 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F021040 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 220 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 220 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 8.37 % |
| % of genes near scaffold ends (potentially truncated) | 92.27 % |
| % of genes from short scaffolds (< 2000 bps) | 92.27 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (46.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (82.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 46.82% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 37.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 1.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.45% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028148 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028155 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028157 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028246 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028463 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070668_1018104982 | 3300005347 | Switchgrass Rhizosphere | MHQNVSLGSNGVDRVLSLRKILTRLRGTNFCTSLDRFAPSFVR |
| Ga0070667_1011921911 | 3300005367 | Switchgrass Rhizosphere | MSLGSNGVDLVRSLRKISMQLRGTNFYISSARFATSFVRQPNGPKCTQMVRNAEK |
| Ga0070707_1012348111 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLGKNEVDRVLSLRKIPMRLRGTNFCISSARFAPSFVRQ |
| Ga0068859_1024842081 | 3300005617 | Switchgrass Rhizosphere | MSFGSNGVDRVLSLQKIPMRLRGTNFCTSSARFAPSFVRQPNGPK |
| Ga0068864_1018479591 | 3300005618 | Switchgrass Rhizosphere | FSLGSNGVDRVRSLRKIPTRLRGTNFRTSSARFAPSFVK* |
| Ga0068863_1019549641 | 3300005841 | Switchgrass Rhizosphere | MSIGSNGVDRVLLLQKIPMRLRGINFFTSSARFAPSVVRQPNGPKCT |
| Ga0068858_1019887212 | 3300005842 | Switchgrass Rhizosphere | MSLGSNGVDWVCLLRKIPMQLRGTNFCTSSARFAQSFVRQPNG |
| Ga0068858_1023956512 | 3300005842 | Switchgrass Rhizosphere | MHQNISLGSIGVDRVRSLRKIPMRLRGTKFYTSSARFAPSFV |
| Ga0068860_1011318081 | 3300005843 | Switchgrass Rhizosphere | MSFGSNGVDRVLSLRKIPMRLRGANFCTSSARFAPSFLRQPNGPKRTQMVRNSPKHE |
| Ga0068860_1014271851 | 3300005843 | Switchgrass Rhizosphere | MSLGSNGVDRVGSLRKILMRLRGTNFCTSSARFAPSLVRQPNGP |
| Ga0068860_1019587861 | 3300005843 | Switchgrass Rhizosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFVRQPNSPK |
| Ga0068860_1019707801 | 3300005843 | Switchgrass Rhizosphere | MSLGSNGVDRVRSLRKILKRLRGTNFCTSSARFAPSFVTQPNGHK |
| Ga0105247_109730061 | 3300009101 | Switchgrass Rhizosphere | MSLGSNGVDRVRSLRKIVMQLRGTNFCTSSKRFAPSFVRL |
| Ga0105247_115955661 | 3300009101 | Switchgrass Rhizosphere | MSLGSNGVDRVRSLRNILMRLRGTKFCTSSDRFAP |
| Ga0105247_117528391 | 3300009101 | Switchgrass Rhizosphere | MSLGSNGLDWVRSLRKIPMQHYGTNLCIDGTSSTRFA |
| Ga0105131_1049161 | 3300009989 | Switchgrass Associated | MSFGCNAVDRVGSLQKILMRLRGTNFCTSSARFAPSLVRQPNG |
| Ga0105131_1445591 | 3300009989 | Switchgrass Associated | MHQNMSLGSNGVDRVLSLRKIWMRLRGMKYCTSSARFA |
| Ga0105132_1418541 | 3300009990 | Switchgrass Associated | MRLGSNGVDRVRSLRKVPMRLRGTNFRTSSAHFPSRFRANQTVPT |
