRAGRTLSWLKVKQPKYREEERGFYRP |
Ga0207687_117566691 | 3300025927 | Miscanthus Rhizosphere | WAQAVHKGYEGMVAKDPESPYAGGRTLRWLKVTQPHYREGERGWEPKR |
Ga0207665_101037142 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLERGYEGMVGKDEASPYTEGRTPSWLKVKQPKYREGERGWEPKGK |
Ga0207711_114912592 | 3300025941 | Switchgrass Rhizosphere | EGLVAKDPASPYRGGRTLSWLKVKQPDYRVEERGWSQHAGSRPDR |
Ga0207711_115332351 | 3300025941 | Switchgrass Rhizosphere | MVRGYEGLVAKDPASPYRGSRTLSWLKVKQPDYRVEERGWSQR |
Ga0257170_10250232 | 3300026351 | Soil | MVGKDPESPYVGGRTLSWLKVKQAEYRVIERGWSNA |
Ga0257166_10061064 | 3300026358 | Soil | VLERGYEGLVAKDPESPYVGGRTLKWLKVKQPRYREGERGWEPKGK |
Ga0257152_10048153 | 3300026369 | Soil | CDYEGLVAKDPLSVYVGGRTLSWLKGKVPKYREGERGWEAKDKS |
Ga0257152_10124731 | 3300026369 | Soil | WQQVVEHGYEGLVARDPSSPYVGGRPLKCLKVKQRDYRVAERGWDPKP |
Ga0257177_10289361 | 3300026480 | Soil | VLECDYEGLVAKDPLSVYVGGRTLSWLKGKVPKYREGERGWE |
Ga0257155_10167912 | 3300026481 | Soil | VLECDYEGLVAKDPLSVYVGGRTLSWLKGKVPKYREGERGWEAKDK |
Ga0257172_11037011 | 3300026482 | Soil | GYEGLVAKDPKSPYVGGRTLKWLKVKQRDYRVEERGWSTQSS |
Ga0257153_11154552 | 3300026490 | Soil | VLTRGYEGLVAKDPASPYVGGRTLSWLKVKQPHYREGERGWEAKGKS |
Ga0257159_10539501 | 3300026494 | Soil | MLEHGHEGLVAKDPASPYVGGRTLKWLKVKQLEYRVEERGWDPGN |
Ga0257156_11076091 | 3300026498 | Soil | EGLVAKDPASPYVGGRTLSWLKVKQPHYREGERGWEAKGKS |
Ga0257181_10069471 | 3300026499 | Soil | QAIHKGYEGMVGKDPESPYVGGRTLSWLKVKQAEYRVIERGWSNA |
Ga0257181_10998851 | 3300026499 | Soil | GLVAKDPESRYVGGRSLKWLKVKQPNYREGERGWEPKGK |
Ga0257161_10504603 | 3300026508 | Soil | EGLVAKDPQSPYRSGRTLSWLKVKQPKYRAEERGFYKP |
Ga0257168_10029516 | 3300026514 | Soil | SRDYEGLVAKDPASPYVGGRTLKWLKVQQPKYREGGRGWEP |
Ga0257168_10121981 | 3300026514 | Soil | MMKLVAKDPASPYVGGRTLKWLKVKQPKYREVERGFYMP |
Ga0257168_10741841 | 3300026514 | Soil | QVLERGYEGLVAKDPASPYVGGRTLKWVKVKQPKYREGERGWESKGKS |
Ga0257168_11423601 | 3300026514 | Soil | VIERGYEGPVARYMGGRTLKWLKVKQPRYREGERGWEPKR |
Ga0209648_100543233 | 3300026551 | Grasslands Soil | VAKDPEWPYSGGRTLKWIKAKAPKYREGERGWELKR |
Ga0209648_100828354 | 3300026551 | Grasslands Soil | VIERGYEGLVAKDPASPYVGGRTLSWLKVKQRGYRVEERGW |
Ga0209117_10145181 | 3300027645 | Forest Soil | VAKNPESRYVPGRALAWIKVKQPNYREGERGWEPKR |
Ga0209117_10193985 | 3300027645 | Forest Soil | VLARGYEGPVAKDPGPPYVGGRALSWLKVKQPKYREVERGFYKPK |
Ga0209117_10280793 | 3300027645 | Forest Soil | VQERGYEGFVAKDESSPYAGGRTLSWLKVKQAEERG |
Ga0209388_10734951 | 3300027655 | Vadose Zone Soil | VLECDYEGLVAKDPLSVYVGGRTLSWLKGKVPKYREGERGWEAKDKS |
Ga0209388_11910432 | 3300027655 | Vadose Zone Soil | VLERGYEGLVAKDPASPYVGGRTLKWLKVKQPAYREAERGFYKP |
Ga0209328_100189871 | 3300027727 | Forest Soil | DAEAEGLVAKDPESRYVGGRSLKWLKVKQPHYREGERGWEPRGKS |
Ga0209068_100207863 | 3300027894 | Watersheds | MVGKDPASPYVAERSLKWLKVKIPKYREEERGFYKP |
Ga0209526_100510024 | 3300028047 | Forest Soil | MVGKHPESPYVAGRSLKWLKVKVPNYRVEERGWERKS |
Ga0209526_104690961 | 3300028047 | Forest Soil | VGTAWAEGQVIERGYEGLVVKDPQSAYVGGRTLKWLKVKQPHYREGERGW |
Ga0209526_106285331 | 3300028047 | Forest Soil | VKAPTPLDPEWSLVGARTLKWLKVKQPKYREVERRFYKP |
Ga0257175_10059391 | 3300028673 | Soil | AKDPESRYVGGRSLKWLKVKQAKYREGERGWEPKGK |
Ga0307301_101592393 | 3300028719 | Soil | EGLVGKDPESPYVGGRTLKWLKVKVPHYREGERGWEPKDRS |
Ga0307320_103962442 | 3300028771 | Soil | VQERGYEGYVAKDEASPYSGGRTLSWLKVKPKEYRVEERGWSLSAR |
Ga0307281_101323462 | 3300028803 | Soil | VRERGYEGLVGKDEASPYVEGRTLSWLKVKVPHYREGERGWEPTRGRA |
Ga0308309_103045461 | 3300028906 | Soil | VACGFEGLVAKNPESRYVPGRPLAWLKVKQPKYREGERGWEPKVKS |
Ga0222749_100083848 | 3300029636 | Soil | VAKDPASVYVGGRTLNWLKVKVPKYREGERGWEATRR |
Ga0222749_106057832 | 3300029636 | Soil | VAKDPQSADVGGRTLKWLKVKQPHYREGERGWEPQGKS |
Ga0318572_106787782 | 3300031681 | Soil | AWREVLERGYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR |
Ga0307469_100553303 | 3300031720 | Hardwood Forest Soil | VLERGYEGLVGKDEASPYMEGRTLSWLKAKVPHYREGERGWEPKI |
Ga0307468_1002572292 | 3300031740 | Hardwood Forest Soil | VLERGYEGLVGKDEASPYVEGRTLAWLKVKQPKYREGERGWEPKT |
Ga0307468_1012062481 | 3300031740 | Hardwood Forest Soil | VAKDPESPYVAGRTLKWLKVKQWEYRVKERGFYDPERT |
Ga0307473_101906401 | 3300031820 | Hardwood Forest Soil | GERRYEGLVGKDPESSYVPGRTLKWLKVKQPAYREKERGFYKP |
Ga0310916_103525661 | 3300031942 | Soil | GLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR |
Ga0318533_110040841 | 3300032059 | Soil | GYEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR |
Ga0318504_102646091 | 3300032063 | Soil | YEGLVGKDESAPYRGGRTLLWLKVRQPNYREGERGWDPKR |
Ga0307471_1027673771 | 3300032180 | Hardwood Forest Soil | VAKDPASPYVAERTLKWLKIKVPKYREGERGFYKP |
Ga0307472_1010403442 | 3300032205 | Hardwood Forest Soil | VEGVAGSGGARFEGLVAKDPESPYVGGRTLRWLKVKQPHYREGERGWEAKGKPWPT |
Ga0326726_104348142 | 3300033433 | Peat Soil | MGPGARDYEGLVGKDETSPYVEGRTLSWLKVKVPNYREGKRGWGYTR |
⦗Top⦘ |