Basic Information | |
---|---|
Family ID | F020999 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 221 |
Average Sequence Length | 44 residues |
Representative Sequence | MRKIFHFDSPADPYVADAAVLCCFDHRISTAVRKFLRKQGIER |
Number of Associated Samples | 200 |
Number of Associated Scaffolds | 221 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 67.87 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 88.24 % |
Associated GOLD sequencing projects | 187 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.475 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.502 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.647 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 221 Family Scaffolds |
---|---|---|
PF04012 | PspA_IM30 | 25.34 |
PF13211 | DUF4019 | 10.41 |
PF12900 | Pyridox_ox_2 | 5.43 |
PF00588 | SpoU_methylase | 2.71 |
PF15975 | Flot | 2.71 |
PF01850 | PIN | 2.26 |
PF00326 | Peptidase_S9 | 2.26 |
PF08238 | Sel1 | 1.36 |
PF02129 | Peptidase_S15 | 1.36 |
PF07853 | DUF1648 | 1.36 |
PF04014 | MazE_antitoxin | 1.36 |
PF00311 | PEPcase | 0.90 |
PF07366 | SnoaL | 0.90 |
PF01987 | AIM24 | 0.90 |
PF12146 | Hydrolase_4 | 0.90 |
PF00266 | Aminotran_5 | 0.90 |
PF12697 | Abhydrolase_6 | 0.90 |
PF12867 | DinB_2 | 0.45 |
PF04185 | Phosphoesterase | 0.45 |
PF13193 | AMP-binding_C | 0.45 |
PF01728 | FtsJ | 0.45 |
PF07883 | Cupin_2 | 0.45 |
PF06739 | SBBP | 0.45 |
PF13181 | TPR_8 | 0.45 |
PF00313 | CSD | 0.45 |
PF00248 | Aldo_ket_red | 0.45 |
PF00801 | PKD | 0.45 |
PF14559 | TPR_19 | 0.45 |
PF01402 | RHH_1 | 0.45 |
PF01979 | Amidohydro_1 | 0.45 |
PF05016 | ParE_toxin | 0.45 |
PF05995 | CDO_I | 0.45 |
PF04255 | DUF433 | 0.45 |
COG ID | Name | Functional Category | % Frequency in 221 Family Scaffolds |
---|---|---|---|
COG1842 | Phage shock protein A | Transcription [K] | 50.68 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 2.71 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 2.71 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 2.71 |
COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.90 |
COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.90 |
COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.45 |
COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.45 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.45 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.48 % |
Unclassified | root | N/A | 4.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000953|JGI11615J12901_10399990 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300002347|JGIcombinedJ26865_1060888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 601 | Open in IMG/M |
3300002558|JGI25385J37094_10166568 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300002909|JGI25388J43891_1041228 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300003324|soilH2_10291819 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300004091|Ga0062387_100313632 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300004092|Ga0062389_101207719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
3300004092|Ga0062389_104080078 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300004473|Ga0068919_1181844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300005093|Ga0062594_102156915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300005171|Ga0066677_10804407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300005330|Ga0070690_101355405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300005338|Ga0068868_100048577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3328 | Open in IMG/M |
3300005347|Ga0070668_102201248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300005436|Ga0070713_100135458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2176 | Open in IMG/M |
3300005437|Ga0070710_10684071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300005439|Ga0070711_102047665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300005534|Ga0070735_10690025 | Not Available | 603 | Open in IMG/M |
3300005557|Ga0066704_10959624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300005559|Ga0066700_11002303 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005561|Ga0066699_10293619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
3300005561|Ga0066699_10580232 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300005566|Ga0066693_10330032 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005591|Ga0070761_10314648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 944 | Open in IMG/M |
3300005610|Ga0070763_10121516 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
3300005614|Ga0068856_101729730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300005712|Ga0070764_10008448 | All Organisms → cellular organisms → Bacteria | 4960 | Open in IMG/M |
3300005764|Ga0066903_105810804 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005840|Ga0068870_10846235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300005921|Ga0070766_11288114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300005995|Ga0066790_10506509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300006028|Ga0070717_10145523 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
3300006028|Ga0070717_10447018 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300006034|Ga0066656_10288681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
3300006050|Ga0075028_100033729 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
3300006052|Ga0075029_101191507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300006059|Ga0075017_100332588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