| Ga0134122_113886911 | 3300010400 | Terrestrial Soil | MSLGSNGVDRVRSLFKIPMRLRGTNICTSSACFALSFVR |
| Ga0157379_111931741 | 3300014968 | Switchgrass Rhizosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFVRQP |
| Ga0157379_125224961 | 3300014968 | Switchgrass Rhizosphere | MSLGSNGVDRVLSLQKIPMRLRGTNFCTSSARFAPSFVRQPN |
| Ga0182183_10944711 | 3300015270 | Switchgrass Phyllosphere | MSKGSNGVDRVLSLQKIPMRLRGINFFTSSARFAPSFVRQPNGPKCT |
| Ga0182099_10696061 | 3300015278 | Switchgrass Phyllosphere | MQQNMSLGSNGVDRVRSLRKIPMRLRGTKFCTSSARFAPSFVRQPNGPK |
| Ga0182101_10878391 | 3300015284 | Switchgrass Phyllosphere | MSLGSNGVDRVHSLRNESTQLRDTNFSTSSERFSPSF |
| Ga0182105_10205411 | 3300015290 | Switchgrass Phyllosphere | MSLGSNGVDRMLSLQKIPMRLRGTNFCTSSARFALSFVRQPNGPKCT |
| Ga0182105_10614361 | 3300015290 | Switchgrass Phyllosphere | MSLGPNGVDRVRSLRKIPMQLRGTNFCTSSKRFAPSFVRLPNG |
| Ga0182103_10214531 | 3300015293 | Switchgrass Phyllosphere | LGSNGVDRVRSLRKIPMRLRGTNFCTSSARFALSFVWQPNDPK* |
| Ga0182103_10345611 | 3300015293 | Switchgrass Phyllosphere | MILASNGVDRVGSLQKIPMRLRGTNFCINCSSSARFAPS |
| Ga0182184_10751431 | 3300015301 | Switchgrass Phyllosphere | MSLGSNLVDRVLSLRKIPVRLHGTNFCTSSARFAPSFVRQPNGPKRTQM |
| Ga0182180_10780781 | 3300015306 | Switchgrass Phyllosphere | MSLGSNEVDRLLSFRKIPMQLRGTNFCTSSARFAPSF |
| Ga0182162_10504151 | 3300015310 | Switchgrass Phyllosphere | MSLGSSEVDRVLSLQKIPMRLCGTNFCISSAHFAPSFVRQPYSPKGTQ |
| Ga0182182_10415511 | 3300015311 | Switchgrass Phyllosphere | MQQNTSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFA |
| Ga0182182_11194701 | 3300015311 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRKIPK*LRDTNFCTSLARFAS |
| Ga0182120_11030811 | 3300015315 | Switchgrass Phyllosphere | MHQNVSLGSNGVDRVHLLPKIPMRLHGMNFCTSSARFAPS |
| Ga0182121_11140631 | 3300015316 | Switchgrass Phyllosphere | MHQNISLVSNGVYRVRSLRKILKQLRGTNFCTSSARFAPSFVS |
| Ga0182121_11367371 | 3300015316 | Switchgrass Phyllosphere | MSLGSNGVDLVRSLRKIPMQLRGTNFYTSSARFATSFVRQPNGPKC |
| Ga0182136_11123281 | 3300015317 | Switchgrass Phyllosphere | MSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSF |
| Ga0182136_11141461 | 3300015317 | Switchgrass Phyllosphere | MVPNKPKWYEMHQNISLGLNGVDRVFSLRKIPTRLRGTNFCTSSARYPPSFV |
| Ga0182181_10507312 | 3300015318 | Switchgrass Phyllosphere | MSLESNGVDRVRSLRKIPTRLRGTNFCSSSARFAPSFVGQPNS |
| Ga0182130_10383111 | 3300015319 | Switchgrass Phyllosphere | MQQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPN |
| Ga0182130_10668201 | 3300015319 | Switchgrass Phyllosphere | MSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPNGPK |
| Ga0182110_11061161 | 3300015322 | Miscanthus Phyllosphere | MSLGSNEVDRVLSLRKILMRLRGTNFCISSARFAPSFI |
| Ga0182166_10259301 | 3300015326 | Switchgrass Phyllosphere | MSLGSNGVDQVRLLRKIPMRLRGTKFCTSLARFAPSF |
| Ga0182114_10264361 | 3300015327 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRNDSKQHRGTNFCTSSERFASSFVRQ |
| Ga0182114_10789641 | 3300015327 | Switchgrass Phyllosphere | MSLGCNAVDRVGSLQKILMRLRGTNFCTTSARFAPSLVRQPNGPKCTQMVRNT |
| Ga0182153_10611061 | 3300015328 | Switchgrass Phyllosphere | MSLGSHEVDRVLSLPKIPTQLRGTNFCTSSERFAPSFVRQPNGRKNTQTVR |
| Ga0182153_11081991 | 3300015328 | Switchgrass Phyllosphere | MHKNVSLGSNGVDRVRSLRKVPSRLHGMNFRTSLVRFAPSFVRQP |
| Ga0182153_11134401 | 3300015328 | Switchgrass Phyllosphere | MYQNTSLVSNGVDRVHSLQKIPTQLRGTNFCTSLAYFAPTF |
| Ga0182153_11203141 | 3300015328 | Switchgrass Phyllosphere | MSLGSNEVDRVLLLRKIPMRLRGTNICISSARFAPSFVRQPNGP |
| Ga0182153_11228371 | 3300015328 | Switchgrass Phyllosphere | MRQNMSLGANGVDRVHSLQKILMRLRGTKFCTKCTSSTRF |
| Ga0182153_11449411 | 3300015328 | Switchgrass Phyllosphere | MSLGSNGVDRVHSLRKIPMRLRGTNFCTSLAPFALSFVR |
| Ga0182135_10387141 | 3300015329 | Switchgrass Phyllosphere | MSLGSNWVDRVLSLRKIPMQIRGTNFCTSSVRFAPRLVRQPNGPK |
| Ga0182135_11141631 | 3300015329 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRNDSTQHRGTNFCTSSERFASSF |
| Ga0182135_11324141 | 3300015329 | Switchgrass Phyllosphere | MRLGSNGVDRVRSLRKIPTRLHGMNFCTTLARFEPSF |
| Ga0182152_11037211 | 3300015330 | Switchgrass Phyllosphere | MSFGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPNGPKRTQM |
| Ga0182152_11112561 | 3300015330 | Switchgrass Phyllosphere | MQQNISLGSNGVDRVLSWRKIPMRLRGTNFSTSSA |
| Ga0182152_11300902 | 3300015330 | Switchgrass Phyllosphere | MHPNVVDRVGSLRKILMRLRGTNFCISSARFAPSFVRQP |
| Ga0182131_11257912 | 3300015331 | Switchgrass Phyllosphere | MSLGYNGVHRVRSLRKILTQLRGTNFCIISARFSPSLVGQP |
| Ga0182131_11261121 | 3300015331 | Switchgrass Phyllosphere | MSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPNGPKC |
| Ga0182131_11381401 | 3300015331 | Switchgrass Phyllosphere | MSLGSNGVDQVRLLRKIPMRLRGTKFCTSLARFAPSFVRQ |
| Ga0182131_11437751 | 3300015331 | Switchgrass Phyllosphere | MSLGSDGVDRVRLLRKIPMQLRGTNFCTSSARFAPSFV |
| Ga0182117_10789071 | 3300015332 | Switchgrass Phyllosphere | MSLGSNEVDRVLSLRKIPMRLRGINFCISSARFAP |
| Ga0182117_11296451 | 3300015332 | Switchgrass Phyllosphere | MHENMSLGSNGVDRVGSLRKILMRLRGTNFCTSSARFAPS |
| Ga0182147_10676831 | 3300015333 | Switchgrass Phyllosphere | MHKNVSLGSNGVDRVRSLQKIPKRLRGTNFCTSSARFAPSFVRQP |
| Ga0182147_11071801 | 3300015333 | Switchgrass Phyllosphere | MSLGCNAVDRVGSLQKILMRLRGTNFCTSSARFAPSLVRQPNG |
| Ga0182116_10385951 | 3300015335 | Switchgrass Phyllosphere | MSFGSNGVDRVGSLRKILMRLRGTNFCTSSARFAPSLVRQPNGPKC |
| Ga0182116_11222681 | 3300015335 | Switchgrass Phyllosphere | MHKNVSLGSNGVDRVRSLQKIPKRLRGTNFCTSSARFAPSFVR |
| Ga0182116_11441241 | 3300015335 | Switchgrass Phyllosphere | MRLGSNGVDRVRSLRKIPTRLHGMNFCTTLARFEPSFVRQ |
| Ga0182150_11679001 | 3300015336 | Switchgrass Phyllosphere | MSFGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFVR |
| Ga0182137_10760651 | 3300015338 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFYTSSARFATSFVRQPNGPKC |
| Ga0182133_10851571 | 3300015340 | Switchgrass Phyllosphere | MLQNASLGSNGVDRVRSLQKILMRLRGTNFCTSSARF |
| Ga0182133_11453391 | 3300015340 | Switchgrass Phyllosphere | MHQIISLGSNGVDRVRSFRKIPTRLRGMNFYTSSARF |
| Ga0182115_11403581 | 3300015348 | Switchgrass Phyllosphere | MLQNMSLGSNGLDRVGSLQKITMRLRGTNFCINCSSSAHF |
| Ga0182115_12417851 | 3300015348 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSSKRFAPSFVRL |
| Ga0182115_12498261 | 3300015348 | Switchgrass Phyllosphere | MHQNISLGLNGVDRVRSLRKIPKRLRGTNFCTSSARYPPSFVMQPNGPE |
| Ga0182115_12580111 | 3300015348 | Switchgrass Phyllosphere | MSLGPNGDNRVRSLRKIPTRLRDTNFCTSSARFALSFVRQPNGPK |
| Ga0182115_12682991 | 3300015348 | Switchgrass Phyllosphere | MSSGSNGVDRVRSLRKIPTRLRGTNFCTSLTRFAQSI |
| Ga0182185_11913251 | 3300015349 | Switchgrass Phyllosphere | MDRVCSLRKIPTRLRGTNFCTSSARFAQSFVRQPNGP |
| Ga0182185_12147361 | 3300015349 | Switchgrass Phyllosphere | MHQNVSLGSNGVDRVRSLRKIVTLLRGSNICTSSARFA |
| Ga0182185_12734891 | 3300015349 | Switchgrass Phyllosphere | MSLGSNEVDRVLLLRKIPMRLRGTNFCTSSARFATSFVRQPNGP |
| Ga0182163_12322931 | 3300015350 | Switchgrass Phyllosphere | MHQNVILGSDGVDRVRSLLKILMQLRGTNFCTSSARFAPSSVRQPNG |
| Ga0182163_13017721 | 3300015350 | Switchgrass Phyllosphere | MSLGSNGVDRVLSLRKIPMQLPGTNFCTSSARFAPNFVW |
| Ga0182169_10999171 | 3300015352 | Switchgrass Phyllosphere | MSFGSNGVDRVGSLRKILMRLRGTNFCTSSARFAPSLVR |
| Ga0182169_11661391 | 3300015352 | Switchgrass Phyllosphere | MSLGSNGVDLVGSLRKILMRLRGTNFCTSSARFTPSLVRQPNGPKCTQ |
| Ga0182169_11797281 | 3300015352 | Switchgrass Phyllosphere | MNKNVSLGSNGVDRVRSLQKILTRLRGTNFCTTSARV |
| Ga0182169_12357981 | 3300015352 | Switchgrass Phyllosphere | MSLGSKGVDRVRSLRNDSTRLRGTNFCTSSERFAPSFIWQING |
| Ga0182169_12544101 | 3300015352 | Switchgrass Phyllosphere | MSLGSDGVDRVRLLRKIPMQLRGTNFCTSSARFAPSFVR |
| Ga0182169_12575671 | 3300015352 | Switchgrass Phyllosphere | NGVDRVRWLRNIPTRLRGKNFCTSSARFAPSFVTQPDGP* |
| Ga0182169_12600071 | 3300015352 | Switchgrass Phyllosphere | MSLGLNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVR |
| Ga0182169_12961971 | 3300015352 | Switchgrass Phyllosphere | MHQNISLGLNGVDRVLSLQKIPMRLRGTNFCTSSARFAPSFVRQPNGPECTQMVRNALKCQFR |
| Ga0182179_12200641 | 3300015353 | Switchgrass Phyllosphere | MSLGSNGVDHVHSSQKTPTRLRGMNFCTSSERFAPSFVRQLNGP |
| Ga0182179_13273791 | 3300015353 | Switchgrass Phyllosphere | MHQNISLGSNAVDRVLLLRNILTQLRGTNFYTSSARFAPSF |
| Ga0182167_12887721 | 3300015354 | Switchgrass Phyllosphere | MSFGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPNGPKRT |
| Ga0182167_13052761 | 3300015354 | Switchgrass Phyllosphere | MQQNISLGSNGVDRVLSWRKIPMRLRGTNFCTSSARFAPSFVRQ |
| Ga0182197_11173071 | 3300017408 | Switchgrass Phyllosphere | MSLGSNGVDLVRSLRKIPMQLRGTNFYTSSARFAPSFVRQPNGPKCTQMVLNSPKHEFRV |
| Ga0182199_11288541 | 3300017412 | Switchgrass Phyllosphere | MSLGPNGVDWVRSLRKIPKRLHGTNLCINGTTRFAMS |
| Ga0182199_11292152 | 3300017412 | Switchgrass Phyllosphere | MVQYNENMSLGSNGVDRVRSLRKIPMQLRGTNFCTSSARFS |
| Ga0182195_11791661 | 3300017414 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLPKIPMRLRGTNFCTTLAPFAPS |
| Ga0182196_10083541 | 3300017432 | Switchgrass Phyllosphere | MHQNISLGLNGVDRVLLLRKITMRLRGTNFCTSAARFAPSFVRQPNGLECT |
| Ga0182194_10834141 | 3300017435 | Switchgrass Phyllosphere | MSLGSNGLERVRLLRKIPMPLRGTNFYTSSARFASGFVCQLNGPKCTKI |
| Ga0182194_10995601 | 3300017435 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRKIFKRLRGTNFCTSSARFAPSFVSQP |
| Ga0182194_11043282 | 3300017435 | Switchgrass Phyllosphere | MSFGSNGVDRVLSLQKIPMRLRGTNFCTSSARFAPSFVRQPNGPKR |
| Ga0182194_11142831 | 3300017435 | Switchgrass Phyllosphere | MVRNTKNISLGSNGVDRVLSLRKILMRLRGTNFCTSSARFAPSFV |
| Ga0182200_11213551 | 3300017439 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRKILTQLRGTKFSTSSARFGPS |
| Ga0182200_11415941 | 3300017439 | Switchgrass Phyllosphere | MSLVSDGVDRVRSLRKIPTQLRGTNFCTSLAYFALSFVMQPNCPKYTQI |
| Ga0182198_10481951 | 3300017445 | Switchgrass Phyllosphere | MSLGSNVVVRVRSLRNDSMQLRGINFCTSSERFAPSFVRQLNGPKCT |
| Ga0182215_10179751 | 3300017447 | Switchgrass Phyllosphere | MHQNISLGLNGVDRVLLLRKITMRLRGTNFCTSAARFAPSFVRQPNGLECTQMVR |
| Ga0182212_10831331 | 3300017691 | Switchgrass Phyllosphere | MSLGSNVVDRVGSLQKIPMRLRGTNFCINCSSSARFAPSFM |
| Ga0182210_10874731 | 3300017692 | Switchgrass Phyllosphere | MSLGSNGVDWVHSLRKIPMRLRGTNFCTSLARFAPSFVRQP |
| Ga0182210_10889191 | 3300017692 | Switchgrass Phyllosphere | MSLGSNGVDRVCSLRKIVMQLRGTNFCTSSKRFAPSFVR |
| Ga0182216_10743271 | 3300017693 | Switchgrass Phyllosphere | MSLGSNGVDRVGSLRKILMRLRGTNFCTSSARFALSL |
| Ga0182216_11165291 | 3300017693 | Switchgrass Phyllosphere | MSLGSTGVDRVRSLRKILTQLRGTNFCISSARFALSFKSQPNGPKCTKIVQ |
| Ga0182211_11284851 | 3300017694 | Switchgrass Phyllosphere | MSLGSNGVDLVHSLRKIPMQLRGTNFYTSSARFATSFV |
| Ga0182178_10055631 | 3300020023 | Switchgrass Phyllosphere | MSLGSNGVDRVRSLRNDSTQHRGTNFCTSSERLASSF |
| Ga0182178_10220751 | 3300020023 | Switchgrass Phyllosphere | MSLGSNGVDQVRSLRKIPMQLRGTNFCTSSALFAPSF |
| Ga0182119_1011701 | 3300020031 | Switchgrass Phyllosphere | MHQNISLGLNGVDRVLLLRKITMRLRGTNFCTSAARFAPSFVRQPNGL |
| Ga0182119_1019592 | 3300020031 | Switchgrass Phyllosphere | MSLGSSEVDRVLSLRKIPMRLHGTNFCTSSARFAPSFVRQPNGPKC |
| Ga0207680_106732281 | 3300025903 | Switchgrass Rhizosphere | MHQKVSLGTHGVDRVHLLPKIPMRLRGTNFCTSSARFAPS |
| Ga0207662_113550422 | 3300025918 | Switchgrass Rhizosphere | MSLGSNGVDRVRSLRKILMRLHGTTFCTSSARFAPSF |
| Ga0207681_110448871 | 3300025923 | Switchgrass Rhizosphere | MSLESNGVDRVRSLRKIPMQLHGTYFCTSSKRFAPSFVRLPNGRKC |
| Ga0207712_116087151 | 3300025961 | Switchgrass Rhizosphere | MHKNISLGSNGVDRVRSLRKIPTRLRGTNFCPSSARFAPSF |
| Ga0207668_112685911 | 3300025972 | Switchgrass Rhizosphere | MHQNISLGSSEVDRVRSLRKIPTRLRGTNFCTLSARFAPSF |
| Ga0207703_115980321 | 3300026035 | Switchgrass Rhizosphere | MSLGSNAVDRVRSLRNDSTRLRGTNFCTSSERFAPSFVRQLNGPKC |
| Ga0207703_119833381 | 3300026035 | Switchgrass Rhizosphere | MSLGSNGVDQVRSLRKIPMQLRGPNFCTSSARFAPSFVRQPNGPKC |
| Ga0207641_116818941 | 3300026088 | Switchgrass Rhizosphere | MSLGSHGVDRVLSLRKIPTRLRGTNFCTTSERFAPSFVRQPNGRKETQMIR |
| Ga0207676_114704401 | 3300026095 | Switchgrass Rhizosphere | MRQNESLGSNGVDRVLLLREIPMRLRGTNFCTSSARFAPSFVRQPNSPQC |
| Ga0207676_125816701 | 3300026095 | Switchgrass Rhizosphere | MSLQSNGVDRVRSLRKILTRLRGMNFCTSLAHFELS |
| Ga0207675_1026414851 | 3300026118 | Switchgrass Rhizosphere | MNLGSNGVDRVRSLRKILTRLRGMNFCISSARFPSSF |
| Ga0268322_10118261 | 3300028049 | Phyllosphere | MSLGSNGVDWVRWLRKIPTQLRGTNFCTSLAHIAPSFVSQPIG |
| Ga0268322_10224501 | 3300028049 | Phyllosphere | MSFGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSF |
| Ga0268328_10212691 | 3300028050 | Phyllosphere | MSLGSNGVDRVLLLRKIPMRLRGTNFCTSSARFSP |
| Ga0268328_10400801 | 3300028050 | Phyllosphere | MSFGSNGVDRVLSLQKIPMRLRGTNFCTSSARFAPSFVRQPNGPKRTQMVR |
| Ga0268328_10583441 | 3300028050 | Phyllosphere | MSLGSNGVDRVRSLRNDSMQLCGMNFCTSSERFAPSFVRQLN |
| Ga0268344_10159841 | 3300028051 | Phyllosphere | MSLGSNGVDRVRLLRKIPVRLRGKNFCINCTSSARFA |
| Ga0268346_10154261 | 3300028053 | Phyllosphere | MSLGSNEVDRVLSLRKIPMRLRGTNICIISARFAP |
| Ga0268346_10156311 | 3300028053 | Phyllosphere | MHQNISLGLNGVDRVLSLQKIPTQLRGTNFCTSSARFAPSFVRKPNGPECTQMVRNA |
| Ga0268346_10239202 | 3300028053 | Phyllosphere | MSLWSNGVDRLLSLRKISMQLRGTNFCTSSARFAPNFVWQPDGPKCT |
| Ga0268338_10253431 | 3300028055 | Phyllosphere | MSLESDGVDRVRSLRKIPAQLRGTNFCTSLARFVLSFVTRLNCT |
| Ga0268330_10142581 | 3300028056 | Phyllosphere | MSLGSNGVDRVRSLRNDSTQLRGTNFCTSSECFDPSFV |
| Ga0268330_10308892 | 3300028056 | Phyllosphere | MSFGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQLNGPK |
| Ga0268352_10223941 | 3300028057 | Phyllosphere | MSLGSNGVDRVRSLQKILMRLRGTKFCTSSAHFAPS |
| Ga0268352_10314581 | 3300028057 | Phyllosphere | MSLGSNVVVRVRSLRNDSMQLRGINFCTSSERFAPSF |
| Ga0268352_10400861 | 3300028057 | Phyllosphere | MSLGSNGVDRVGSLRKILMRLRGTNFCTSSARFAPSLVRQPNGPKCT |
| Ga0268332_10060911 | 3300028058 | Phyllosphere | MSLGSNGVDLVRSLRKISMQLRGTNFYISSARFATSFVRQPNGP |
| Ga0268314_10093691 | 3300028061 | Phyllosphere | MQQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQP |
| Ga0268314_10220271 | 3300028061 | Phyllosphere | MSLGSNGVDREQSLLKIPTRLRGTNFCTNSARFAPSF |
| Ga0268314_10273781 | 3300028061 | Phyllosphere | MSLGSNGVNRVLLLRKIKMQLRGTNFYTTSARFAP |
| Ga0268314_10435381 | 3300028061 | Phyllosphere | MHPNVVDRVGSLRKILMRLRGTNFCISSARFAPSFVRQPNGPK |
| Ga0268314_10455211 | 3300028061 | Phyllosphere | MSLGSNGVDRVLSLRKIPMRLCGTNFCTSSARFAPSFVGQPNGP |
| Ga0268342_10125701 | 3300028062 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSLARFAPSFVRQPNSPKCT |
| Ga0268342_10139131 | 3300028062 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFVRQPNS |
| Ga0268342_10241302 | 3300028062 | Phyllosphere | MSLGSNGVDRVRSLRKIPTRLRGTNFCTSLTRFAQSI |
| Ga0268342_10385741 | 3300028062 | Phyllosphere | MSLGSNGVDRVRSLRKIPIGLHGTKFFTSLTRFTLSV |
| Ga0268350_10185401 | 3300028063 | Phyllosphere | MSLGSNGVDLVRSLRKISMQLRGTNFYISSARFATSFVRQPNGPKCTQMVRNAEKHEF |
| Ga0268340_10057961 | 3300028064 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFVRQ |
| Ga0268340_10106501 | 3300028064 | Phyllosphere | MHQNISLGSNGVDRVRSLRKILTQIRGTNFCTSSARFALSF |
| Ga0268340_10523532 | 3300028064 | Phyllosphere | MSLGSNGVDRVRSLRKIPKXLRDTNFCTSLARFASSFFKATKQ |
| Ga0268340_10755422 | 3300028064 | Phyllosphere | MSLWSNGVDRLLSLRKISMQLRGTNFCTSSARFAPNFVWQPDGPKCTQMVRN |
| Ga0268355_10006261 | 3300028139 | Phyllosphere | MSLGSNGVDRVLSLRKIPMRLCGTNFCTSSARFAPSFVGQPNGPK |
| Ga0268355_10042721 | 3300028139 | Phyllosphere | MQQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPNSPQ |
| Ga0268355_10047241 | 3300028139 | Phyllosphere | MSLGSNGVDRVLLLRKIPMRLRGTNFCTSSARFAPSFVRQPNGPKC |
| Ga0268355_10092931 | 3300028139 | Phyllosphere | MSLGSNGVDRVRSLRNDSTQHRGTNFCTSSERFASSFVRQLH |
| Ga0268355_10093701 | 3300028139 | Phyllosphere | MHQNVSLGSNGVDRVLLFRKIPKRFRGTNFRTCSARFA |
| Ga0268334_10090311 | 3300028140 | Phyllosphere | MSLGSNGVDQVRSLRKIPMQLRGTNFCTSSARFAPSFVRQPNS |
| Ga0268348_10025481 | 3300028143 | Phyllosphere | MQQNTSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFALSL |
| Ga0268348_10031711 | 3300028143 | Phyllosphere | MSFGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFV |
| Ga0268348_10032241 | 3300028143 | Phyllosphere | MSLGSNGVDRVRLLRKIPMRLRGTKFRTSSARFAPSFVSNQMVP |
| Ga0268348_10056291 | 3300028143 | Phyllosphere | MSFGSNGVDRVLSLRKIPMRLRGTNLCTSSARSAL |
| Ga0268348_10057471 | 3300028143 | Phyllosphere | MSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVR |
| Ga0268348_10171651 | 3300028143 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFYTSSARFATSF |
| Ga0268345_10251381 | 3300028144 | Phyllosphere | MHQNVSLGANGVDRVRSLRKIPTRLRGTNFCTSLACFALS |
| Ga0268345_10276081 | 3300028144 | Phyllosphere | MSLGSNGVDRVRSLRNILMRLRGTKFCTSSDRFAPSFL |
| Ga0268354_10101871 | 3300028148 | Phyllosphere | MSLGSNGVDLVRSLRKIPMQLRGTNFYTSSARFATSFVRQPNGPKCTQMVRNEEKR |
| Ga0268343_10104931 | 3300028150 | Phyllosphere | MHQNVSLGLNGVDRVRSLRKIPMRLHGMNFCTSSDRFPPSFVRQPNGLECTQMV |
| Ga0268343_10140931 | 3300028150 | Phyllosphere | MQQNMSLGSNGVDRVLSLRKIPMRLCGTNFCTSSARFAPSFVGQPNGPKC |
| Ga0268343_10200121 | 3300028150 | Phyllosphere | MSSGSNGVDRVLLLRKIPMRLRGTNFCSSSARFATSFV |
| Ga0268308_10157531 | 3300028151 | Phyllosphere | MSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPS |
| Ga0268336_10236491 | 3300028152 | Phyllosphere | MSLGSNGVDRVLLLRKIPMRLRGTNFCTSSARVAPSFLR |
| Ga0268320_10049361 | 3300028153 | Phyllosphere | MSLGSNGVDRVRSLLEIPTRLRGTNFSTSSARFGPSFVSKPN |
| Ga0268349_10316361 | 3300028155 | Phyllosphere | MHQNMSLGSNGVDRVLSLRKISMRLRGMKYCTSSARFAPS |
| Ga0268318_1005831 | 3300028157 | Phyllosphere | MSFGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFVRQPNSPKCTQMVGNA |
| Ga0268351_10067601 | 3300028246 | Phyllosphere | MHQNISLGLNGVDRVLLLRKIPMRLRGTNFCTSAARFAPSFVRQPNGLECTEMVRNALKC |
| Ga0268351_10288731 | 3300028246 | Phyllosphere | MTLGSNGVDRVRSLPKIPMRIRGTNFCTNLAPFALSF |
| Ga0268324_10008501 | 3300028251 | Phyllosphere | MTLGSNGVDRVRSLPKIPMRIRGTNFSTTLAPFAL |
| Ga0268324_10043181 | 3300028251 | Phyllosphere | MSLGSNGVDPVRSLRKIPMQLRGTNFCTSSALFAPSFVRQPNSP |
| Ga0268324_10114961 | 3300028251 | Phyllosphere | MSLGSNGVDRVGSLRKILMRLRGTNFCTSSARFAPSLVRQ |
| Ga0268324_10119551 | 3300028251 | Phyllosphere | MSLGSNGVDRVLSLRKIPVRIRGTNFCTSSVRIAPRLVR |
| Ga0268316_10119091 | 3300028253 | Phyllosphere | MSFGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQLNGPKHTQMVQTFALVRPGLHRDS |
| Ga0268304_10051501 | 3300028256 | Phyllosphere | MHQNVSLGSNGVDRVRSLRKIPMRLRFTNFCISSARFALSFV |
| Ga0268304_10121992 | 3300028256 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSLARFAPSF |
| Ga0268310_10402441 | 3300028262 | Phyllosphere | MHQNVSLGANGVDRVRSLRKIPTRLRGTNFCTSLARFALSLV |
| Ga0268310_10448551 | 3300028262 | Phyllosphere | MSLGSNGVDPVRSLRKIPMQLRGTNFCTSSARFAPSFVRQANSP |
| Ga0268264_126917321 | 3300028381 | Switchgrass Rhizosphere | MSLGSNGVDRVRSLPKIPMRLRGTNFCTTLAPFAPSFV |
| Ga0268325_1018371 | 3300028463 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSFVRQQNS |
| Ga0268302_1049651 | 3300028464 | Phyllosphere | MSLGSNEVDRVLSLRKISMRLRGTNFCISSACFAP |
| Ga0268333_10049411 | 3300028467 | Phyllosphere | MSLGSNEVDRVLSLRKIPMRLRGTNFCISSARFAPSF |
| Ga0268317_10017151 | 3300028468 | Phyllosphere | MSLGSNGVDLVRSLRKISMQLRGTNFYISSARFATSFVRQPNGPKCTQMVRNAEKRE |
| Ga0268317_10051031 | 3300028468 | Phyllosphere | MSLGSNGVDRVLLLRKIPMRLRGTNFCTSSARVAPSF |
| Ga0268323_10138821 | 3300028471 | Phyllosphere | MHQNISLGSNGVERVRSLRKILKRLRVTNFCTSSARFAPSFVTQPNGYK |
| Ga0268323_10142521 | 3300028471 | Phyllosphere | MQQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPNSP |
| Ga0268315_10038551 | 3300028472 | Phyllosphere | MSLRSNGVDRVLSLRKIPMQLRGTNFCTGSARFAPSFV |
| Ga0268319_10139202 | 3300028473 | Phyllosphere | MSFGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQLNGPKHTQMVQTFAL |
| Ga0268331_10123241 | 3300028474 | Phyllosphere | MHQNISLGLNGVDRVLLLRKIPMRLRGTNFCTSAARFAPSFVRQLNGLECTEMVR |
| Ga0268327_10190201 | 3300028475 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFYTSSARFASSFVRQPNSPKCTQM |
| Ga0268327_10192281 | 3300028475 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFCTSSARFAPSF |
| Ga0268327_10200611 | 3300028475 | Phyllosphere | MSLGSNGVDRVRSLRKIPTRLRGTNFCTSLTRFAQ |
| Ga0268329_10161561 | 3300028476 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLHGTNFCTSSKRFAPSF |
| Ga0268305_1008771 | 3300028525 | Phyllosphere | MSLGSNGVDRVLSLRKIPMRLRGTNFCTSSARFAPSFVRQPNGPKSTQ |
| Ga0268305_1092791 | 3300028525 | Phyllosphere | MSLGSNGVDRVLSLRKIPMRLCGTNFCTSSARFAPSV |
| Ga0268339_10190411 | 3300028526 | Phyllosphere | MSLGSNGVDRVLLLRKIPMRLRGTNFCTSSARFAPSFVR |
| Ga0268339_10205731 | 3300028526 | Phyllosphere | MSLGSNGVDRVRSLRKIPMQLRGTNFYTSSARFATSFVRLPNGRKCTQTVR |
| Ga0268335_10007241 | 3300028527 | Phyllosphere | MHQNISLGLNGVDRVLLLRKIPMRLRGTNFCTSAARFAPSFVRQPNGLECTEMVRNVLKCHFRV |
| Ga0214493_11343771 | 3300032465 | Switchgrass Phyllosphere | MCLGSNVEDRVRSLQKILTRLLGTNFCTSSARFAPSFESGRE |
| Ga0214490_10342771 | 3300032502 | Switchgrass Phyllosphere | MSLGSNGVERVHSLRKIPKXLRDTNFCTSLARFASSFLM |
| Ga0214490_10383471 | 3300032502 | Switchgrass Phyllosphere | MSFGSNGVDWVRLLRKILTRLHGTKFCTTSARFTTSFVRQPNGPKCIQRVLNT |
| Ga0214501_11001111 | 3300032625 | Switchgrass Phyllosphere | YEMHQNISLGSNGVDRVRSLRKSPTRLRATKFCTSSARFAPEF |
| Ga0214501_12423221 | 3300032625 | Switchgrass Phyllosphere | MSLGSNEVDRVLSLRKIPMQLRGTNFCTSSARFAPSFIRQHNGP |
| Ga0214499_11622951 | 3300032697 | Switchgrass Phyllosphere | MHQNISLGSDGVDRVRSLRKIPTQVRGTNFCTSSARFALSF |
| Ga0214499_11896251 | 3300032697 | Switchgrass Phyllosphere | MSLGSYGVDRVLLLRKIPMRLRGTNFCTSSARVAPSF |
| Ga0214494_11007891 | 3300032699 | Switchgrass Phyllosphere | MHQNISLVLNGVDRLLSLXKILMQLRGMNFYTSSAHYPRSFVMQPNGPECTQMVXN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |