| Basic Information | |
|---|---|
| Family ID | F020917 |
| Family Type | Metagenome |
| Number of Sequences | 221 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTPEQIDRVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFL |
| Number of Associated Samples | 176 |
| Number of Associated Scaffolds | 221 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.33 % |
| % of genes near scaffold ends (potentially truncated) | 99.10 % |
| % of genes from short scaffolds (< 2000 bps) | 93.21 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.095 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.217 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.27% β-sheet: 23.94% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 221 Family Scaffolds |
|---|---|---|
| PF13672 | PP2C_2 | 33.03 |
| PF07228 | SpoIIE | 27.60 |
| PF00498 | FHA | 8.60 |
| PF01594 | AI-2E_transport | 0.45 |
| PF01098 | FTSW_RODA_SPOVE | 0.45 |
| PF01370 | Epimerase | 0.45 |
| PF03466 | LysR_substrate | 0.45 |
| PF00578 | AhpC-TSA | 0.45 |
| PF06983 | 3-dmu-9_3-mt | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 221 Family Scaffolds |
|---|---|---|---|
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.45 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.45 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.45 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.10 % |
| Unclassified | root | N/A | 0.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_104602132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300001431|F14TB_100477771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1598 | Open in IMG/M |
| 3300004192|Ga0066448_1056156 | Not Available | 548 | Open in IMG/M |
| 3300004268|Ga0066398_10143310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300005176|Ga0066679_10399201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 901 | Open in IMG/M |
| 3300005178|Ga0066688_10605441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 704 | Open in IMG/M |
| 3300005329|Ga0070683_100406284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1299 | Open in IMG/M |
| 3300005329|Ga0070683_101063088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 777 | Open in IMG/M |
| 3300005330|Ga0070690_100200929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1387 | Open in IMG/M |
| 3300005331|Ga0070670_100569875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1011 | Open in IMG/M |
| 3300005334|Ga0068869_101897329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300005335|Ga0070666_10882631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 661 | Open in IMG/M |
| 3300005335|Ga0070666_11086251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 595 | Open in IMG/M |
| 3300005335|Ga0070666_11331121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 536 | Open in IMG/M |
| 3300005347|Ga0070668_100049200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3244 | Open in IMG/M |
| 3300005355|Ga0070671_101145697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 684 | Open in IMG/M |
| 3300005356|Ga0070674_100038290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3231 | Open in IMG/M |
| 3300005366|Ga0070659_100325194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1286 | Open in IMG/M |
| 3300005435|Ga0070714_100283147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1541 | Open in IMG/M |
| 3300005438|Ga0070701_10149158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1345 | Open in IMG/M |
| 3300005441|Ga0070700_100979363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 694 | Open in IMG/M |
| 3300005451|Ga0066681_10034068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2708 | Open in IMG/M |
| 3300005458|Ga0070681_11611959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300005459|Ga0068867_100355943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1223 | Open in IMG/M |
| 3300005466|Ga0070685_10225311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1230 | Open in IMG/M |
| 3300005536|Ga0070697_102092439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300005539|Ga0068853_100311831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1456 | Open in IMG/M |
| 3300005539|Ga0068853_101284300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300005543|Ga0070672_100453007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1105 | Open in IMG/M |
| 3300005548|Ga0070665_100314283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1570 | Open in IMG/M |
| 3300005555|Ga0066692_10850260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300005556|Ga0066707_10499610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 789 | Open in IMG/M |
| 3300005564|Ga0070664_100165193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1961 | Open in IMG/M |
| 3300005569|Ga0066705_10032805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2807 | Open in IMG/M |
| 3300005615|Ga0070702_101655669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 531 | Open in IMG/M |
| 3300005616|Ga0068852_100232025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1759 | Open in IMG/M |
| 3300005718|Ga0068866_10333327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 958 | Open in IMG/M |
| 3300005719|Ga0068861_101147593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 749 | Open in IMG/M |
| 3300005719|Ga0068861_101153116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 747 | Open in IMG/M |
| 3300005764|Ga0066903_106663198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
| 3300005840|Ga0068870_10141307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1409 | Open in IMG/M |
| 3300005842|Ga0068858_101152071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300005843|Ga0068860_100211828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1880 | Open in IMG/M |
| 3300005843|Ga0068860_102714837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300006046|Ga0066652_101150616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 735 | Open in IMG/M |
| 3300006353|Ga0075370_10041064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2611 | Open in IMG/M |
| 3300006354|Ga0075021_10587650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 710 | Open in IMG/M |
| 3300006358|Ga0068871_101355446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 670 | Open in IMG/M |
| 3300006854|Ga0075425_102056130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 638 | Open in IMG/M |
| 3300006871|Ga0075434_101948916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300006881|Ga0068865_100086271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2266 | Open in IMG/M |
| 3300006881|Ga0068865_101852640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 546 | Open in IMG/M |
| 3300006969|Ga0075419_11506722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
| 3300009131|Ga0115027_10808514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 716 | Open in IMG/M |
| 3300009156|Ga0111538_13935987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
| 3300009176|Ga0105242_10578663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1081 | Open in IMG/M |
| 3300009551|Ga0105238_12923191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300010048|Ga0126373_12357858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300010166|Ga0126306_11128228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300010329|Ga0134111_10566979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
| 3300010358|Ga0126370_11609243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 622 | Open in IMG/M |
| 3300010373|Ga0134128_12772801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300010373|Ga0134128_12920173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 526 | Open in IMG/M |
| 3300010398|Ga0126383_10494650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1280 | Open in IMG/M |
| 3300010399|Ga0134127_11807872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 687 | Open in IMG/M |
| 3300010400|Ga0134122_10323026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1333 | Open in IMG/M |
| 3300010400|Ga0134122_10911738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 851 | Open in IMG/M |
| 3300010401|Ga0134121_12238944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 584 | Open in IMG/M |
| 3300010401|Ga0134121_12413251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
| 3300010403|Ga0134123_13482730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 509 | Open in IMG/M |
| 3300012096|Ga0137389_10221655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1581 | Open in IMG/M |
| 3300012185|Ga0136619_10211063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
| 3300012188|Ga0136618_10478992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 538 | Open in IMG/M |
| 3300012198|Ga0137364_10766950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 728 | Open in IMG/M |
| 3300012357|Ga0137384_10388265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1154 | Open in IMG/M |
| 3300012512|Ga0157327_1088725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 510 | Open in IMG/M |
| 3300012517|Ga0157354_1022990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300012519|Ga0157352_1045474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 636 | Open in IMG/M |
| 3300012684|Ga0136614_11034952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
| 3300012905|Ga0157296_10022639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1250 | Open in IMG/M |
| 3300012907|Ga0157283_10330597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 541 | Open in IMG/M |
| 3300012913|Ga0157298_10221530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 622 | Open in IMG/M |
| 3300012971|Ga0126369_12969528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
| 3300013296|Ga0157374_10747573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 992 | Open in IMG/M |
| 3300013306|Ga0163162_13036583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 539 | Open in IMG/M |
| 3300013308|Ga0157375_10045814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4258 | Open in IMG/M |
| 3300013308|Ga0157375_10425065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1494 | Open in IMG/M |
| 3300013308|Ga0157375_10896953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300014166|Ga0134079_10618271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 541 | Open in IMG/M |
| 3300014326|Ga0157380_10242798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1625 | Open in IMG/M |
| 3300014326|Ga0157380_11639706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 699 | Open in IMG/M |
| 3300014968|Ga0157379_10890648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300015167|Ga0167661_1069432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300015201|Ga0173478_10139007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 950 | Open in IMG/M |
| 3300015372|Ga0132256_101154979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 888 | Open in IMG/M |
| 3300015374|Ga0132255_105939490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 517 | Open in IMG/M |
| 3300016445|Ga0182038_10865266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 795 | Open in IMG/M |
| 3300017787|Ga0183260_10026382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4404 | Open in IMG/M |
| 3300017787|Ga0183260_10383678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300017789|Ga0136617_10713367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300017792|Ga0163161_11396875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 611 | Open in IMG/M |
| 3300017792|Ga0163161_12084847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
| 3300018051|Ga0184620_10056795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1117 | Open in IMG/M |
| 3300018075|Ga0184632_10297800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300018078|Ga0184612_10563681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300018466|Ga0190268_11572383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300018469|Ga0190270_12183857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 614 | Open in IMG/M |
| 3300018481|Ga0190271_12733965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300018481|Ga0190271_13605649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
| 3300019882|Ga0193713_1133862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 675 | Open in IMG/M |
| 3300020002|Ga0193730_1088620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 869 | Open in IMG/M |
| 3300020186|Ga0163153_10221401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300021073|Ga0210378_10330125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 571 | Open in IMG/M |
| 3300021082|Ga0210380_10150058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1045 | Open in IMG/M |
| 3300021384|Ga0213876_10278201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 889 | Open in IMG/M |
| 3300021445|Ga0182009_10159592 | Not Available | 1076 | Open in IMG/M |
| 3300021445|Ga0182009_10356946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300023056|Ga0233357_1012972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 933 | Open in IMG/M |
| 3300025321|Ga0207656_10152091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1096 | Open in IMG/M |
| 3300025893|Ga0207682_10191692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300025893|Ga0207682_10637460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 501 | Open in IMG/M |
| 3300025893|Ga0207682_10639303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300025903|Ga0207680_10590102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 794 | Open in IMG/M |
| 3300025903|Ga0207680_11037712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
| 3300025905|Ga0207685_10871184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300025908|Ga0207643_10497499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 779 | Open in IMG/M |
| 3300025925|Ga0207650_10045291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3236 | Open in IMG/M |
| 3300025925|Ga0207650_10721434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300025926|Ga0207659_11178095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300025931|Ga0207644_10269305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
| 3300025932|Ga0207690_11125627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 655 | Open in IMG/M |
| 3300025934|Ga0207686_11510989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 554 | Open in IMG/M |
| 3300025935|Ga0207709_10301876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1191 | Open in IMG/M |
| 3300025938|Ga0207704_10093776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1980 | Open in IMG/M |
| 3300025938|Ga0207704_10279837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1267 | Open in IMG/M |
| 3300025941|Ga0207711_10238553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1667 | Open in IMG/M |
| 3300025944|Ga0207661_10652096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 967 | Open in IMG/M |
| 3300025945|Ga0207679_10067324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2686 | Open in IMG/M |
| 3300025945|Ga0207679_10851284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 833 | Open in IMG/M |
| 3300025972|Ga0207668_10021350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 4129 | Open in IMG/M |
| 3300025972|Ga0207668_12028156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
| 3300025986|Ga0207658_11473783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 622 | Open in IMG/M |
| 3300025986|Ga0207658_11940938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 536 | Open in IMG/M |
| 3300026041|Ga0207639_10185942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Xylophilus → unclassified Xylophilus → Xylophilus sp. Leaf220 | 1771 | Open in IMG/M |
| 3300026041|Ga0207639_11198461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 713 | Open in IMG/M |
| 3300026041|Ga0207639_11381465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 661 | Open in IMG/M |
| 3300026067|Ga0207678_10887083 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300026075|Ga0207708_10092437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2334 | Open in IMG/M |
| 3300026088|Ga0207641_10894111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 882 | Open in IMG/M |
| 3300026089|Ga0207648_10891605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 830 | Open in IMG/M |
| 3300026095|Ga0207676_10234818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1641 | Open in IMG/M |
| 3300026095|Ga0207676_11828835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300026095|Ga0207676_12132354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300026095|Ga0207676_12134663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
| 3300026118|Ga0207675_101097832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 815 | Open in IMG/M |
| 3300027907|Ga0207428_10335933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1113 | Open in IMG/M |
| 3300027909|Ga0209382_11124525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 809 | Open in IMG/M |
| 3300028380|Ga0268265_10028250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4015 | Open in IMG/M |
| 3300028380|Ga0268265_12349013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300028381|Ga0268264_11013288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 837 | Open in IMG/M |
| 3300028587|Ga0247828_10680202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 638 | Open in IMG/M |
| 3300028587|Ga0247828_10734799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 619 | Open in IMG/M |
| 3300028587|Ga0247828_10910995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 567 | Open in IMG/M |
| 3300028589|Ga0247818_10195582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1327 | Open in IMG/M |
| 3300028589|Ga0247818_10480152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 846 | Open in IMG/M |
| 3300028590|Ga0247823_11484275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 508 | Open in IMG/M |
| 3300028592|Ga0247822_10886556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300028592|Ga0247822_11533556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 564 | Open in IMG/M |
| 3300028596|Ga0247821_11210357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 513 | Open in IMG/M |
| 3300028608|Ga0247819_10487534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300028809|Ga0247824_10284154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 927 | Open in IMG/M |
| 3300028809|Ga0247824_10663637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 632 | Open in IMG/M |
| 3300028872|Ga0307314_10276710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
| 3300028889|Ga0247827_10421194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 816 | Open in IMG/M |
| 3300030048|Ga0302273_1112378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300030336|Ga0247826_10786462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 744 | Open in IMG/M |
| 3300030336|Ga0247826_11673101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 519 | Open in IMG/M |
| 3300031543|Ga0318516_10644318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300031546|Ga0318538_10433187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 712 | Open in IMG/M |
| 3300031640|Ga0318555_10256469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 945 | Open in IMG/M |
| 3300031640|Ga0318555_10608419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300031668|Ga0318542_10583002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300031720|Ga0307469_11409969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300031751|Ga0318494_10817514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031765|Ga0318554_10842366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031771|Ga0318546_10738677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300031820|Ga0307473_10290229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1024 | Open in IMG/M |
| 3300031859|Ga0318527_10145519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 992 | Open in IMG/M |
| 3300031896|Ga0318551_10664622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300031901|Ga0307406_12113044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 505 | Open in IMG/M |
| 3300031910|Ga0306923_11930912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300031938|Ga0308175_102718350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 553 | Open in IMG/M |
| 3300031938|Ga0308175_102823004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300031939|Ga0308174_10145516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1758 | Open in IMG/M |
| 3300031996|Ga0308176_10986807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 888 | Open in IMG/M |
| 3300032001|Ga0306922_10974058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300032001|Ga0306922_11571410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300032005|Ga0307411_10277583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1332 | Open in IMG/M |
| 3300032005|Ga0307411_12000198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 541 | Open in IMG/M |
| 3300032009|Ga0318563_10757798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300032012|Ga0310902_10561543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 753 | Open in IMG/M |
| 3300032013|Ga0310906_10280528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1054 | Open in IMG/M |
| 3300032065|Ga0318513_10420301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300032074|Ga0308173_10704842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 922 | Open in IMG/M |
| 3300032074|Ga0308173_10846126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 844 | Open in IMG/M |
| 3300032074|Ga0308173_10939211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 801 | Open in IMG/M |
| 3300032090|Ga0318518_10177757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1087 | Open in IMG/M |
| 3300032174|Ga0307470_11089935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
| 3300032180|Ga0307471_100237529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1863 | Open in IMG/M |
| 3300032180|Ga0307471_100356294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1575 | Open in IMG/M |
| 3300032261|Ga0306920_102876843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300032782|Ga0335082_11630696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 518 | Open in IMG/M |
| 3300032828|Ga0335080_11632423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 634 | Open in IMG/M |
| 3300032893|Ga0335069_10033848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6878 | Open in IMG/M |
| 3300033290|Ga0318519_11054936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300033550|Ga0247829_11076656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 667 | Open in IMG/M |
| 3300033551|Ga0247830_10051477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2704 | Open in IMG/M |
| 3300033551|Ga0247830_11396895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300034125|Ga0370484_0021844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1474 | Open in IMG/M |
| 3300034147|Ga0364925_0360690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
| 3300034268|Ga0372943_0388313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 899 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.17% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.45% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.45% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.45% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.45% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.45% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.45% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.45% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004192 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 70_HOW9 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1046021322 | 3300000956 | Soil | MKPADIERVFGRSRLRMVTGDHVEVYREAAQPGERRRYTKRFLATDAGDFR |
| F14TB_1004777711 | 3300001431 | Soil | MTPEQIERVFGCSRLKMATGEHVEVFREAVRPGERRRYTKRFLET |
| Ga0066448_10561562 | 3300004192 | Freshwater Sediment | MERSDIDLVFGRGRVRMVTGKHVEVFREDSQPGERRRYSKRFLATAAGD |
| Ga0066398_101433102 | 3300004268 | Tropical Forest Soil | MTPGQIDRVFGRGRLKMATGEHVEVFREAAAPGERRRYTKRFLNT |
| Ga0066679_103992012 | 3300005176 | Soil | MTPEQIDHVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFLN |
| Ga0066688_106054411 | 3300005178 | Soil | MTPEQIDRVFGRGRLKMATGEHVEVFREAVASGERRRYTKRFLNTREGD |
| Ga0070683_1004062843 | 3300005329 | Corn Rhizosphere | MTSDQLERVFGRTRLKMATGEHVEVHREAASPGERRRYTKRFL |
| Ga0070683_1010630881 | 3300005329 | Corn Rhizosphere | MKQEQIERVFGRGRLRMVTGEHVEVFREAVAPGERRRYTKRFLATGDADF |
| Ga0070690_1002009293 | 3300005330 | Switchgrass Rhizosphere | MTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFLATA |
| Ga0070670_1005698752 | 3300005331 | Switchgrass Rhizosphere | MTPQQIEQVFGRGRLKMATGDHVEVFREAIAPGERRRYTKRF |
| Ga0068869_1018973292 | 3300005334 | Miscanthus Rhizosphere | VTPADIDRVFGRARLRMVTGDHVEVFREASLPGERRRYTKRFLATAAGD |
| Ga0070666_108826311 | 3300005335 | Switchgrass Rhizosphere | MTPEQIDRVFGRGRLKMATGEHVEVFREAVRTGERRRYTKRFLSTQDGD |
| Ga0070666_110862511 | 3300005335 | Switchgrass Rhizosphere | MTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDTRDGDFG |
| Ga0070666_113311211 | 3300005335 | Switchgrass Rhizosphere | MTPQQIEQVFGRGRLKMATGEHVAVFREAMMPGERRRYTKRFLKT |
| Ga0070668_1000492001 | 3300005347 | Switchgrass Rhizosphere | MTPEQIDHVFGRGRLKMVTGQHVEVFREAMAPGERRRYTKRFLATSDGD |
| Ga0070671_1011456971 | 3300005355 | Switchgrass Rhizosphere | MTPEQIEQVFGRGRLKMATGEHVEVFREAMMPGERRRYTKRFL |
| Ga0070674_1000382905 | 3300005356 | Miscanthus Rhizosphere | MTPEQIDHVFGRGRLKMDTGAHVEVFREAAPPGESRRYTKRFLTTADG |
| Ga0070659_1003251943 | 3300005366 | Corn Rhizosphere | MTPADLDRVFGRGRLRMVTGEHVEVFREAALPGERRRYTKRFL |
| Ga0070714_1002831473 | 3300005435 | Agricultural Soil | MTPEQIERVFGRGRLKMATGAHVEVFREAVPPGERRRYTKR |
| Ga0070701_101491583 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPEQIERVFGHGRLKMVTGEHVEVFREAVVPGERRRYTKRFLNSTDGDFA |
| Ga0070700_1009793631 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAELERVFGRGRQKMATGDHVEVFREAAAPGERGRYTKRFLATG |
| Ga0066681_100340683 | 3300005451 | Soil | MTPENIERVFGRSRLKMVTGEHVEVFREAVAPGERRRYTKRFLNTREGDF |
| Ga0070681_116119591 | 3300005458 | Corn Rhizosphere | MSPAEIERVFGRGRVRMTTGEHVEVFREEAREGEERRYTKRFLETA |
| Ga0068867_1003559431 | 3300005459 | Miscanthus Rhizosphere | MTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFL |
| Ga0070685_102253111 | 3300005466 | Switchgrass Rhizosphere | MMTPDQIEQVFGRGRLKMATGQHVEVFREAMASGERRRYTKRFLATIDGDFGP |
| Ga0070697_1020924392 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFLNTPEGDF |
| Ga0068853_1003118313 | 3300005539 | Corn Rhizosphere | MTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFLAT |
| Ga0068853_1012843001 | 3300005539 | Corn Rhizosphere | MTRDQIDRVFGRDRLKMVTGDHVEVFREAASAGSRRRYTK |
| Ga0070672_1004530072 | 3300005543 | Miscanthus Rhizosphere | MTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAGD |
| Ga0070665_1003142831 | 3300005548 | Switchgrass Rhizosphere | MTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDTRD |
| Ga0066692_108502602 | 3300005555 | Soil | MTPEQIDRVFGRGRLKMATGEHVEVFREAVISGERRRYTKRFLDTT |
| Ga0066707_104996101 | 3300005556 | Soil | MTPEQIDRVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFL |
| Ga0070664_1001651931 | 3300005564 | Corn Rhizosphere | MTRDQIDRVFGRDRLKMVTGDHVEVFREAATDGSRRRYTKRFLDTRDGDF |
| Ga0066705_100328054 | 3300005569 | Soil | MTPEQIDHVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKR |
| Ga0070702_1016556691 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPADIDRVFGRGRLRMVTGDHVEVFREHAAPGERRRYTKRFLATAAGDFS |
| Ga0068852_1002320251 | 3300005616 | Corn Rhizosphere | MTRDQIDRVFGRDRLKMVTGDHVEVFREAASAGSRRRYTKRFLDT |
| Ga0068866_103333272 | 3300005718 | Miscanthus Rhizosphere | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFLNTPEG |
| Ga0068861_1011475932 | 3300005719 | Switchgrass Rhizosphere | MTPEQIDHVFGRGRLKMVTGQHVEVFREAMAPGERRRYTKR |
| Ga0068861_1011531162 | 3300005719 | Switchgrass Rhizosphere | MTLDQIDRVFGRGRLKMVTGDHVEVFREAASDGNRRRYTKRFLDTRE |
| Ga0066903_1066631981 | 3300005764 | Tropical Forest Soil | VKAETIERVFGRERIKMATGDHVEVFRESVAPGERGRYTKRFLETGDA |
| Ga0068870_101413071 | 3300005840 | Miscanthus Rhizosphere | MTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDTRDGDF |
| Ga0068858_1011520711 | 3300005842 | Switchgrass Rhizosphere | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPTERRRYTKRFL |
| Ga0068860_1002118283 | 3300005843 | Switchgrass Rhizosphere | MTPEQIDRVFGRGRLKMVTGDHVEVFREAAMAGDRRRYTKRFLNT |
| Ga0068860_1027148372 | 3300005843 | Switchgrass Rhizosphere | MTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFLNTTDG |
| Ga0066652_1011506161 | 3300006046 | Soil | MTPEQIDHVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFL |
| Ga0075370_100410644 | 3300006353 | Populus Endosphere | MTPGDIDRVFGRSRLRMVTGDHVEVFREETSPGERRRYTKRFLATTAGD |
| Ga0075021_105876502 | 3300006354 | Watersheds | MTPEQIERVFGCSRLKMATGEHVEVFREAVRAGERRRYTKR |
| Ga0068871_1013554461 | 3300006358 | Miscanthus Rhizosphere | MTPEQIEQVFGRGRLKMATGEHVEVFREAMMPGERRRYTKRFLTTSAGD |
| Ga0075425_1020561302 | 3300006854 | Populus Rhizosphere | MTPTQIDRVFGRGRLKMVTGEHVEVFREAVGPGERR |
| Ga0075434_1019489161 | 3300006871 | Populus Rhizosphere | MTPEQIERVFGCSRLKMATGEHVEVFREAVRPGERRRYTKRFLN |
| Ga0068865_1000862711 | 3300006881 | Miscanthus Rhizosphere | MSPADLDRVFGRARLRMVTGEHVEVFREASLPGERRRYTKRFLATA |
| Ga0068865_1018526402 | 3300006881 | Miscanthus Rhizosphere | MTPAAIERVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFL |
| Ga0075419_115067222 | 3300006969 | Populus Rhizosphere | MTPEQIERVFGCSRLKMATGEHVEVFREAVRPGERRRYTKRFLETG |
| Ga0115027_108085142 | 3300009131 | Wetland | MTPEQIDQVFGRGRLKMATGEHVEVFREAIAPGERRRYTKRFLATSD |
| Ga0111538_139359871 | 3300009156 | Populus Rhizosphere | MTPELIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYNKRFVNTT |
| Ga0105242_105786631 | 3300009176 | Miscanthus Rhizosphere | MTAEHIERVFGRGRLKMTTGEHVEVFREAVAPGDRRRYTKR |
| Ga0105238_129231911 | 3300009551 | Corn Rhizosphere | MTPAQIDRVFGRERLKMVTGEHVEVYREAVAPGEPR |
| Ga0126373_123578581 | 3300010048 | Tropical Forest Soil | MTPEQIDRVFGRERLKMATGEHVEVFREAAAWGERRRYTKRFLSTEEGDYG |
| Ga0126306_111282281 | 3300010166 | Serpentine Soil | MTPAAMDRVFGRGRLRMVTGDHVEVYREEALPGERRRYTKRFL |
| Ga0134111_105669791 | 3300010329 | Grasslands Soil | MTPEQIDRVFGRGRLKMVTGDHVEVFREAAAAGER |
| Ga0126370_116092431 | 3300010358 | Tropical Forest Soil | MTPEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRYTKRFLN |
| Ga0134128_127728012 | 3300010373 | Terrestrial Soil | MTPDQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFL |
| Ga0134128_129201731 | 3300010373 | Terrestrial Soil | MTPADIDRVFGRGRVRMVTGEHVEVFRGASLPGERRRHTKRLLATAAGD |
| Ga0126383_104946503 | 3300010398 | Tropical Forest Soil | MTPEQINLVFGRSRLRMRTGEHVEVFREGVGPGERRRYTKRFLDSG |
| Ga0134127_118078721 | 3300010399 | Terrestrial Soil | MTAEHIERVFGRGRLKMTTGEHVEVFREAVAPGGRRRYTKRFLATDEAD |
| Ga0134122_103230263 | 3300010400 | Terrestrial Soil | MSPEQIDRVFGRGRLKMVTGEHVEVYREAVAKGERRRYTKRFLNTTDG |
| Ga0134122_109117382 | 3300010400 | Terrestrial Soil | MTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYT |
| Ga0134121_122389442 | 3300010401 | Terrestrial Soil | MKPADIERVFGRGRLKMMTGEHVEVFREEAAPGERRRYTKRF |
| Ga0134121_124132512 | 3300010401 | Terrestrial Soil | MTPQQIEQVFGGERLKIATGDHVEVYREALAPGQR |
| Ga0134123_134827302 | 3300010403 | Terrestrial Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREQSLPGERRRYTKRFLATAAG |
| Ga0137389_102216551 | 3300012096 | Vadose Zone Soil | MTPAQIERVFGLGRLKMATGEHVEVFREAVAPGER |
| Ga0136619_102110632 | 3300012185 | Polar Desert Sand | MASEPIDRVFGSGRLQMVTGAHVEVFREAAAPGESRRYTKRFLTTA |
| Ga0136618_104789921 | 3300012188 | Polar Desert Sand | MTPASIDRVFGHGRLQMVTGDHVEVFREEAPAGARRRYTKRFLAT |
| Ga0137364_107669501 | 3300012198 | Vadose Zone Soil | MTPEQIERVFGLGRLKMATGEHVEVFREAVAPGERRRYTKRFLATSDADF |
| Ga0137384_103882652 | 3300012357 | Vadose Zone Soil | MTPAQIERVFGLGRLKMATGEHVEVFREAVAPGERRRYTKRFLATSDADF |
| Ga0157327_10887251 | 3300012512 | Arabidopsis Rhizosphere | MKPVDIDRVFGRGRLKMVTGAHVEVFREASLPGERRRYTKRFL |
| Ga0157354_10229902 | 3300012517 | Unplanted Soil | MTPAEIDRVFGRGRLRMTTGEHVEVFREEARDGEERRYSK |
| Ga0157352_10454743 | 3300012519 | Unplanted Soil | MSPADLDRVFGRARLRMVTGEHVEVFREASLPGERR |
| Ga0136614_110349521 | 3300012684 | Polar Desert Sand | MASEPIDRVFGSGRLQMVTGAHVEVFREAAAPGESRRY |
| Ga0157296_100226393 | 3300012905 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRFLA |
| Ga0157283_103305972 | 3300012907 | Soil | MSPPAIDRVFGRGRLRMVTGDHVEVFREESQPGER |
| Ga0157298_102215301 | 3300012913 | Soil | MTPAAIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKR |
| Ga0126369_129695281 | 3300012971 | Tropical Forest Soil | MTPEQIDRVFGRARLKMVTGEHVEVFREAAATGERRRYTKRFLNTA |
| Ga0157374_107475732 | 3300013296 | Miscanthus Rhizosphere | MMTPDQIEQVFGRGRLKMATGQHVEVFREAMASGERRRYTKRFLA |
| Ga0163162_130365831 | 3300013306 | Switchgrass Rhizosphere | MTPQQIEQVFGRGRLKIATGEHVAVFREAMMPGERRRYTKRFL |
| Ga0157375_100458145 | 3300013308 | Miscanthus Rhizosphere | MTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFLATAAG |
| Ga0157375_104250651 | 3300013308 | Miscanthus Rhizosphere | MTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRF |
| Ga0157375_108969532 | 3300013308 | Miscanthus Rhizosphere | MTPAEIDRVFGRARVRMMTGEHVEVFREEARDGEERRYSK |
| Ga0134079_106182712 | 3300014166 | Grasslands Soil | MTPEQIDRVFGRGRLKMVTGDHVEVFREAAAAGERRR |
| Ga0157380_102427982 | 3300014326 | Switchgrass Rhizosphere | MTPADVDRVFGRGLVKMVTGEHVEVYREAALPGERRR* |
| Ga0157380_116397061 | 3300014326 | Switchgrass Rhizosphere | MNPEQIDRVFGRGRLKMVTGEHVEVFREAVIPGERRRYTKRF |
| Ga0157379_108906481 | 3300014968 | Switchgrass Rhizosphere | MTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLATAAGDFRM |
| Ga0167661_10694323 | 3300015167 | Glacier Forefield Soil | MTPDQIDRVFGRGRLRMVTGDHVEVFREAVQPGERRRY |
| Ga0173478_101390071 | 3300015201 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATAA |
| Ga0132256_1011549792 | 3300015372 | Arabidopsis Rhizosphere | MTPEQVDRVFGRGRLKMATGDHVEVFREAAPPGERRRYTKRFLSTQEGD |
| Ga0132255_1059394901 | 3300015374 | Arabidopsis Rhizosphere | MNPLDPDRVFGRSRLRMVTGAHVEVYREAAAPGERRRYTKRFLATEAG |
| Ga0182038_108652661 | 3300016445 | Soil | MNAEQIERVFGRGRLKMVTGEHVEVFREGVARGERRRYTKRFLNTRE |
| Ga0183260_100263821 | 3300017787 | Polar Desert Sand | VTPMTSEPIDRVFGRGRLQMVTGAHVEVFREAAAPGE |
| Ga0183260_103836782 | 3300017787 | Polar Desert Sand | MTPAAIERVFGHGRVRMVTGDHVEVFREEAAPGERRRYTKRFLATDAGDFR |
| Ga0136617_107133673 | 3300017789 | Polar Desert Sand | MKPAALERVFGRSRLKMVTGQYVEVYREATAPGERRRYTKRF |
| Ga0163161_113968752 | 3300017792 | Switchgrass Rhizosphere | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRFLATAAG |
| Ga0163161_120848472 | 3300017792 | Switchgrass Rhizosphere | MTSDQLERVFGRTRLKMATGEHVEVHREAASPGERRRYTKRFLSTDEADFREW |
| Ga0184620_100567952 | 3300018051 | Groundwater Sediment | MTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFLNTTD |
| Ga0184632_102978002 | 3300018075 | Groundwater Sediment | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFLN |
| Ga0184612_105636811 | 3300018078 | Groundwater Sediment | MTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRR |
| Ga0190268_115723832 | 3300018466 | Soil | MTIADIDRVFGRCRLRMVTGDHVEVFREASQPGERRRYTKRFLA |
| Ga0190270_121838572 | 3300018469 | Soil | MSPPAIDRVFGRGRLRMVTGDHVEVFREESQPGERRR |
| Ga0190271_127339652 | 3300018481 | Soil | MSPAEIDRVFGRGRLRMVTGDHVEVFREPALPGERRRYTKRFLA |
| Ga0190271_136056491 | 3300018481 | Soil | MDPIDRVFGRDRLQMVTGAHVEVFREAAARGESRRYTKRFL |
| Ga0193713_11338621 | 3300019882 | Soil | MTPEQIDRVFGRGRLKMATGDHVEVFREAVVSGGRRRYTKRFLD |
| Ga0193730_10886201 | 3300020002 | Soil | MTPEQIDRVFGRGRLKMATGDHVEVFREAVVSGGRRRYTKRFPDTS |
| Ga0163153_102214012 | 3300020186 | Freshwater Microbial Mat | MTPAANDRVFGRGRLRMVTGDHVEVFREESQPGERRRYT |
| Ga0210378_103301251 | 3300021073 | Groundwater Sediment | MTPEQIDRVFGPGRLKMVTGEHVEVFREAVVPGQRRRYT |
| Ga0210380_101500581 | 3300021082 | Groundwater Sediment | MKHADIDRVFGRGRLRMVTGDHVEVFREHAAPGERRRYTKRFLATPAG |
| Ga0213876_102782011 | 3300021384 | Plant Roots | MTPADIDRVFGRGRLRMVTGEHVEVFREASPPGERRRYTKRFLAT |
| Ga0182009_101595923 | 3300021445 | Soil | MNTPAREVVFGRSRLAMSTRKHVEVFREAAAADERRRYTKRFLATA |
| Ga0182009_103569461 | 3300021445 | Soil | MTPAAIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPA |
| Ga0233357_10129721 | 3300023056 | Soil | MTPEQIERVFGLGRLKMATGEHVEVFREAVAPGERRRYTKRFLATS |
| Ga0207656_101520911 | 3300025321 | Corn Rhizosphere | MTPADIDRVFGRGRLRMVTGDHVEVFREASLPGQR |
| Ga0207682_101916922 | 3300025893 | Miscanthus Rhizosphere | MTPEQIDRVFGRGRLKMVTGEHVEVFREAVVSGER |
| Ga0207682_106374601 | 3300025893 | Miscanthus Rhizosphere | MTPTDIDRVFGRGRLRMVTGDHVEVFREHSLPGER |
| Ga0207682_106393032 | 3300025893 | Miscanthus Rhizosphere | MTPDQIEQVFGRGRLKMATGQHVEVFREAMASGERRRY |
| Ga0207680_105901022 | 3300025903 | Switchgrass Rhizosphere | MTPEQIERVFGHGRLKMVTGEHVEVFREAVVPGERRRYTKRFLNSTDGD |
| Ga0207680_110377121 | 3300025903 | Switchgrass Rhizosphere | MTPQQIEQVFGRGRLKMATGEHVAVFREAMMPGERRRYTKRFLKTS |
| Ga0207685_108711841 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTK |
| Ga0207643_104974991 | 3300025908 | Miscanthus Rhizosphere | MTPEQIERVFGHGRLKMVTGEHVEVFREAVVPGERRR |
| Ga0207650_100452915 | 3300025925 | Switchgrass Rhizosphere | MTPADIDRVFGRGRLRMVTGDHVEVFREQSLPGERRRYTKRFLA |
| Ga0207650_107214342 | 3300025925 | Switchgrass Rhizosphere | MTPAAIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRF |
| Ga0207659_111780953 | 3300025926 | Miscanthus Rhizosphere | MTPEQIDRVFGRGRLRMVTGEHVEVFREAVAPGERRRYTKRFLNSTD |
| Ga0207644_102693051 | 3300025931 | Switchgrass Rhizosphere | VFGAGRLQMATGAHVEVFREAVEHGVERRYTKRFLAGP |
| Ga0207690_111256271 | 3300025932 | Corn Rhizosphere | MTSDQLERVFGRTRLKMATGEHVEVHREAAAPGERRRYTKRFLSTD |
| Ga0207686_115109891 | 3300025934 | Miscanthus Rhizosphere | MKHADIDRVFGRGRLRMVTGDHVEVFREHAAPGERRRYTKRFLA |
| Ga0207709_103018763 | 3300025935 | Miscanthus Rhizosphere | MTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATP |
| Ga0207704_100937763 | 3300025938 | Miscanthus Rhizosphere | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRR |
| Ga0207704_102798371 | 3300025938 | Miscanthus Rhizosphere | MTPQQIDRVFGRERLKMVTGEHVEVYREAVAPGEPRRYTKRFLA |
| Ga0207711_102385531 | 3300025941 | Switchgrass Rhizosphere | MKHADIDRVFGRGRLRMVTGDHVEVFREHAAPGERR |
| Ga0207661_106520962 | 3300025944 | Corn Rhizosphere | MTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRR |
| Ga0207679_100673241 | 3300025945 | Corn Rhizosphere | MTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLATAAGDF |
| Ga0207679_108512842 | 3300025945 | Corn Rhizosphere | MMPADIDRVFGRGRLRMVTGDHVEVFRERSLPGERRRYTKRFLATAAG |
| Ga0207668_100213501 | 3300025972 | Switchgrass Rhizosphere | MTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERR |
| Ga0207668_120281561 | 3300025972 | Switchgrass Rhizosphere | MTPDQIDRVFGCGRLKMVTGEHVEVFREAACAGERRRYTKRFLN |
| Ga0207658_114737831 | 3300025986 | Switchgrass Rhizosphere | MTPQQIDRVFGRERLKMVTGEHVEVYREAVAPGEPRRYTKR |
| Ga0207658_119409381 | 3300025986 | Switchgrass Rhizosphere | MTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAG |
| Ga0207639_101859421 | 3300026041 | Corn Rhizosphere | MTPAEIDRVFGRGRLRMTTGEHVEVFREEARDGEERRYSKRFLDTA |
| Ga0207639_111984612 | 3300026041 | Corn Rhizosphere | MTPDQIDHVFGRGRLKMDTGAHVEVFREAAPPGESR |
| Ga0207639_113814651 | 3300026041 | Corn Rhizosphere | MTPAQIDRVFGRERLKMVTGEHVEVYREAVAPGEPRRYTKRFLATPNG |
| Ga0207678_108870833 | 3300026067 | Corn Rhizosphere | MTPQQIEQVFGRGRLKMATGDHVEVFREAIAPGERRRYTKRFLTT |
| Ga0207708_100924373 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPEQIERVFGHGRLKMVTGEHVEVFREAVVSGERRRYTKRFLNSTDGD |
| Ga0207641_108941112 | 3300026088 | Switchgrass Rhizosphere | MTPEQIDRVFGRGRLKMVTGDHVEVFREAATAGDR |
| Ga0207648_108916052 | 3300026089 | Miscanthus Rhizosphere | MTPQQIEQVFGGERLKIATGDHVEVYREALAAGQRRRYTKRFLATAAGD |
| Ga0207676_102348183 | 3300026095 | Switchgrass Rhizosphere | MTPADIDRVFGRARLRMVTGDHVEVFREASLPGERRRY |
| Ga0207676_118288352 | 3300026095 | Switchgrass Rhizosphere | MTPEQIDHVFGRGRLKMDTGAHVEVFREAAPPGESR |
| Ga0207676_121323541 | 3300026095 | Switchgrass Rhizosphere | MTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDT |
| Ga0207676_121346632 | 3300026095 | Switchgrass Rhizosphere | MTPEQIDHVFGRGRLKMVTGQHVEVFREAMAPGERRRYT |
| Ga0207675_1010978321 | 3300026118 | Switchgrass Rhizosphere | MTPDQIEQVFGRGRLKMATGEHVEVFREAIAPGERR |
| Ga0207428_103359331 | 3300027907 | Populus Rhizosphere | MTLDQIDRVFGRGRLKMVTGDHVEVFREAASDGNRRRYTKRFLDT |
| Ga0209382_111245252 | 3300027909 | Populus Rhizosphere | MTPDQIEQVFGRGRLKMATGEHVEVFREAMATGERR |
| Ga0268265_100282505 | 3300028380 | Switchgrass Rhizosphere | MHEDLEHVFGRGRRKMATGDHVEVFREAAAPGERRRYTKR |
| Ga0268265_123490132 | 3300028380 | Switchgrass Rhizosphere | MTPEQIDRVFGRGRLKMATGEHVEVFREAIRTGERRRYTK |
| Ga0268264_110132881 | 3300028381 | Switchgrass Rhizosphere | MTPEQIDRVFGRGRLKMVTGDHVEVFREAAMAGDRRRYTKRF |
| Ga0247828_106802022 | 3300028587 | Soil | MTPEQIDRVFGRGRLQMVTGAHVEVFREAAAPGESRRYTKRFLK |
| Ga0247828_107347992 | 3300028587 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRGRSGRRR |
| Ga0247828_109109952 | 3300028587 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREQSLPGERRRYTKRFLATA |
| Ga0247818_101955823 | 3300028589 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRFLATA |
| Ga0247818_104801521 | 3300028589 | Soil | MTHADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLA |
| Ga0247823_114842751 | 3300028590 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRY |
| Ga0247822_108865562 | 3300028592 | Soil | MTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAGDFRQW |
| Ga0247822_115335562 | 3300028592 | Soil | MTPSDIDRVFGRGRLRMVTGEHVEVYREASLPGER |
| Ga0247821_112103572 | 3300028596 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRF |
| Ga0247819_104875342 | 3300028608 | Soil | MTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAGDFR |
| Ga0247824_102841542 | 3300028809 | Soil | MSAMSNGEIERVFGRGRLKMATGDHVEVFREAVAAGER |
| Ga0247824_106636372 | 3300028809 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHALPGERRRY |
| Ga0307314_102767102 | 3300028872 | Soil | MTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLATAAGDFR |
| Ga0247827_104211941 | 3300028889 | Soil | MTPADIDRVFGRTRLRMVTGDHVEVFREASLPGERRRYTK |
| Ga0302273_11123782 | 3300030048 | Bog | MTPAHIDRVFGRGRLRMVTGDHVEVFREEAMPGERR |
| Ga0247826_107864622 | 3300030336 | Soil | MTPADIDRVFGRGRLRMVTGEHVEVFREASLPGERRRYTKRFL |
| Ga0247826_116731011 | 3300030336 | Soil | MTPADIDRVFGRGRLRMVTGEHVEVFREASLPGERRRYTKRFLAT |
| Ga0318516_106443182 | 3300031543 | Soil | MTPDQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRY |
| Ga0318538_104331872 | 3300031546 | Soil | MTPGQIDRVFGRERLKMATGEHVEVFREAAAPGERRRYTKRFLNTI |
| Ga0318555_102564691 | 3300031640 | Soil | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGER |
| Ga0318555_106084191 | 3300031640 | Soil | MTPEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRYTKRFLNT |
| Ga0318542_105830021 | 3300031668 | Soil | MNAEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRY |
| Ga0307469_114099691 | 3300031720 | Hardwood Forest Soil | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFL |
| Ga0318494_108175142 | 3300031751 | Soil | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTKRFLNTPD |
| Ga0318554_108423662 | 3300031765 | Soil | MNAEQIERVFGRGRLKMVTGEHVEVFREEALPGERRRYTKRFLCTSE |
| Ga0318546_107386772 | 3300031771 | Soil | MTPAEIDRVFGRARMRMVTGEHVEVFREEAREGEERLY |
| Ga0307473_102902291 | 3300031820 | Hardwood Forest Soil | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTK |
| Ga0318527_101455191 | 3300031859 | Soil | MNAEQIERVFGRGRLKMVTGEHVEVFREGVARGERRRYTKRFLNTQ |
| Ga0318551_106646222 | 3300031896 | Soil | MTPAEIDRVFGRARMRMVTGEHVEVFREEALEGEER |
| Ga0307406_121130441 | 3300031901 | Rhizosphere | MTADDIDRVFGRTRLRMVTGAHVEVFREASLPGERRRYTKRFLA |
| Ga0306923_119309121 | 3300031910 | Soil | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTKR |
| Ga0308175_1027183501 | 3300031938 | Soil | MRPADIDRVFGRSRLRMVTGDHVEVFREAARPGERRRYTKRFLATAAGD |
| Ga0308175_1028230042 | 3300031938 | Soil | MTPEQIERVFGRGRLQMVTGKHVEVFREAAGDGRRRKYTKRF |
| Ga0308174_101455161 | 3300031939 | Soil | MKSDQIERVFGRGRLKMATGEHVEVFREAVGPGQRRRYTKRFLDSG |
| Ga0308176_109868072 | 3300031996 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREESLPGERRRYTKRFLA |
| Ga0306922_109740581 | 3300032001 | Soil | MTPAEIDRVFGRARMRMVTGEHVEVFREEAREGEE |
| Ga0306922_115714102 | 3300032001 | Soil | MTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTKRF |
| Ga0307411_102775833 | 3300032005 | Rhizosphere | MDSIDRVFGRNRLQMVTGAHVEVFREAAARGESRRYTKRFLTTADGD |
| Ga0307411_120001982 | 3300032005 | Rhizosphere | MTPADIDRVFGRSRLRMVTGAHVEVFREASLAGERRRYTKRF |
| Ga0318563_107577981 | 3300032009 | Soil | MTPEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRYTKRFLNTREGDFG |
| Ga0310902_105615431 | 3300032012 | Soil | MTPADIDRVFGRSRLRMVTGEHVEVFREASLPGERRRYTKRFLAT |
| Ga0310906_102805282 | 3300032013 | Soil | MTAEHIERVFGRGRLKMTTGEHVEVFREAVAPGDRRRYTKRFLATDE |
| Ga0318513_104203011 | 3300032065 | Soil | MTPAEIDRVFGRARTRMMTGEHVEVFREEAREGEERRY |
| Ga0308173_107048422 | 3300032074 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGER |
| Ga0308173_108461261 | 3300032074 | Soil | MTSDQLERVFGRARLKMATGEHVEVHREAASPGERRRYTKRFLSTDDAD |
| Ga0308173_109392112 | 3300032074 | Soil | MTPEQIDRVFGRGRLKMVTGDHVEVFREAAAAGDRRRYTKR |
| Ga0318518_101777572 | 3300032090 | Soil | MNAEQIERVFGRGRLKMVTGEHVEVFREGVARGERRRYTKRFLN |
| Ga0307470_110899352 | 3300032174 | Hardwood Forest Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREAALPGQRRCYT |
| Ga0307471_1002375291 | 3300032180 | Hardwood Forest Soil | MTPEQIERVFGRGRLKMTTGEHVEVFREAVASGERRRYTKR |
| Ga0307471_1003562941 | 3300032180 | Hardwood Forest Soil | MTPDQIEQVFGRGRLKMATGEHVEVFREAMAPGERRR |
| Ga0306920_1028768432 | 3300032261 | Soil | MTPAEIDRVFGRARMRMVTGEHVEVFREEAREGEERPYTKRFL |
| Ga0335082_116306961 | 3300032782 | Soil | MNPMDLDRVFGRSRLRMVTGAHVEVFREESAPGERRRYTKRFLATPD |
| Ga0335080_116324231 | 3300032828 | Soil | MNASDLDRVFGRGRLRMVTGDHVEVFREEALPGERRRYTKRFLAT |
| Ga0335069_100338481 | 3300032893 | Soil | MSTADLDRVFGRSRLRMVTGAHVEVFREEAVAGERRRYTKRFL |
| Ga0318519_110549361 | 3300033290 | Soil | MTPEQIEQVFGRGRLKMATGDHVEVFREAMVAGERRRYTKRFLATRD |
| Ga0247829_110766562 | 3300033550 | Soil | MTAMSTGEIERVFGRGRLKMATGDHVEVFREAVAAGERR |
| Ga0247830_100514771 | 3300033551 | Soil | MTPADIDRVFGRGRLRMVTGDHVEVFREHALPGERRRYTKRFLAT |
| Ga0247830_113968952 | 3300033551 | Soil | MTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRF |
| Ga0370484_0021844_2_124 | 3300034125 | Untreated Peat Soil | MTPADIDRVFGRRRLRMVTGDHVEVFREESLPGERRRYTKR |
| Ga0364925_0360690_1_150 | 3300034147 | Sediment | MNADPIDRVFGRGRLRMVTGAQVEVFREAAAPGEARRYTKRFLATAEGDY |
| Ga0372943_0388313_768_899 | 3300034268 | Soil | MTPADLDRVFGRSRLRMATGAHVEVYRDETPPGQARRFSKRFLE |
| ⦗Top⦘ |