Metagenome Family F020808

Overview

Basic Information

• Family ID: F020808
• Family Type: Metagenome
• Number of Sequences: 222
• Average Sequence Length: 47 residues
• Representative Sequence: LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
• Number of Associated Samples: 22
• Number of Associated Scaffolds: 222

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 47.55 %
• % of genes near scaffold ends (potentially truncated): 46.40 %
• % of genes from short scaffolds (< 2000 bps): 76.58 %
• Associated GOLD sequencing projects: 12
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (52.252 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (64.414 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 32.88%
  β-sheet: 0.00%
  Coil/Unstructured: 67.12%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 222 Family Scaffolds
PF00078	RVT_1	1.80
PF02995	DUF229	0.45
PF16529	Ge1_WD40	0.45
PF01591	6PF2K	0.45
PF16521	Myosin-VI_CBD	0.45
PF06424	PRP1_N	0.45
PF14529	Exo_endo_phos_2	0.45
PF16347	DUF4976	0.45

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.76 %
Unclassified	root	N/A	43.24 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.41 %
Unclassified	root	N/A	43.24 %
Viruses	superkingdom	All Organisms → Viruses	1.35 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	52.25 %
Unclassified	root	N/A	43.24 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %

Level 4

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	52.25 %
Unclassified	root	N/A	43.24 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %

Level 5

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.90 %

Level 6

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.90 %

Level 7

Name	Rank	Taxonomy	Distribution
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.90 %

Level 8

Name	Rank	Taxonomy	Distribution
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.45 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.45 %

Level 9

Name	Rank	Taxonomy	Distribution
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.45 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.45 %

Level 10

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.45 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.45 %

Level 11

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.45 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.45 %

Level 12

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 13

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 14

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 15

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 16

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 17

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 18

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Teleostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 19

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Osteoglossocephalai	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 20

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Clupeocephala	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 21

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Otomorpha	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 22

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Ostariophysi	subcohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 23

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Otophysi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 24

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cypriniphysae	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 25

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cypriniformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 26

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cyprinoidei	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 27

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cyprinidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 28

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Acrossocheilinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 29

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Onychostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae → Onychostoma	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Level 30