3300006102|Ga0075015_100153770 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300006102|Ga0075015_100949963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300006162|Ga0075030_100266077 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300006163|Ga0070715_11009659 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006174|Ga0075014_100545167 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300006176|Ga0070765_100069878 | All Organisms → cellular organisms → Bacteria | 2943 | Open in IMG/M |
3300006176|Ga0070765_100274098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
3300006176|Ga0070765_101632452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300006237|Ga0097621_101232353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300006358|Ga0068871_102020804 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria | 549 | Open in IMG/M |
3300006796|Ga0066665_10668172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
3300006796|Ga0066665_11314667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300006800|Ga0066660_11392488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300006893|Ga0073928_10334978 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300006914|Ga0075436_101427443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300007076|Ga0075435_100228782 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300007076|Ga0075435_100830006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300007258|Ga0099793_10711808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300009012|Ga0066710_104646072 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009029|Ga0066793_10682992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300009094|Ga0111539_11594428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300009174|Ga0105241_11697192 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300009177|Ga0105248_10124785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2904 | Open in IMG/M |
3300009525|Ga0116220_10029906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2226 | Open in IMG/M |
3300009643|Ga0116110_1025945 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
3300009644|Ga0116121_1188598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300009764|Ga0116134_1314719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300010048|Ga0126373_10035025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4372 | Open in IMG/M |
3300010303|Ga0134082_10038151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1824 | Open in IMG/M |
3300010321|Ga0134067_10063647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
3300010325|Ga0134064_10032172 | Not Available | 1545 | Open in IMG/M |
3300010336|Ga0134071_10044810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1988 | Open in IMG/M |
3300010339|Ga0074046_10574977 | Not Available | 668 | Open in IMG/M |
3300010358|Ga0126370_11208649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
3300010361|Ga0126378_11691450 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300010366|Ga0126379_12154609 | Not Available | 659 | Open in IMG/M |
3300010366|Ga0126379_12607597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300010373|Ga0134128_12042949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300010376|Ga0126381_100039236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5731 | Open in IMG/M |
3300010379|Ga0136449_101978359 | Not Available | 862 | Open in IMG/M |
3300010399|Ga0134127_12006541 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300010401|Ga0134121_12220999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300011088|Ga0138576_1012344 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300011270|Ga0137391_10472142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
3300012350|Ga0137372_10058004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3385 | Open in IMG/M |
3300012359|Ga0137385_10549315 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300012361|Ga0137360_10239250 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300012361|Ga0137360_11620106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300012582|Ga0137358_10832658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300012923|Ga0137359_11715371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300012930|Ga0137407_11305127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300012971|Ga0126369_11381097 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300012987|Ga0164307_11345145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300012987|Ga0164307_11459558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300013105|Ga0157369_10733682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300014169|Ga0181531_10568814 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300014489|Ga0182018_10463617 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300014491|Ga0182014_10258153 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300014497|Ga0182008_10132182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1245 | Open in IMG/M |
3300014502|Ga0182021_12974698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300014969|Ga0157376_12752949 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300015242|Ga0137412_11185332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300015371|Ga0132258_11414320 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
3300015373|Ga0132257_100079160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3737 | Open in IMG/M |
3300016270|Ga0182036_10992452 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300017822|Ga0187802_10103450 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300017822|Ga0187802_10324762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300017928|Ga0187806_1293825 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300017933|Ga0187801_10260540 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300017938|Ga0187854_10023848 | All Organisms → cellular organisms → Bacteria | 3356 | Open in IMG/M |
3300017943|Ga0187819_10061463 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
3300017943|Ga0187819_10250422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
3300017946|Ga0187879_10616712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300017955|Ga0187817_10595435 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300017955|Ga0187817_10991027 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300017972|Ga0187781_10485926 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300017973|Ga0187780_10733193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300017975|Ga0187782_10880193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300017995|Ga0187816_10048524 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
3300017995|Ga0187816_10507788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300017996|Ga0187891_1118753 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300018006|Ga0187804_10260899 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300018007|Ga0187805_10183466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
3300018016|Ga0187880_1132822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
3300018020|Ga0187861_10339255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300018021|Ga0187882_1208458 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300018022|Ga0187864_10406192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300018030|Ga0187869_10330605 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300018035|Ga0187875_10552120 | Not Available | 609 | Open in IMG/M |
3300018038|Ga0187855_10937972 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300018044|Ga0187890_10295899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300018090|Ga0187770_10189270 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
3300018433|Ga0066667_11852235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300020004|Ga0193755_1122255 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300020170|Ga0179594_10425930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300020580|Ga0210403_11211888 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300020581|Ga0210399_11362821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300020583|Ga0210401_10886791 | Not Available | 751 | Open in IMG/M |
3300021170|Ga0210400_10056877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3047 | Open in IMG/M |
3300021178|Ga0210408_11367896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300021181|Ga0210388_10219843 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300021181|Ga0210388_10903124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300021181|Ga0210388_11825094 | Not Available | 500 | Open in IMG/M |
3300021401|Ga0210393_10704370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300021404|Ga0210389_11486272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300021406|Ga0210386_11195641 | Not Available | 643 | Open in IMG/M |
3300021420|Ga0210394_10665766 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300021432|Ga0210384_10083369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2875 | Open in IMG/M |
3300021560|Ga0126371_13709464 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300022524|Ga0224534_1042040 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300023101|Ga0224557_1193746 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300025454|Ga0208039_1013333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1896 | Open in IMG/M |
3300025473|Ga0208190_1096458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300025474|Ga0208479_1083778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300025477|Ga0208192_1054664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300025498|Ga0208819_1020074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1852 | Open in IMG/M |
3300025507|Ga0208188_1072796 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300025900|Ga0207710_10142186 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300025903|Ga0207680_11294894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300025908|Ga0207643_10651510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300025911|Ga0207654_10465741 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300025911|Ga0207654_10479229 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300025916|Ga0207663_10769751 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300025926|Ga0207659_11570843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300025929|Ga0207664_11714951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300025930|Ga0207701_10708219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300025934|Ga0207686_11185956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300025939|Ga0207665_10269123 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300025944|Ga0207661_10437297 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300026089|Ga0207648_11086527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300026142|Ga0207698_10396957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
3300026294|Ga0209839_10253130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300026315|Ga0209686_1053677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1465 | Open in IMG/M |
3300026329|Ga0209375_1022479 | All Organisms → cellular organisms → Bacteria | 3584 | Open in IMG/M |
3300026481|Ga0257155_1045184 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300026514|Ga0257168_1134984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300026550|Ga0209474_10205806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
3300027570|Ga0208043_1124377 | Not Available | 685 | Open in IMG/M |
3300027625|Ga0208044_1020061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2396 | Open in IMG/M |
3300027696|Ga0208696_1087825 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300027773|Ga0209810_1176599 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300027853|Ga0209274_10126794 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300027882|Ga0209590_10266548 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300027905|Ga0209415_10512453 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300027911|Ga0209698_10264666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1370 | Open in IMG/M |
3300028746|Ga0302233_10066992 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300028792|Ga0307504_10462650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300028874|Ga0302155_10003433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10262 | Open in IMG/M |
3300029907|Ga0311329_10712859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300029953|Ga0311343_10090999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3548 | Open in IMG/M |
3300029954|Ga0311331_10114854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3372 | Open in IMG/M |
3300029993|Ga0302304_10130421 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300030019|Ga0311348_10940832 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300030020|Ga0311344_10974401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300030049|Ga0302191_10387120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300030339|Ga0311360_10959435 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300030494|Ga0310037_10049477 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
3300030494|Ga0310037_10100672 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300030706|Ga0310039_10004193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8900 | Open in IMG/M |
3300030707|Ga0310038_10065248 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
3300031057|Ga0170834_111649424 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300031231|Ga0170824_105316528 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300031232|Ga0302323_102741741 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031236|Ga0302324_101824063 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300031561|Ga0318528_10343385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300031708|Ga0310686_115788047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300031736|Ga0318501_10037020 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
3300031754|Ga0307475_10016745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5043 | Open in IMG/M |
3300031754|Ga0307475_10787116 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300031823|Ga0307478_10511664 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300031893|Ga0318536_10520324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300031942|Ga0310916_11570576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300031959|Ga0318530_10375714 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300032025|Ga0318507_10181899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300032160|Ga0311301_11563183 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300032160|Ga0311301_11605137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300032174|Ga0307470_10931070 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300032261|Ga0306920_102485361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300032421|Ga0310812_10471343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300032783|Ga0335079_11975472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300032829|Ga0335070_11081224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300032892|Ga0335081_10406769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1748 | Open in IMG/M |
3300032954|Ga0335083_11263203 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300033982|Ga0371487_0183732 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.50% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.33% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.43% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.43% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.98% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.62% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.62% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.36% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.36% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.81% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.45% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.45% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.45% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.45% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.45% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.45% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.91% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11615J12901_103999901 | 3300000953 | Soil | MHKIFHFDTPADPYVADAAVLCCFDHRINTVVRKFLKKQNIERCDMI |
JGIcombinedJ26865_10608882 | 3300002347 | Arctic Peat Soil | MRKIFHFDSPDGQYIADAAVLCCFDHRISTAVRKFLKKQA |
JGI25385J37094_101665681 | 3300002558 | Grasslands Soil | MRKIFHFDSPADQYVADAAVLCCFDQRISRAVRKFLKKQGIERADMIIVA |
JGI25388J43891_10412281 | 3300002909 | Grasslands Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKFLRRQGILRPDMIVVAGG |
soilH2_102918191 | 3300003324 | Sugarcane Root And Bulk Soil | MEKTFHFDSPSEPYVADAVVLTCFDQRIRTVVNKFLQKRGILRPDMVVI |
Ga0062387_1003136322 | 3300004091 | Bog Forest Soil | MRKVFHFDSPAAPYVADAAVLCCFDHRIGTAVRKFLKKQGIERADMIVVAGGA |
Ga0062389_1012077193 | 3300004092 | Bog Forest Soil | MRKIFHFDSPPGQYVADAAVLCCFDHRIGTVVRKFLKKQNI |
Ga0062389_1040800782 | 3300004092 | Bog Forest Soil | MRKVFHFDSPAAPYVADAAVLCCFDHRIGTAVRKFLKKQGIERADM |
Ga0068919_11818443 | 3300004473 | Peatlands Soil | MKKVFHFESPPEPYVADAAVLCCFDQRIRLATYKFLKHQGILRPDMIVVA |
Ga0062594_1021569151 | 3300005093 | Soil | MKKVFHFDSPPDQYVADAAVLCCFDQRIRQAVRKFLQKQAIERPDM |
Ga0066677_108044071 | 3300005171 | Soil | MARSGKVTAMEKVFHFDSAAEPYVADAAVLCCFDQRIRLAVYKFLQKRGILRPDMI |
Ga0070690_1013554052 | 3300005330 | Switchgrass Rhizosphere | MQKAFHWDSPSDPYVADAVVLTCFDQRIRTAVNKFLHRRGILRPDMVVIAGGAKT |
Ga0068868_1000485771 | 3300005338 | Miscanthus Rhizosphere | MKKIFHFDSPDGQYVADAAVLCCFDHRISQVVRKFLKKQGIE |
Ga0070668_1022012482 | 3300005347 | Switchgrass Rhizosphere | MKKVFHFDSPPDQYVADAAVLCCFDQRIRQAVRKFLQKQAIERPDMIVIA |
Ga0070713_1001354581 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKVFHFDSPPEPYVADAAVLCCFDQRIRLAVYKFLQKRGILRPDM |
Ga0070710_106840713 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKTFHFDSQADPYVADAVVLTCFDQRIRTAVNKFLQKRGILRPDMVVIAGGAKTLA |
Ga0070711_1020476651 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFTFRIKAMPEMKKVFHFDSPPDQYVADAAVLCCFDQRIRQAVRKFLQKREIERPDMVV |
Ga0070735_106900252 | 3300005534 | Surface Soil | MHKVFHFDSPSDQYVADAAVLCCFDHRINMAVRKFL |
Ga0066704_109596242 | 3300005557 | Soil | MRKIFHFDSPADQYVADAAVLCCFDHRISTAVRKFLKKRGIERADMIVV |
Ga0066700_110023031 | 3300005559 | Soil | VRKVFHFDSPPERYSCDAAVISCFDQRFGLATRKF |
Ga0066699_102936191 | 3300005561 | Soil | VARSGKVTAMEKVFHFDSAADPYVADAAVLCCFDQRIRLAVYKFLQKRGILRPDMIVV |
Ga0066699_105802321 | 3300005561 | Soil | MRKIFHFDSPADQYVADAAVLCCFDHRISTAVRKFLKKRGIERADMIVVAG |
Ga0066693_103300322 | 3300005566 | Soil | MRKTFHFDSAPDPYIADAAVLCCFDERIRQTVYKFLKHQRILRPDMIIVAG |
Ga0070761_103146481 | 3300005591 | Soil | MARIEKILMRKVFHFDSPSGPYVADAAVLCCFDHRISTVVRKFL |
Ga0070763_101215161 | 3300005610 | Soil | MRKVFHFESPSEAYVADAAVLCCFDHRISMAVRKFLKKQGIERADMI |
Ga0068856_1017297301 | 3300005614 | Corn Rhizosphere | MEKTFHFDSPSEPYVADAVVLTCFDQRIRTAVNKFLQKRG |
Ga0070764_100084485 | 3300005712 | Soil | MRKVFHFDSPADPYVADAAVLCCFDHRIGTVVKKFLKKQAIE |
Ga0066903_1058108041 | 3300005764 | Tropical Forest Soil | MKKVFHFDSPPDAYTADAAVLCCFDYRISTAVQKFLRKQGIERPDMIIVAGGA |
Ga0068870_108462351 | 3300005840 | Miscanthus Rhizosphere | MQKAFHWDSPSDPYVADAVVLTCFDQRIRTAVNKFL |
Ga0070766_112881141 | 3300005921 | Soil | MQKIFHLDSPPEQYLADAAVLCCFDQRVRLATNKFLESQGILRPDMIVVAGGA |
Ga0066790_105065091 | 3300005995 | Soil | MEKIFHFDSPPEPYIADAAVLCCFDQRIRLAVHKFLQ |
Ga0070717_101455233 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKVFHFDSPPEPYVADAAVLCCFDQRIRLAVYKFLQKRGILRPDMVV |
Ga0070717_104470181 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKVFHFDSPSAPYIADAAVLSCFDQRIRTAVNKFLQRQGILR |
Ga0066656_102886811 | 3300006034 | Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKFLRRQGIL |
Ga0075028_1000337294 | 3300006050 | Watersheds | MDKLFHFDSPAEPYVADAAVLCCFDQRINLALRKFLARQEILR |
Ga0075029_1011915072 | 3300006052 | Watersheds | MRKIFHFDSPAAPYVADAAVICCFDHRIGTAVRKFLKKQAIERA |
Ga0075017_1003325882 | 3300006059 | Watersheds | MRKIFHFDSPADPYVADAAVLCCFDHRISQAVRKFLRKQNISRPDMI |
Ga0075015_1001537701 | 3300006102 | Watersheds | MDKIFHFDSSPEPYVADAAVLCCFDQRIRLAIYKFLKRQ |
Ga0075015_1009499631 | 3300006102 | Watersheds | MRKIFHFDSPADPYVADAAVLCCFDHRISTAVRKFLRKQNIS |
Ga0075030_1002660771 | 3300006162 | Watersheds | MRKIFHFDSPAAPYVADAAVLCCFDHRIGMAVRKFLKKQ |
Ga0070715_110096591 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKIFHFDSPADPYVADAAVLCCFDHRISQAVRKFLRKQGIERPDMI |
Ga0075014_1005451671 | 3300006174 | Watersheds | MRKIFHFDSPADPYVADAAVLCCFDHRISTVVRKFLRKQGIV |
Ga0070765_1000698785 | 3300006176 | Soil | MKKVFHFDSDAGPYVADAAVLCCFDQRIRLAVHKFLQRQSILRPDM |
Ga0070765_1002740983 | 3300006176 | Soil | MQKIFHFESPPEPYIAHAAVLCCFDHRIRLATNKFLES |
Ga0070765_1016324522 | 3300006176 | Soil | MQKIFHFESPPEAYAADAAVLCCFDQRIRQTTNQFLESQGILRPDMIVVAG |
Ga0097621_1012323532 | 3300006237 | Miscanthus Rhizosphere | MEKTFHFDSPSDPYVADAVVLTCFDQRIRTAVNKFLQK |
Ga0068871_1020208043 | 3300006358 | Miscanthus Rhizosphere | MRKIFHFDSPDGQYVADAAVLCCFDHRISQVVRKFLKK |
Ga0066665_106681721 | 3300006796 | Soil | MPEMKKVFHFDSPPDQYVADAAVLCCFDQRIRQAV |
Ga0066665_113146671 | 3300006796 | Soil | MLEENMNKIFHFDSAPDPYVADAAVLTCFDQRIRTTVNKF |
Ga0066660_113924881 | 3300006800 | Soil | VNKAFHFDSPSAPYVADAAVLTCFDQRIRQAVNKFLQRRGIL |
Ga0073928_103349783 | 3300006893 | Iron-Sulfur Acid Spring | MRKVFSFDSPPEQYVADAAVLCCFDHRINMAVREFLTQQGIER |
Ga0075436_1014274432 | 3300006914 | Populus Rhizosphere | MDLPGTPMQKIFHFDSPPEPYVADAAVLCCFDERIRLAVNKFLRRQGILRPDMI |
Ga0075435_1002287821 | 3300007076 | Populus Rhizosphere | MRKVFHFDSPADPYVADAAVLGCFDHRISTAVRKFLRKQGIERADMII |
Ga0075435_1008300061 | 3300007076 | Populus Rhizosphere | MQKIFHFDSPPEPYVADAAVLCCFDERIRLAVSKFLRRQGILR |
Ga0099793_107118081 | 3300007258 | Vadose Zone Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKFLRRQGILRPDMIVVAG |
Ga0066710_1046460721 | 3300009012 | Grasslands Soil | MQKVFHFDSEPDPYAADAAVLTCFDQRIRTTVNKFL |
Ga0066793_106829921 | 3300009029 | Prmafrost Soil | MRKVFHFDSPADPYVAGAAVLCCFDHRISTAVRKF |
Ga0111539_115944282 | 3300009094 | Populus Rhizosphere | MTEMKKVFHFDSPPDPYVADAAVLCCFDQRIRLAVRKFLDKREIKRP |
Ga0105241_116971922 | 3300009174 | Corn Rhizosphere | MEKTFHFDSAPDPYIADAAVLCCFDQRIRLAVNKFLQRQKILRPDMIVVAGG |
Ga0105248_101247851 | 3300009177 | Switchgrass Rhizosphere | MTEMKKVFHFDSPPDPYVADAAVLCCFDQRIRLAVRKFLDKREIKRPDMIVIAG |
Ga0116220_100299063 | 3300009525 | Peatlands Soil | MRKVFHFDSPAGPYVADAAVLCCFDHRISTAVRKFLKKQGIE |
Ga0116110_10259456 | 3300009643 | Peatland | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQAIERADMI |
Ga0116121_11885981 | 3300009644 | Peatland | MRKVFHFDSPAGPYVADAAVLCCFDHRISTAVRKFLKKQGIERADMITVA |
Ga0116134_13147191 | 3300009764 | Peatland | MRKVFHFDSPDEPYVADAAVLCCFDHRISTAVRKF |
Ga0126373_100350251 | 3300010048 | Tropical Forest Soil | MRKVFHFDSAPEPYVAGAAVLCCFDHRINLAVRKFL |
Ga0134082_100381514 | 3300010303 | Grasslands Soil | MHKIFHFDSPPEPYVADAAVLCCFDERIRLAVNKFLRRQGILRPDMIVV |
Ga0134067_100636471 | 3300010321 | Grasslands Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKFLRRQ |
Ga0134064_100321721 | 3300010325 | Grasslands Soil | MQKVFHFDSEPDPYIADAAVLTCFDQRIRTTVNKFLQRRGILRPDMIVIAG |
Ga0134071_100448101 | 3300010336 | Grasslands Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKFLRRQG |
Ga0074046_105749771 | 3300010339 | Bog Forest Soil | MRKVFHFDSPADPYIADAAVLCCFDHRISTAVRKFLKKQGIERADM |
Ga0126370_112086492 | 3300010358 | Tropical Forest Soil | MDKVFHFDAAPEPYVADAAVLTCFDQRIRQTVNKFLQRRGILRPDMIVVAGG |
Ga0126378_116914502 | 3300010361 | Tropical Forest Soil | MPKIFHFDSPSDPYIADAAVLCCFDHRINQAVRKFLRKRRIERADMIIVAGG |
Ga0126379_121546091 | 3300010366 | Tropical Forest Soil | MDKVFHFDAAPEPYVADAAVLTCFDQRIRQTVHKFLQRRGILRPDMIV |
Ga0126379_126075971 | 3300010366 | Tropical Forest Soil | MDKVFHFDSASEPYVADAVVLTCFDQRIRQTVNKFLQRRGILRPDM |
Ga0134128_120429492 | 3300010373 | Terrestrial Soil | MNAVNSMQKTFHFDSDPNPYIADAAVLCCFDQRIRLTVNKFLQRSEILRPDMI |
Ga0126381_1000392361 | 3300010376 | Tropical Forest Soil | MRKIFHFDSADDPYIADAAVLCCFDARISQAVRKFLRKQGIERPDMIIVA |
Ga0136449_1019783591 | 3300010379 | Peatlands Soil | MMRKIFHFDSPPGPYVADAAVLCCFDHRISLAVRKFLKKQGIERPDM |
Ga0134127_120065411 | 3300010399 | Terrestrial Soil | MQKTFHFHSAPDPYIADAAVLCCFDQRIRLTVNKFLQRSKILRPDMIVVAGGA |
Ga0134121_122209992 | 3300010401 | Terrestrial Soil | MEKAFHWDSSSDPYVADAVVLTCFDQRIRIAVNKFLQRRG |
Ga0138576_10123442 | 3300011088 | Peatlands Soil | MEKIFHFDSPPEPYTADAAVLCCFDQRIRLAVNKFLKRQGILRPD |
Ga0137391_104721422 | 3300011270 | Vadose Zone Soil | MQKIFHFDSPPEPYVADAAVLCCFDQRIRLAVHKFLQRQGIVRPDMIVVAGG |
Ga0137372_100580041 | 3300012350 | Vadose Zone Soil | MKKVFHFDSPPDPYVADAAVLCCFDQRIRLAVRKFLDKRGIRRPDMVVIA |
Ga0137385_105493151 | 3300012359 | Vadose Zone Soil | MQKAFHFDSSSEPYVADAAVLCCFDQRIRLAVNKF |
Ga0137360_102392501 | 3300012361 | Vadose Zone Soil | MRKIFQFDSPADPYVADAAVLCCFDHRISTVLRKFLRKQ |
Ga0137360_116201062 | 3300012361 | Vadose Zone Soil | MRKIFHFDSPADPYVADAAVLCCFDHRISTAVRKFL |
Ga0137358_108326581 | 3300012582 | Vadose Zone Soil | MRKIFHLDSPADQYVADAAVLCCFDHRISTAVRKFLKKQG |
Ga0137359_117153711 | 3300012923 | Vadose Zone Soil | MEKIFHFDSPPEPYVADAAVLCCFDQRIRLAVHKFLQRQGI |
Ga0137407_113051272 | 3300012930 | Vadose Zone Soil | MQKIFHFDSPPEPYTADAAVLCCFHQRIRLAVNKFL |
Ga0126369_113810971 | 3300012971 | Tropical Forest Soil | MKKVFHFDSPPDAYTADAAVLCCFDYRISTAVQKFLRKQGIERPDMIIV |
Ga0164307_113451452 | 3300012987 | Soil | MKKIFDFDSRPEAYVADAAVLCCFDQRIRLAVNKFLRRQ |
Ga0164307_114595581 | 3300012987 | Soil | MDKVFHFDSPSAPYIADAAVLSCFDQRIRTAVNKFLQRQGI |
Ga0157369_107336821 | 3300013105 | Corn Rhizosphere | MEKTFHFDSPPDPYVADAVVLTCFDQRIRTAVNKF |
Ga0181531_105688141 | 3300014169 | Bog | MRKVFHFDSPSAPYVADAAVLCCFDHRVATAVRKFLKKQGIERADM |
Ga0182018_104636171 | 3300014489 | Palsa | MRKVFHFDSAAESYVADAAVLCCFDHRISLATRKFLRKQGIHRPDM |
Ga0182014_102581531 | 3300014491 | Bog | MRKVFHFDSSADPYVADAAVLCCFDHRISTAVRKFLKKQGI |
Ga0182008_101321821 | 3300014497 | Rhizosphere | MHKIFHFDTPADPYVADAAVLCCFDHRINTVVRKFLKKQNIE |
Ga0182021_129746982 | 3300014502 | Fen | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQGVERAD |
Ga0157376_127529491 | 3300014969 | Miscanthus Rhizosphere | MRKIFHLDSPADPYVADAVVLSCFDARIATLVRKFLKKK |
Ga0137412_111853322 | 3300015242 | Vadose Zone Soil | MKKIFHFDSPTDPYVADAALICCFDHRINRAVRKFMKKQG |
Ga0132258_114143204 | 3300015371 | Arabidopsis Rhizosphere | MRKVFHFDSPADPYVADAAVLCCFDHRINTAVRKFLRKQGIE |
Ga0132257_1000791601 | 3300015373 | Arabidopsis Rhizosphere | MKKIFDFDSRPEAYVADAAVLCCFDQRIRLAVNKFLQRQGILRPDMIV |
Ga0182036_109924521 | 3300016270 | Soil | MRKIFHFDSPDAPYVADAAVLCCFDHRISTAVRKFLKKQNIERA |
Ga0187802_101034501 | 3300017822 | Freshwater Sediment | MRKVFHFDSPADPYVADAAVLCCFDHRIGTAVRKFLKKQAIERADMIVV |
Ga0187802_103247622 | 3300017822 | Freshwater Sediment | MRKVFHFDSPAEPYVADAAVLCCFDYRIGTAVHKFLKRQAIVRAD |
Ga0187806_12938251 | 3300017928 | Freshwater Sediment | MRKIFHFDSPPEPYVADAAVLCCFDQRISRAVRKFLKKQ |
Ga0187801_102605401 | 3300017933 | Freshwater Sediment | MEKIFHFDSPPEPYVADAAVLCCFDQRIRLATSKFLQRQGILRPDMIVV |
Ga0187854_100238487 | 3300017938 | Peatland | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQA |
Ga0187819_100614634 | 3300017943 | Freshwater Sediment | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQGIEHADMI |
Ga0187819_102504221 | 3300017943 | Freshwater Sediment | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQGIEHADMITVAG |
Ga0187879_106167122 | 3300017946 | Peatland | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLK |
Ga0187817_105954352 | 3300017955 | Freshwater Sediment | MGKVFPFDSSPEPYIADAAVLCCFDERIPTAAQKFLRRHRVLHPDMIAVAGSAQT |
Ga0187817_109910272 | 3300017955 | Freshwater Sediment | MRKIFHFDSPPGPYVADAAVLCCFDHRISLAVRKFLKKQGIERA |
Ga0187781_104859261 | 3300017972 | Tropical Peatland | MRKVFHFDSAADPYVADAAVLCCFDHRISTAVRKFLKKQGIEHADMIT |
Ga0187780_107331932 | 3300017973 | Tropical Peatland | MKKIFHFDSPPQAYVADAAVLCCFDQRIRLATNKFLHRKKILKPDMI |
Ga0187782_108801932 | 3300017975 | Tropical Peatland | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQGIEHADMITVAGGA |
Ga0187816_100485243 | 3300017995 | Freshwater Sediment | MRKVFHFDSAAGPYVADAAVLCCFDHRIRMAVRKFLKKQGIERADMIIVAGGA |
Ga0187816_105077881 | 3300017995 | Freshwater Sediment | MRKIFHFDSPAAPYVADAAVLCCFDYRIGTAVRKFLKKQGIER |
Ga0187891_11187531 | 3300017996 | Peatland | MRKVFDFDSPDGQYVADAAVLCCFDHRISAAVRQF |
Ga0187804_102608991 | 3300018006 | Freshwater Sediment | MRKIFHFDSPPEPYVADAAVLCCFDQRISRAVRKFLKKQAVER |
Ga0187805_101834661 | 3300018007 | Freshwater Sediment | MEKVFHFDSPPEQYVADAAVLCCFDERIRVATSKFLESQGVLRPDMIVVAGGARTLASP |
Ga0187880_11328221 | 3300018016 | Peatland | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQ |
Ga0187861_103392551 | 3300018020 | Peatland | MRKVFHFDSPAGPYVADAAVLCCFDHRISTAVRKFLKKQGVERADMISVAG |
Ga0187882_12084581 | 3300018021 | Peatland | MRKIFHFDSPAAPYVADAAVLCCFDHRIGMAVRKFLKKQSIERADMIVV |
Ga0187864_104061921 | 3300018022 | Peatland | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQG |
Ga0187869_103306051 | 3300018030 | Peatland | MRKVFDFDSPDGQYVADAAVLCCFDHRINRAVREF |
Ga0187875_105521202 | 3300018035 | Peatland | MRKVFHCDSPSGPYVADAAVLCCFDHRISTAVRKFLKK |
Ga0187855_109379722 | 3300018038 | Peatland | MRKVFHFDSPADPYVADAAVLCCFDHRIGTAVRKFLKKQGIERADM |
Ga0187890_102958991 | 3300018044 | Peatland | MRKVFHFDSPDEPYVADAAVLCCFDHRISTAVRKFL |
Ga0187770_101892704 | 3300018090 | Tropical Peatland | MRKVFHFDSPSEHYVADAAVLCCFDHRVNRAVRKFLKKQKIEHFDMIVV |
Ga0066667_118522351 | 3300018433 | Grasslands Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKF |
Ga0193755_11222551 | 3300020004 | Soil | MKKIFHFDSPAGPYVADAAVLCCFDHRISNAVRKFLKKQVIERADMIVVA |
Ga0179594_104259301 | 3300020170 | Vadose Zone Soil | LRKIFHFDSPADAYVADAAVLCCFDHRINQAVRKFLRKQHIE |
Ga0210403_112118882 | 3300020580 | Soil | MRKVFHFDSPSGPYVADAAVLCCFDHRISTAVRKFLKKQGIERADMIIVAGGA |
Ga0210399_113628212 | 3300020581 | Soil | MKQVFYFDSPPEPYVADAAVLCCFDQRIRLAVNKFLQRQDILRPDM |
Ga0210401_108867912 | 3300020583 | Soil | MRKVFEFDSPSGPYVADAAVLCCFDHRISMVVREFLKQQEIERADMIIV |
Ga0210400_100568775 | 3300021170 | Soil | MRKIFHFDSPADQYVADAAVLCCFDHRISTAVRKFLKKQGI |
Ga0210408_113678961 | 3300021178 | Soil | MRKIFHFDSPADPYVADAAVLCCFDHRISQAVRKFLR |
Ga0210388_102198434 | 3300021181 | Soil | MARIEKILMRKVFHFDSPSGPYVADAAVLCCFDHRISTVVRKFLKKQGIERADMIIVAGG |
Ga0210388_109031242 | 3300021181 | Soil | MRKVFHFDSPADPYVADAAVLCCFDHRIGTVVKKFLKKQAIERADMIV |
Ga0210388_118250942 | 3300021181 | Soil | MRKIFHFDSADSAYTADAAVLSCFDYRISTVVRKFLKKQG |
Ga0210393_107043701 | 3300021401 | Soil | MKKIFHFDSEPDPYVADAAVLTCFDYRVNRVVRKFLKKQGIE |
Ga0210389_114862721 | 3300021404 | Soil | MKQVFYFDSPPEPYVADAAVLCCFDQRIRLAVNKFLQ |
Ga0210386_111956411 | 3300021406 | Soil | MRKIFHFDSPPGPYVADAAVLCCFDHRISTAVRKFLKKQAIERPDMIIVAGG |
Ga0210394_106657662 | 3300021420 | Soil | MDKVFHFDSPPEQYIADAAVLCCFDQRIRLAVHKFLQRQSIVRPDMIVVA |
Ga0210384_100833691 | 3300021432 | Soil | MRKIFHFDSPADPYVADAAVLCCFDHRISTAVRKFLRKQGIER |
Ga0126371_137094642 | 3300021560 | Tropical Forest Soil | MRKIFHFDSPADAYVADAAVLCCFDARIGQAVRKFLRKQGIERP |
Ga0224534_10420401 | 3300022524 | Soil | MRKVFHFDSSADPYVADAAVLCCFDHRISTAVRKFLKKQGIERADMIIVAG |
Ga0224557_11937463 | 3300023101 | Soil | VRKVFHFDSPPGPYVADAAVLCCFDHRISMAVRKFL |
Ga0208039_10133331 | 3300025454 | Peatland | MRKVFHFDSPDEPYVADAAVLCCFDHRISTAVRKFLKKQRIEH |
Ga0208190_10964582 | 3300025473 | Peatland | MRKIFHFDSPPDPYIADAAVLCCFDHRINLAVRKFLKDQSIERPDMIVVAGGA |
Ga0208479_10837781 | 3300025474 | Arctic Peat Soil | MRKIFHFDSPDGQYIADAAVLCCFDHRISTAVRKFLKK |
Ga0208192_10546641 | 3300025477 | Peatland | MRKVFHFDSPDEPYVADAAVLCCFDHRISTAVRKFLKKQRIE |
Ga0208819_10200741 | 3300025498 | Peatland | MRKVFHFDSPDEPYVADAAVLCCFDHRISTAVRKFLKKQRIEHADMIVVAGG |
Ga0208188_10727961 | 3300025507 | Peatland | MRKVFHFDSPDSPYVADAAVLCCFDYRIGTAVRKFLKKQAIAR |
Ga0207710_101421863 | 3300025900 | Switchgrass Rhizosphere | MRKIFHFDSPADPYVADAAVLCCFDDRISTVVRKFLRK |
Ga0207680_112948941 | 3300025903 | Switchgrass Rhizosphere | MKKIFHFDSHPQPYVADAAVLCCFDQRIRLAVNKFLQRQGI |
Ga0207643_106515101 | 3300025908 | Miscanthus Rhizosphere | MQKAFHWDSPSDPYVADAVVLTCFDQRIRTAVNKFLHRRGIL |
Ga0207654_104657413 | 3300025911 | Corn Rhizosphere | MRKIFHFDSPADPYVADAAVLCCFDDRISTVVRKFLRKQNIVRCDMIVV |
Ga0207654_104792291 | 3300025911 | Corn Rhizosphere | MEKTFHFDSPSEPYVADAVVLTCFDQRIRTVVNKFLQK |
Ga0207663_107697512 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKIFHFDSPADPYVADAAVLCCFDHRISQAVRKFLRKQNIERPDM |
Ga0207659_115708431 | 3300025926 | Miscanthus Rhizosphere | MKKVFHFDSPPDQYVADAAVLCCFDQRIRQAVRKFLQKQAIERPDMIVIAGGAR |
Ga0207664_117149511 | 3300025929 | Agricultural Soil | MRKIFHFDSPADPYVADAAVLCCFDHRISQAVRKFLRKQGIERPDMIIVAGGA |
Ga0207701_107082192 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKIFHFDSHPQPYVADAAVLCCFDQRIRLAVNKFLQRQGILRPDMIVV |
Ga0207686_111859561 | 3300025934 | Miscanthus Rhizosphere | MKKVFHFDSPPDQYVADAAVLCCFDQRIRQAVRKFLQKQGIERPDMIVIA |
Ga0207665_102691234 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MYKIFHFDSPPEPYITDAAVLCCFDEPIRLAVNKFLRR |
Ga0207661_104372973 | 3300025944 | Corn Rhizosphere | MRKIFHFDSPADPYVADAAVLCCFDDRISTVVRKFL |
Ga0207648_110865271 | 3300026089 | Miscanthus Rhizosphere | MRKIFHFDSPADPYVADAAVLCCFDDRISTVVRKFLRNQNIVRCDMIIV |
Ga0207698_103969572 | 3300026142 | Corn Rhizosphere | MQKAFHWDSPSDPYVADAVVLTCFDQRIRTAVNKFLHRRGILRPDM |
Ga0209839_102531302 | 3300026294 | Soil | MEKIFHFDSPPEPYIADAAVLCCFDQRIRLAVHKFLQKQGIVRPDMIVV |
Ga0209686_10536771 | 3300026315 | Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKFLR |
Ga0209375_10224791 | 3300026329 | Soil | MQKIFHFDSPPEPYVSDAAVLCCFDERIRLAVNKFLRRQGILRPDMIVVA |
Ga0257155_10451841 | 3300026481 | Soil | MRKIFHFDSPADQYVADAAVLCCFDHRISTAVRKFLKKQGIERADMIVVA |
Ga0257168_11349841 | 3300026514 | Soil | MRKIFHFDSPADPYVADAAVLCCFDHRISAAVRKFLKK |
Ga0209474_102058061 | 3300026550 | Soil | MHKIFHFDSPPEPYVADAAVLCCFDERIRLAVNKFLRRQGSLRPD |
Ga0208043_11243772 | 3300027570 | Peatlands Soil | MRKIFHFDSPPGPYVADAAVLCCFDHRISLAVRKFLKKQGIERPDMIIVAG |
Ga0208044_10200614 | 3300027625 | Peatlands Soil | MRKVFHFDSPADPYVADAAVLCCFDQRISTAVRKFLKKQGI |
Ga0208696_10878253 | 3300027696 | Peatlands Soil | MRKVFHFDSPADPYAADAAVLCCFDHRISTAVRKFLKKQGIERADMITVAGG |
Ga0209810_11765991 | 3300027773 | Surface Soil | MTQTARTMQKVFHFDSDPAAYTADAAVLCCFDERIRGAVQKFLR |
Ga0209274_101267943 | 3300027853 | Soil | MRKVFHFDSPPEPYVADAAVLCCFDHRINRAVRKFLKKQA |
Ga0209590_102665483 | 3300027882 | Vadose Zone Soil | MRKIFHFDSPADQYVADAAVLCCFDHRISTVVRKF |
Ga0209415_105124533 | 3300027905 | Peatlands Soil | MRKVFHFDSPADPYAADAAVLCCFDHRISTAVRKFLKKQG |
Ga0209698_102646663 | 3300027911 | Watersheds | MRKIFHCDSPAAPYVADAAVLCCFDHRIGMAVRKFLKKQGIE |
Ga0302233_100669921 | 3300028746 | Palsa | MRKVFHFDSPAAPYVADAAVLCCFDHRIGTAVRKFLKKQNIERADMIVVAG |
Ga0307504_104626501 | 3300028792 | Soil | VCMRKVFHFDSPADPYVADAVVLCCFDHRISTAVRKFL |
Ga0302155_100034331 | 3300028874 | Bog | MRKIFHFDSPSAPYVADAAVLCCFDHRIGTAVRKFLKKQG |
Ga0311329_107128591 | 3300029907 | Bog | LMRKIFHFDSPSAPYVADAAVLCCFDHRIGTAVRKFLKKQGV |
Ga0311343_100909991 | 3300029953 | Bog | MRKIFHFDSPSAPYVADAAVLCCFDHRIGTAVRKFLKKQ |
Ga0311331_101148541 | 3300029954 | Bog | MRKIFHFDSPSAPYVADAAVLCCFDHRIGTAVRKFLKKQGIERADMI |
Ga0302304_101304212 | 3300029993 | Palsa | MRKVFHFDSPAAPYVADAAVLCCFDHRIGTAVRKFLKKQNIERADMI |
Ga0311348_109408321 | 3300030019 | Fen | MEKIFHFDSPPEPYVADAAVLCCFDQRIRLATNKFLQRQRILRPDMII |
Ga0311344_109744011 | 3300030020 | Bog | MRKIFHFDSPSAPYVADAAVLCCFDHRIGTAVRKFLKK |
Ga0302191_103871202 | 3300030049 | Bog | MRKIFHFDSPSAPYVADAAVLCCFDHRIGTAVRKFLKKQGIERADMIVVAGG |
Ga0311360_109594351 | 3300030339 | Bog | MEKIFHFDSPPEPYVADAAVLCCFDQRIRLATNKFLQRQRILRPD |
Ga0310037_100494771 | 3300030494 | Peatlands Soil | MRKVFHFDSPPGPYVADAAVLCCFDHRISTAVRKFL |
Ga0310037_101006721 | 3300030494 | Peatlands Soil | MRKIFHFDSPPGPYVADAAVLCCFDHRISLAVRKFLKKQGIERPDMVIVAGG |
Ga0310039_100041938 | 3300030706 | Peatlands Soil | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQGIERADMIT |
Ga0310038_100652483 | 3300030707 | Peatlands Soil | MRKVFHFDSPADPYVADAAVLCCFDHRISTAVRKFLKKQGIERADMITVAGG |
Ga0170834_1116494241 | 3300031057 | Forest Soil | MDKIFHFDSAPDPYIADAAVLTCFDQRIRATVNKFLQRRGILRPDMI |
Ga0170824_1053165281 | 3300031231 | Forest Soil | MQKTFHFDSARDPYIADAAVLCCFDQRIRLAVNKFLQRSEILR |
Ga0302323_1027417411 | 3300031232 | Fen | MKKIFHFDSPPEQYVADAAVLCCFDHRINRAVRKFLKKQGIERADMI |
Ga0302324_1018240632 | 3300031236 | Palsa | MEQIFQFDSPPESYLADAAVLCCFDQRIRLAVNEFLLSQGVQRPD |
Ga0318528_103433851 | 3300031561 | Soil | MRKIFHFDSPADPYIADAAVLCCFDARINQVVRKFLRKQGIE |
Ga0310686_1157880471 | 3300031708 | Soil | MRKVFHFDSPAGPYVADAAVLCCFDHRIGTAVRKFLKKQGIERADM |
Ga0318501_100370201 | 3300031736 | Soil | MRKIFHFDSPADPYIADAAVLCCFDARINQVVRKFLR |
Ga0307475_100167451 | 3300031754 | Hardwood Forest Soil | MRKIFHFDSPADQYVADAAVLCCFDHRISTAVRKFLKKQGIE |
Ga0307475_107871161 | 3300031754 | Hardwood Forest Soil | MRKVFHFDSPPGQYIADAAVLCCFDYRISTVVRKFLKKQAIELPDMIV |
Ga0307478_105116643 | 3300031823 | Hardwood Forest Soil | MRKIFHFDSPADQYVADAAVLCCFDHRISTAVRKFLKKQAI |
Ga0318536_105203241 | 3300031893 | Soil | MRKIFHFDSPADPYIADAAVLCCFDARINQVVRKFLRKQGIERPD |
Ga0310916_115705761 | 3300031942 | Soil | MEKIFHFDSADDAYVADAAVLCCFDHRISQVARKFLRRQGIVRPDWVV |
Ga0318530_103757141 | 3300031959 | Soil | MKKIFHFDSAAEPYVADAAVLTCFDYRVNRVVRKFLKKQGI |
Ga0318507_101818991 | 3300032025 | Soil | MRKIFHFDSPADPYIADAAVLCCFDHRINQAVRKFLRKQGI |
Ga0311301_115631832 | 3300032160 | Peatlands Soil | MRKIFHFDSSPGSYVADAAVLCCFDHRISLAVRKFLKKQGIERP |
Ga0311301_116051372 | 3300032160 | Peatlands Soil | MRKVFHFDSPAGPYVADAAVLCCFDHRISTAVRKFLKKQGI |
Ga0307470_109310702 | 3300032174 | Hardwood Forest Soil | MRKVFHFDSPAEPYVADAAVLCCFDHRISTVVRKFLRKQG |
Ga0306920_1024853612 | 3300032261 | Soil | MRKIFHFDSLADPYVADAAVLCCFDARISQAVRKFLRKQG |
Ga0310812_104713431 | 3300032421 | Soil | MRKIFHFDSPADPYVADAAVLCCFDDRISTVVRKFLRKQNIVRCDMI |
Ga0335079_119754721 | 3300032783 | Soil | MQKVFHFDSDSAPYVADAAVLCCFDHRINTAAQKFLKRTGI |
Ga0335070_110812242 | 3300032829 | Soil | MEKIFHFDSPPQAYVADAAVLCCFDQRIRLAINKFLQRQGILRPDM |
Ga0335081_104067691 | 3300032892 | Soil | MKKLFHFDSPAEPYIADAAVLCCFDQRIRLATNKFLQRHEILRPDMIVVAGG |
Ga0335083_112632031 | 3300032954 | Soil | MKKVFHFDSPSDPYVADAAVLCCFDHRINRAVRKFLKKEGIERADMIVV |
Ga0371487_0183732_3_116 | 3300033982 | Peat Soil | MRKVFHFDSPADPYVADAAVVCCFDYRINRAVRKFLKK |
⦗Top⦘ |