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Onychostoma macrolepis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae → Onychostoma → Onychostoma macrolepis	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001734|JGI24668J20090_10010110	Not Available	1853
3300001734|JGI24668J20090_10053176	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	981
3300001734|JGI24668J20090_10070733	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	879
3300001734|JGI24668J20090_10097806	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	772
3300001734|JGI24668J20090_10129507	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	688
3300001734|JGI24668J20090_10147195	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	651
3300001734|JGI24668J20090_10151488	Not Available	643
3300001734|JGI24668J20090_10164149	Not Available	621
3300001734|JGI24668J20090_10178620	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	598
3300001734|JGI24668J20090_10201061	Not Available	567
3300001734|JGI24668J20090_10205122	Not Available	562
3300001734|JGI24668J20090_10224609	Not Available	539
3300001734|JGI24668J20090_10258539	Not Available	504
3300001741|JGI24671J20093_10055858	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	853
3300001741|JGI24671J20093_10125913	Not Available	634
3300001741|JGI24671J20093_10224634	Not Available	501
3300001742|JGI24673J20094_10035715	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1125
3300001742|JGI24673J20094_10153300	Not Available	645
3300001742|JGI24673J20094_10166686	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	622
3300001742|JGI24673J20094_10188793	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	589
3300001742|JGI24673J20094_10199635	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	575
3300001742|JGI24673J20094_10210067	Not Available	562
3300001742|JGI24673J20094_10227037	Not Available	542
3300001744|JGI24669J20092_10022143	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1073
3300001744|JGI24669J20092_10049413	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	804
3300001744|JGI24669J20092_10060179	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	750
3300001744|JGI24669J20092_10072660	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	701
3300001744|JGI24669J20092_10143895	Not Available	546
3300001744|JGI24669J20092_10147994	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	540
3300001746|JGI24672J20091_10022120	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1059
3300001746|JGI24672J20091_10026262	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	996
3300001746|JGI24672J20091_10029018	Not Available	960
3300001746|JGI24672J20091_10041737	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	844
3300001746|JGI24672J20091_10071806	Not Available	699
3300002181|JGI24670J26820_11244058	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	546
3300002181|JGI24670J26820_11252992	Not Available	552
3300002181|JGI24670J26820_11282870	Not Available	575
3300002181|JGI24670J26820_11304063	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593
3300002181|JGI24670J26820_11372965	Not Available	661
3300002181|JGI24670J26820_11467166	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	798
3300002181|JGI24670J26820_11473909	Not Available	811
3300002181|JGI24670J26820_11487698	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	840
3300002181|JGI24670J26820_11492642	Not Available	851
3300002181|JGI24670J26820_11509133	Not Available	891
3300002181|JGI24670J26820_11540760	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	987
3300002181|JGI24670J26820_11609867	Not Available	1473
3300002181|JGI24670J26820_11617775	Not Available	1620
3300003801|Ga0056138_1007036	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1488
3300003801|Ga0056138_1014474	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	942
3300003801|Ga0056138_1068861	Not Available	516
3300003829|Ga0056137_1019021	Not Available	689
3300004098|Ga0065184_10048732	All Organisms → cellular organisms → Eukaryota	1523
3300004098|Ga0065184_10055466	Not Available	1441
3300004098|Ga0065184_10084975	Not Available	1184
3300004098|Ga0065184_10092710	Not Available	1135
3300004098|Ga0065184_10230784	Not Available	678
3300004098|Ga0065184_10243648	Not Available	655
3300004122|Ga0065185_10187797	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	765
3300004122|Ga0065185_10339665	Not Available	530
3300027500|Ga0209145_1253776	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	544
3300027540|Ga0209791_1002643	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4496
3300027540|Ga0209791_1012026	Not Available	2566
3300027540|Ga0209791_1026123	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2000
3300027540|Ga0209791_1031407	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1882
3300027540|Ga0209791_1078594	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1330
3300027540|Ga0209791_1088298	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1266
3300027540|Ga0209791_1156342	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	963
3300027540|Ga0209791_1210852	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	810
3300027540|Ga0209791_1263482	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	695
3300027540|Ga0209791_1292872	Not Available	644
3300027540|Ga0209791_1309925	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	616
3300027540|Ga0209791_1349506	Not Available	557
3300027540|Ga0209791_1392853	Not Available	501
3300027551|Ga0209338_1000990	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	9065
3300027551|Ga0209338_1010887	Not Available	4182
3300027551|Ga0209338_1030311	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2906
3300027551|Ga0209338_1040948	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2575
3300027551|Ga0209338_1043559	Not Available	2512
3300027551|Ga0209338_1047415	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2425
3300027551|Ga0209338_1088973	All Organisms → Viruses → Predicted Viral	1790
3300027551|Ga0209338_1143438	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1344
3300027551|Ga0209338_1159098	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1252
3300027551|Ga0209338_1165214	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1219
3300027551|Ga0209338_1166357	Not Available	1213
3300027551|Ga0209338_1217678	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	990
3300027551|Ga0209338_1279153	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	793
3300027551|Ga0209338_1302218	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	729
3300027551|Ga0209338_1302369	Not Available	729
3300027551|Ga0209338_1303188	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	727
3300027551|Ga0209338_1304813	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	722
3300027551|Ga0209338_1333856	Not Available	653
3300027551|Ga0209338_1397602	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	520
3300027556|Ga0209743_1012853	Not Available	2949
3300027556|Ga0209743_1015217	Not Available	2796
3300027556|Ga0209743_1021090	Not Available	2514
3300027556|Ga0209743_1065416	Not Available	1660
3300027556|Ga0209743_1102447	Not Available	1350
3300027556|Ga0209743_1136374	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1167
3300027556|Ga0209743_1141450	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1144
3300027556|Ga0209743_1196970	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae → Onychostoma → Onychostoma macrolepis	945
3300027556|Ga0209743_1308873	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	680
3300027556|Ga0209743_1314480	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	670
3300027564|Ga0209428_1039246	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2297
3300027564|Ga0209428_1098282	Not Available	1533
3300027564|Ga0209428_1127469	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1330
3300027564|Ga0209428_1164672	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1142
3300027564|Ga0209428_1206714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	983
3300027564|Ga0209428_1211854	Not Available	967
3300027564|Ga0209428_1270484	Not Available	800
3300027564|Ga0209428_1283122	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	769
3300027564|Ga0209428_1364321	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	605
3300027564|Ga0209428_1397218	Not Available	549
3300027584|Ga0209637_1027570	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2763
3300027584|Ga0209637_1078224	Not Available	1791
3300027584|Ga0209637_1091371	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1661
3300027584|Ga0209637_1105303	All Organisms → cellular organisms → Eukaryota	1542
3300027584|Ga0209637_1108496	All Organisms → Viruses → Predicted Viral	1517
3300027584|Ga0209637_1110759	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1500
3300027584|Ga0209637_1138131	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1320
3300027584|Ga0209637_1142947	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1292
3300027584|Ga0209637_1188880	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1080
3300027584|Ga0209637_1193299	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1063
3300027584|Ga0209637_1208646	Not Available	1008
3300027584|Ga0209637_1270854	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	823
3300027584|Ga0209637_1274429	Not Available	814
3300027584|Ga0209637_1306529	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	735
3300027584|Ga0209637_1310045	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	727
3300027584|Ga0209637_1321456	Not Available	702
3300027584|Ga0209637_1360965	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	625
3300027584|Ga0209637_1381738	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	587
3300027584|Ga0209637_1408503	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	541
3300027585|Ga0209150_1004033	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3772
3300027585|Ga0209150_1023443	Not Available	2181
3300027585|Ga0209150_1027830	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2062
3300027585|Ga0209150_1085633	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1345
3300027585|Ga0209150_1185100	Not Available	916
3300027585|Ga0209150_1202994	Not Available	867
3300027585|Ga0209150_1207669	Not Available	855
3300027585|Ga0209150_1225827	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	808
3300027585|Ga0209150_1266750	Not Available	719
3300027585|Ga0209150_1315978	Not Available	632
3300027585|Ga0209150_1322495	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	621
3300027585|Ga0209150_1351100	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	578
3300027585|Ga0209150_1386762	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	528
3300027585|Ga0209150_1390794	Not Available	523
3300027613|Ga0209122_1103087	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1363
3300027613|Ga0209122_1196172	Not Available	954
3300027613|Ga0209122_1270381	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	758
3300027613|Ga0209122_1317520	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	665
3300027613|Ga0209122_1317770	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	664
3300027613|Ga0209122_1352247	Not Available	606
3300027613|Ga0209122_1361852	Not Available	591
3300027613|Ga0209122_1371612	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	575
3300027613|Ga0209122_1390449	Not Available	546
3300027613|Ga0209122_1409427	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	520
3300027613|Ga0209122_1416180	Not Available	511
3300027620|Ga0209260_10014685	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1533
3300027620|Ga0209260_10037862	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1148
3300027620|Ga0209260_10100908	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	841
3300027620|Ga0209260_10206620	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	637
3300027626|Ga0209149_1011096	All Organisms → cellular organisms → Eukaryota	6531
3300027626|Ga0209149_1013843	Not Available	6029
3300027626|Ga0209149_1017865	Not Available	5479
3300027626|Ga0209149_1022678	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4978
3300027626|Ga0209149_1035147	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4102
3300027626|Ga0209149_1057565	Not Available	3191
3300027626|Ga0209149_1059122	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3143
3300027626|Ga0209149_1059917	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3118
3300027626|Ga0209149_1064132	Not Available	3000
3300027626|Ga0209149_1070692	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2833
3300027626|Ga0209149_1088702	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2461
3300027626|Ga0209149_1095754	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2340
3300027626|Ga0209149_1099435	Not Available	2280
3300027626|Ga0209149_1126075	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1911
3300027626|Ga0209149_1126994	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1900
3300027626|Ga0209149_1132621	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1837
3300027626|Ga0209149_1138268	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1775
3300027626|Ga0209149_1148512	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1673
3300027626|Ga0209149_1157492	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1588
3300027626|Ga0209149_1160249	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1562
3300027626|Ga0209149_1160397	Not Available	1560
3300027626|Ga0209149_1190940	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1316
3300027626|Ga0209149_1214202	Not Available	1164
3300027626|Ga0209149_1216176	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1152
3300027626|Ga0209149_1225127	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1100
3300027626|Ga0209149_1238451	All Organisms → Viruses → Predicted Viral	1030
3300027626|Ga0209149_1268458	Not Available	888
3300027626|Ga0209149_1300735	Not Available	755
3300027626|Ga0209149_1315590	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	702
3300027626|Ga0209149_1324920	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	671
3300027626|Ga0209149_1348683	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	596
3300027632|Ga0209339_1027570	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3938
3300027632|Ga0209339_1062252	Not Available	2692
3300027632|Ga0209339_1089071	Not Available	2206
3300027632|Ga0209339_1090217	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2190
3300027632|Ga0209339_1118419	Not Available	1845
3300027632|Ga0209339_1152965	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1538
3300027632|Ga0209339_1175704	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1376
3300027632|Ga0209339_1218327	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	1137
3300027632|Ga0209339_1298535	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	823
3300027632|Ga0209339_1317622	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	763
3300027632|Ga0209339_1328415	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	731
3300027632|Ga0209339_1377473	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	606
3300027632|Ga0209339_1418782	Not Available	515

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	64.41%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	35.59%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	64.41%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	35.59%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	64.41%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	35.59%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001734	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1	Host-Associated
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated
3300001744	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2	Host-Associated
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated
3300002181	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3	Host-Associated
3300003801	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1	Host-Associated
3300003829	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI	Host-Associated
3300004098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2)	Host-Associated
3300004122	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2)	Host-Associated
3300027500	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 (SPAdes)	Host-Associated
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated
3300027556	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes)	Host-Associated
3300027557	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes)	Host-Associated
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated
3300027620	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes)	Host-Associated
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24668J20090_100101104	3300001734	Marine Gutless Worms Symbiont	LNRDQIVKIARFTGCKNFVGNRKKFIVNVFIDLKPVERFENM*
JGI24668J20090_100531763	3300001734	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERCENGSDM*
JGI24668J20090_100707333	3300001734	Marine Gutless Worms Symbiont	LNKDQIVKIARLTGCKNFVGKRKFIFNAFVDLKPVETFKNGSDM*
JGI24668J20090_100978062	3300001734	Marine Gutless Worms Symbiont	LNIYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVKRFENGSDM*
JGI24668J20090_101295071	3300001734	Marine Gutless Worms Symbiont	VGTARGLNKDQIVKIARLTGCKNFVGKKKKFIFNALVDLKPVERFENGSDM*
JGI24668J20090_101471952	3300001734	Marine Gutless Worms Symbiont	CWRYRAACDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERSENGSDM*
JGI24668J20090_101514881	3300001734	Marine Gutless Worms Symbiont	WARKGHNRRGAGTARELNRDQIVKIARLTGCKKFLGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24668J20090_101641491	3300001734	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24668J20090_101786201	3300001734	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKKFVGKRKKFIFNAFVDLKPVERF*
JGI24668J20090_102010612	3300001734	Marine Gutless Worms Symbiont	MRSGTVRGLNRDNIVKIAKLTGCKNFVGKRKKFIFNAFVDHKPVERFENGSDI*
JGI24668J20090_102051221	3300001734	Marine Gutless Worms Symbiont	VRGLYRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSDNRSDM*
JGI24668J20090_102246091	3300001734	Marine Gutless Worms Symbiont	ISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM*
JGI24668J20090_102585391	3300001734	Marine Gutless Worms Symbiont	LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENGSDM*
JGI24671J20093_100558581	3300001741	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24671J20093_101259133	3300001741	Marine Gutless Worms Symbiont	LNRVQIVKIARLTGCKNFVGKRMKFTFNVFVDLKPVERFENGSDM*
JGI24671J20093_101413442	3300001741	Marine Gutless Worms Symbiont	MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVDLKPVERLENGSDYVRI*
JGI24671J20093_102246342	3300001741	Marine Gutless Worms Symbiont	RGLNRDQIVKIVRLTGCKNFVGKRKKFIFNVFVDLNPAERFKNGSDM*
JGI24673J20094_100357152	3300001742	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDLKPVERFDFENGSDM*
JGI24673J20094_101533002	3300001742	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM*
JGI24673J20094_101666861	3300001742	Marine Gutless Worms Symbiont	LNRDQIVKIARLSGCRNSVGKIKKFIFNAFADLKPVERFENGSDM*
JGI24673J20094_101887933	3300001742	Marine Gutless Worms Symbiont	RGLNKDQIVKIARLTGFKNFVGKRKKFRPILNAFVDLKPVERFDNGSDM*
JGI24673J20094_101996352	3300001742	Marine Gutless Worms Symbiont	DQIVKIARLTGCKNFVSKKKKFIFNAFIDLKPVERFENGSDM*
JGI24673J20094_102100671	3300001742	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPVERLENWSDNNVRI*
JGI24673J20094_102270371	3300001742	Marine Gutless Worms Symbiont	GLNRDQIVKXXRLTGCKNFVGKRKKFIFSAFVDLKPVERFENGSNH*
JGI24669J20092_100221431	3300001744	Marine Gutless Worms Symbiont	MTRWLVGLNRDQIVKIARLTGCKNFVGKREKFIFNASVDLKPVERSENRSDM*
JGI24669J20092_100494132	3300001744	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERXENRSDM*
JGI24669J20092_100601792	3300001744	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24669J20092_100726601	3300001744	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGTDM*
JGI24669J20092_101438951	3300001744	Marine Gutless Worms Symbiont	KIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET*
JGI24669J20092_101479942	3300001744	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFEDGWE*
JGI24672J20091_100221202	3300001746	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDFKPVERCDFENGSDM*
JGI24672J20091_100262623	3300001746	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24672J20091_100290181	3300001746	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVGKRKKFIFNAFVDLKPVLRSENRSDM*
JGI24672J20091_100417373	3300001746	Marine Gutless Worms Symbiont	GTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN*
JGI24672J20091_100718061	3300001746	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPXERLENWSDNNVRI*
JGI24672J20091_101720532	3300001746	Marine Gutless Worms Symbiont	ARGLNRDKIVKIVRLNGCKNFVGKRKFIFNAFMDLKPVERFENGSDM*
JGI24670J26820_112440581	3300002181	Marine Gutless Worms Symbiont	AGTARGLNRDQIVKIARLTGCKNFVGKRKEFIFNAFVDLKPVERSENRSDM*
JGI24670J26820_112529921	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDVKPVERFENRSDMCGFRSLNNST
JGI24670J26820_112828701	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKKKKFIFNAFVDLKPVERFENGSDIVRI*
JGI24670J26820_113040631	3300002181	Marine Gutless Worms Symbiont	RGLNRDHIVQIARLTGCKDFVGKRKKFVFNMFIDLKPVERFENGGDM*
JGI24670J26820_113729652	3300002181	Marine Gutless Worms Symbiont	MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFSAFIDLKPVERFENGSDM*
JGI24670J26820_114178172	3300002181	Marine Gutless Worms Symbiont	RKGDNR*GAGTARGLNRDEIVKIARLTGCQNFIGRSLYSMRSFNFVDLKPVERSENGSDMICEV*
JGI24670J26820_114377092	3300002181	Marine Gutless Worms Symbiont	KIARLTGCKNFVGKRKFIFNAFVDLKPVEKFENGSDM*
JGI24670J26820_114652472	3300002181	Marine Gutless Worms Symbiont	MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVHLKPVERLENGSDYVRI*
JGI24670J26820_114671663	3300002181	Marine Gutless Worms Symbiont	ARLTGCKNFVGKRKKFIFNVFVNLKPVERFENGSDM*
JGI24670J26820_114739091	3300002181	Marine Gutless Worms Symbiont	LNRDKIVKIVRLNGCKNFVGKRKFIFNAFMDLKPVERFENGSDM
JGI24670J26820_114876982	3300002181	Marine Gutless Worms Symbiont	AGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNSFVDLKPLERFENGSDM*
JGI24670J26820_114926422	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPMERLENWSDNNVRI*
JGI24670J26820_115091331	3300002181	Marine Gutless Worms Symbiont	NRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM*
JGI24670J26820_115407602	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERFENGGDM*
JGI24670J26820_116098672	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCENFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24670J26820_116177754	3300002181	Marine Gutless Worms Symbiont	MMSGYCEGLDRDQIVKIAGLTGCKNFVGKRKKFIFNAFVDLKPVERFGNRSDM*
Ga0056138_10070361	3300003801	Marine Gutless Worms Symbiont	VGTARGLNKDQIVKIARLTGCKNFVGKRKKFIFNALVDLKPVERFENGSDM*
Ga0056138_10144741	3300003801	Marine Gutless Worms Symbiont	MRSGYCVGLNRDQVVKIARLTGCKNFVGKRKKFIFNAFVDLTPVEKIENGSDM*
Ga0056138_10688612	3300003801	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKKFLGKRKKFIFNAFVDLKPVERFENGSDM*
Ga0056137_10190212	3300003829	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCTNSVGKRKKFIFNEFVDLKLVERFENANDM*
Ga0065184_100487322	3300004098	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVGKRKKFLFSAFVDVKPVERVENGSDM*
Ga0065184_100554661	3300004098	Marine Gutless Worms Symbiont	GTARGLNRDQIVKIARSTGFKNLVGKRNKFVLNAFVDLKPVERFENGSHTARI*
Ga0065184_100849751	3300004098	Marine Gutless Worms Symbiont	TARGLNRDQIVKVARLTGCKNFVCKRKKFIFDAFVDLKPVESLHVNACS*
Ga0065184_100927101	3300004098	Marine Gutless Worms Symbiont	VTTGAGTARGLKRDQVVNIATLSDSKNFVCKRKKFIINAFVDLKPVERFENGSDMS
Ga0065184_102307841	3300004098	Marine Gutless Worms Symbiont	RLKRDKIVKIARLSGCKNFARESQKFIFHAFVDLWPVERFVHCK*
Ga0065184_102436482	3300004098	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM*
Ga0065185_101877971	3300004122	Marine Gutless Worms Symbiont	MRRWARKGNNRAGTARGLNKDQIAKIAGFTGCKNFVGKRKKFIFNAFIDFKPVERFENGSDM*
Ga0065185_103396652	3300004122	Marine Gutless Worms Symbiont	LKVNQIVKTVRLPGCNNLVGRRKKFIFNVFVDLKPVERFENGSDMCRF
Ga0209145_12537761	3300027500	Marine Gutless Worms Symbiont	RDQIVKIARLTSCKNFVGKRKKFIFNAFVDLKPVEKSENRSDR
Ga0209791_10026436	3300027540	Marine Gutless Worms Symbiont	VLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRSDM
Ga0209791_10120262	3300027540	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARLTGCKNFVGKRKKFIFNVFTDLKPVERFENWSDM
Ga0209791_10261232	3300027540	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209791_10314071	3300027540	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFVSKRKKFIFDEFVDLKPVERSENGSDM
Ga0209791_10785942	3300027540	Marine Gutless Worms Symbiont	VGTARGLNKDQIVKIARLTGCKNFVGKRKKFIFNALVDLKPVERFENGSDM
Ga0209791_10882982	3300027540	Marine Gutless Worms Symbiont	VNRDQIVKIARLTGCKNFLGRRTKFIFNAFVDLKPVERSENRSDM
Ga0209791_11563421	3300027540	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209791_12108522	3300027540	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN
Ga0209791_12634821	3300027540	Marine Gutless Worms Symbiont	MRSGYCEGVEMNRDQIVKTARLTGCKNFIGKRKKFIFNAFVDLKPVERSENRSDMRGFRSLNNSTSK
Ga0209791_12928721	3300027540	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARSIGCKNFVGKRKKFIFNAFTDLKPVQISENGSDM
Ga0209791_13099252	3300027540	Marine Gutless Worms Symbiont	MRSGYCEGLKRDQVVKIARQTGYKNFVGKRKKFIFNTFVDLKPVERFQNGSDM
Ga0209791_13495062	3300027540	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET
Ga0209791_13787221	3300027540	Marine Gutless Worms Symbiont	MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVDLKPVERLENGSDYVRI
Ga0209791_13928531	3300027540	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAYVDLKPVERSEHRSDIVRI
Ga0209338_10009905	3300027551	Marine Gutless Worms Symbiont	MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFSAFIDLKPVERFENGSDM
Ga0209338_10108874	3300027551	Marine Gutless Worms Symbiont	MRSGTVRGLNRDNIVKIAKLTGCKNFVGKRKKFIFNAFVDHKPVERFENGSDI
Ga0209338_10180835	3300027551	Marine Gutless Worms Symbiont	MGTSRGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209338_10303114	3300027551	Marine Gutless Worms Symbiont	NRDQTVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERSENRSDM
Ga0209338_10409483	3300027551	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRFENRSDM
Ga0209338_10435591	3300027551	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKKFVGKRKKFIFNAFVDLKPVETGEIGEWE
Ga0209338_10474152	3300027551	Marine Gutless Worms Symbiont	MRRWARKGNNRAGTARGLNKDQIAKIAGFTGCKNFVGKRKKFIFNAFIDFKPVERFENGSDM
Ga0209338_10889732	3300027551	Marine Gutless Worms Symbiont	VRGLHRDQIVKIARLTGCKNFVGKRQQLIFNTFTDLMPMERFET
Ga0209338_11434381	3300027551	Marine Gutless Worms Symbiont	RGLNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209338_11590981	3300027551	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARLTGCKNFVGKRKKFVLNVFVDLKPVARFENRSDM
Ga0209338_11652141	3300027551	Marine Gutless Worms Symbiont	GTAMGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSYVRI
Ga0209338_11663571	3300027551	Marine Gutless Worms Symbiont	MKSGTARALNTDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFEDGV
Ga0209338_12176782	3300027551	Marine Gutless Worms Symbiont	LNRDEIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENRGDM
Ga0209338_12791531	3300027551	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGTGNKKKFWPIFNAFVDLKPVERFENGSDI
Ga0209338_13022182	3300027551	Marine Gutless Worms Symbiont	TARGLNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209338_13023691	3300027551	Marine Gutless Worms Symbiont	NRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM
Ga0209338_13031882	3300027551	Marine Gutless Worms Symbiont	VRGLKIDQTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209338_13048131	3300027551	Marine Gutless Worms Symbiont	VKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM
Ga0209338_13338562	3300027551	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPMERLENWSDNNVRI
Ga0209338_13976022	3300027551	Marine Gutless Worms Symbiont	VKIARLTGFKNFVGQRKKFIFNAFVDLKPVERFENWSDM
Ga0209743_10128531	3300027556	Marine Gutless Worms Symbiont	ARRLKRDKIVKIARLSGCKNFARESQKFIFHAFVDLWPVERFVHCK
Ga0209743_10152171	3300027556	Marine Gutless Worms Symbiont	LRGRGGLNRDQIVKIAKLTGCKNFVGKRKKFIFNAFIDLKSVERFENASDM
Ga0209743_10210903	3300027556	Marine Gutless Worms Symbiont	MRSRYCEGIEQDYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209743_10654161	3300027556	Marine Gutless Worms Symbiont	RGLNRDQIVKIARLTGCKNFEGKRKKFIFNAFVDLKPVLRSENRSDM
Ga0209743_11024471	3300027556	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKFIYNVFVDLKPVE
Ga0209743_11363742	3300027556	Marine Gutless Worms Symbiont	LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDNYVRI
Ga0209743_11414502	3300027556	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDFKPVERCDFENGSDM
Ga0209743_11969701	3300027556	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFELE
Ga0209743_13088732	3300027556	Marine Gutless Worms Symbiont	MKSGYCEGVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERFENGSDM
Ga0209743_13144801	3300027556	Marine Gutless Worms Symbiont	ARRLNRDQIVKIARLTGCKNFVGKIKKFIFNAFVDLKPVERLE
Ga0209743_14045542	3300027556	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFVFNAFVDLKPLERFKNRSDM
Ga0209679_12079391	3300027557	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRS
Ga0209428_10392463	3300027564	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTSCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209428_10982821	3300027564	Marine Gutless Worms Symbiont	QTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNESDM
Ga0209428_11274691	3300027564	Marine Gutless Worms Symbiont	MRRVLNRDQIVKISRCTGCKNFVGKRKKFIFNAFIDLKLVERFENGSDM
Ga0209428_11646722	3300027564	Marine Gutless Worms Symbiont	VGTARGLNRDQTVKIARLTGCKNNVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209428_11656882	3300027564	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDFKPVERFENRSDM
Ga0209428_12067141	3300027564	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209428_12118542	3300027564	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM
Ga0209428_12704841	3300027564	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209428_12831221	3300027564	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM
Ga0209428_13643211	3300027564	Marine Gutless Worms Symbiont	QPMRSGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209428_13972181	3300027564	Marine Gutless Worms Symbiont	LNRDQIVKTARLSGCKNFVGKRKKFVFNAFVDLKPVERIGVICE
Ga0209637_10275702	3300027584	Marine Gutless Worms Symbiont	VLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209637_10782242	3300027584	Marine Gutless Worms Symbiont	MRSGSCEGVENRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGNDM
Ga0209637_10913712	3300027584	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGYKNFVGKRKKFIFNAFIDLKPVERFENGSDI
Ga0209637_11053031	3300027584	Marine Gutless Worms Symbiont	MSQLAYSFRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVEIFENGSDV
Ga0209637_11084961	3300027584	Marine Gutless Worms Symbiont	ARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM
Ga0209637_11107592	3300027584	Marine Gutless Worms Symbiont	ARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRSENRSDRPM
Ga0209637_11381312	3300027584	Marine Gutless Worms Symbiont	LNKDQIVKIARLTGFKNFVGKRKKFRPILNAFVDLKPVERFDNGSDM
Ga0209637_11429472	3300027584	Marine Gutless Worms Symbiont	ARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVNLKPVERSENRSDM
Ga0209637_11888801	3300027584	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209637_11932992	3300027584	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFADLKPVERFENRSDM
Ga0209637_12086462	3300027584	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPVERLENWSDNNVRI
Ga0209637_12700331	3300027584	Marine Gutless Worms Symbiont	LKRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPAQRRGVVS
Ga0209637_12708542	3300027584	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSLQLIEVCTL
Ga0209637_12744291	3300027584	Marine Gutless Worms Symbiont	GTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM
Ga0209637_13065292	3300027584	Marine Gutless Worms Symbiont	LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDM
Ga0209637_13100452	3300027584	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERSENRSDM
Ga0209637_13214561	3300027584	Marine Gutless Worms Symbiont	DQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDVKI
Ga0209637_13609652	3300027584	Marine Gutless Worms Symbiont	MGLNRDQIVKIARLTGCKNFVSKKKKFIFNAFIDLKPVERFENGSDM
Ga0209637_13817382	3300027584	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSGNGSDM
Ga0209637_14085031	3300027584	Marine Gutless Worms Symbiont	VGTARGLNRDQTVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERSEYRSDM
Ga0209150_10040333	3300027585	Marine Gutless Worms Symbiont	LNRDHTVKIARLTGCKNFAGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209150_10157062	3300027585	Marine Gutless Worms Symbiont	VLNRDEIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRSDM
Ga0209150_10234432	3300027585	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209150_10278303	3300027585	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFSVFIDLKLVERFENRSDM
Ga0209150_10856331	3300027585	Marine Gutless Worms Symbiont	IARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209150_11851001	3300027585	Marine Gutless Worms Symbiont	VRGLNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERLENGGDNYVRIQQT
Ga0209150_12029941	3300027585	Marine Gutless Worms Symbiont	VRGLNRDQIVKIVRLTGCKNFVGKRKKFIFNVFVDLNPAERFENGSDM
Ga0209150_12076691	3300027585	Marine Gutless Worms Symbiont	QGGAGTAIGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEICECE
Ga0209150_12258271	3300027585	Marine Gutless Worms Symbiont	RGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209150_12667501	3300027585	Marine Gutless Worms Symbiont	LNRDQIVKIARLTSCKNFVSKRKKFIFNAFVDLKPVERFENGSDT
Ga0209150_13159782	3300027585	Marine Gutless Worms Symbiont	LSRDQIVKIARLTGCKNFVGKRKKFNAFVDLKPVERSENRSDM
Ga0209150_13224951	3300027585	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFEDGWE
Ga0209150_13511002	3300027585	Marine Gutless Worms Symbiont	NRDEIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN
Ga0209150_13867621	3300027585	Marine Gutless Worms Symbiont	IARLTGCKNFVGKRKKFIFNVFVDLKPVERFENGSDM
Ga0209150_13907942	3300027585	Marine Gutless Worms Symbiont	LNRDQVVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209122_11030872	3300027613	Marine Gutless Worms Symbiont	LNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209122_11961721	3300027613	Marine Gutless Worms Symbiont	AATARGLNRDQTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNESDM
Ga0209122_12703812	3300027613	Marine Gutless Worms Symbiont	MRSGYCDGVVMNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209122_13175201	3300027613	Marine Gutless Worms Symbiont	VRGLKRDQIVKIARLTGYKNFIGKRQKFIFNAFVDLKPVERFENRSDM
Ga0209122_13177702	3300027613	Marine Gutless Worms Symbiont	MRSGTASGLNRDQIVRIARLTGCKNFVGKRKKFIFNAFINLKPVERLENRSDM
Ga0209122_13522471	3300027613	Marine Gutless Worms Symbiont	VEIDPQVAHGRGDRDQIVKIARLTGCKNFVGKRKKFIFNAFVERFENGSDM
Ga0209122_13556841	3300027613	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGNRKKFIFNAFVDLKPVERFENRSDM
Ga0209122_13618522	3300027613	Marine Gutless Worms Symbiont	VGEKGVNRRGAGTANGLNEYQTVKIATLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSD
Ga0209122_13716122	3300027613	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFADLKPVERFENGSDM
Ga0209122_13904491	3300027613	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET
Ga0209122_14094272	3300027613	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVELKPVERFENRSDM
Ga0209122_14161801	3300027613	Marine Gutless Worms Symbiont	KDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDM
Ga0209260_100146851	3300027620	Marine Gutless Worms Symbiont	MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFNAFIDLKPVERFENGSDM
Ga0209260_100206011	3300027620	Marine Gutless Worms Symbiont	IARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209260_100378621	3300027620	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM
Ga0209260_101009081	3300027620	Marine Gutless Worms Symbiont	RLTGCKNFAGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209260_102066202	3300027620	Marine Gutless Worms Symbiont	TASGLNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDLKPVERFDFENGSDM
Ga0209149_10110961	3300027626	Marine Gutless Worms Symbiont	GLNRDQIVIARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM
Ga0209149_10138431	3300027626	Marine Gutless Worms Symbiont	MRSGYTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDL
Ga0209149_10178653	3300027626	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKKKKFIFNAFVDLKPVERFENGSDIVRI
Ga0209149_10226783	3300027626	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFEGKRKKFIFNAFVDLKPVLRSENRSDM
Ga0209149_10351471	3300027626	Marine Gutless Worms Symbiont	VKIARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209149_10575652	3300027626	Marine Gutless Worms Symbiont	MKSGTARALNTDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFEDGVIM
Ga0209149_10591221	3300027626	Marine Gutless Worms Symbiont	MRSRYCEGLNRDQIVKIARLTGCKNFVGKREKFIFNASVDLKPVERSENRSDM
Ga0209149_10599174	3300027626	Marine Gutless Worms Symbiont	VTFNEETVTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDV
Ga0209149_10641321	3300027626	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERSENRSDM
Ga0209149_10642251	3300027626	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIATLTGCKNFVSKRKKFIFDEFVDLKPVERSENGSDM
Ga0209149_10706921	3300027626	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209149_10887022	3300027626	Marine Gutless Worms Symbiont	MRSGYCDGVVMNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENTSDM
Ga0209149_10957541	3300027626	Marine Gutless Worms Symbiont	RGLNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209149_10994353	3300027626	Marine Gutless Worms Symbiont	DQVVKIARLTGCKNFVGKRKKFMFNAFVDLKPVQRFENRSDM
Ga0209149_11260753	3300027626	Marine Gutless Worms Symbiont	MMRGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNGNNM
Ga0209149_11269941	3300027626	Marine Gutless Worms Symbiont	MRNGYCEGLNRDQIIKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSNM
Ga0209149_11326212	3300027626	Marine Gutless Worms Symbiont	VNRDQIVKIARLTGCKNFLGRRTKFIFNAFVDLKTVERSENRSNM
Ga0209149_11382681	3300027626	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209149_11485122	3300027626	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209149_11574923	3300027626	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDISYLRI
Ga0209149_11602492	3300027626	Marine Gutless Worms Symbiont	LNKDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVDRSENRSDM
Ga0209149_11603971	3300027626	Marine Gutless Worms Symbiont	RGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSGNGSDM
Ga0209149_11909403	3300027626	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDVKI
Ga0209149_12142021	3300027626	Marine Gutless Worms Symbiont	MRSGYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSEN
Ga0209149_12161763	3300027626	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERFENGGDM
Ga0209149_12251272	3300027626	Marine Gutless Worms Symbiont	TARGSNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRFENRSDM
Ga0209149_12384511	3300027626	Marine Gutless Worms Symbiont	MRSGYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDT
Ga0209149_12684581	3300027626	Marine Gutless Worms Symbiont	VGTARGLNKDRIVKIARLTGCKNFVGKRKKFIFNALVDLKPVEIFENGSDM
Ga0209149_13007351	3300027626	Marine Gutless Worms Symbiont	MRSQYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFE
Ga0209149_13155901	3300027626	Marine Gutless Worms Symbiont	RLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM
Ga0209149_13249202	3300027626	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209149_13486831	3300027626	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERSENRNDT
Ga0209339_10275705	3300027632	Marine Gutless Worms Symbiont	KIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209339_10433881	3300027632	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209339_10622521	3300027632	Marine Gutless Worms Symbiont	AGTASGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209339_10890711	3300027632	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERLENGGDNYVRIQQT
Ga0209339_10902171	3300027632	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDYVRI
Ga0209339_11184192	3300027632	Marine Gutless Worms Symbiont	MMSGYCEGLDRDQIVKIAGLTGCKNFVGKRKKFIFNAFVDLKPVERFGNRSDM
Ga0209339_11529651	3300027632	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKISRLTVCKNVVGKRKKFIFNAFYDLKPVERSENRSDM
Ga0209339_11755212	3300027632	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNSFVDLKPLERFENGSDM
Ga0209339_11757041	3300027632	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209339_12183271	3300027632	Marine Gutless Worms Symbiont	VNRDQIVKIARLTGCKNIVGKRKMFIFNAFVDLKPEERFEKRND
Ga0209339_12484712	3300027632	Marine Gutless Worms Symbiont	LNRDQIVKIPVARLTGCKNFVGKRKKFIFNAFVDFKPVERFDNGSDM
Ga0209339_12985351	3300027632	Marine Gutless Worms Symbiont	IVKIARLTGCKKFVGKRKKFIFNAFVDLKPVERFENGSDI
Ga0209339_13176222	3300027632	Marine Gutless Worms Symbiont	GTARGLNRYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209339_13284151	3300027632	Marine Gutless Worms Symbiont	NRDQIVKIAKLTGCKNFVGKREKFIFNAFVDLKPVERFENGSDM
Ga0209339_13774732	3300027632	Marine Gutless Worms Symbiont	DQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNGNNM
Ga0209339_14187821	3300027632	Marine Gutless Worms Symbiont	KDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDNYVRI