| Basic Information | |
|---|---|
| Family ID | F020808 |
| Family Type | Metagenome |
| Number of Sequences | 222 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Number of Associated Samples | 22 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.55 % |
| % of genes near scaffold ends (potentially truncated) | 46.40 % |
| % of genes from short scaffolds (< 2000 bps) | 76.58 % |
| Associated GOLD sequencing projects | 12 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.252 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (64.414 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut (100.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 1.80 |
| PF02995 | DUF229 | 0.45 |
| PF16529 | Ge1_WD40 | 0.45 |
| PF01591 | 6PF2K | 0.45 |
| PF16521 | Myosin-VI_CBD | 0.45 |
| PF06424 | PRP1_N | 0.45 |
| PF14529 | Exo_endo_phos_2 | 0.45 |
| PF16347 | DUF4976 | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.76 % |
| Unclassified | root | N/A | 43.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001734|JGI24668J20090_10010110 | Not Available | 1853 | Open in IMG/M |
| 3300001734|JGI24668J20090_10053176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 981 | Open in IMG/M |
| 3300001734|JGI24668J20090_10070733 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 879 | Open in IMG/M |
| 3300001734|JGI24668J20090_10097806 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 772 | Open in IMG/M |
| 3300001734|JGI24668J20090_10129507 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 688 | Open in IMG/M |
| 3300001734|JGI24668J20090_10147195 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 651 | Open in IMG/M |
| 3300001734|JGI24668J20090_10151488 | Not Available | 643 | Open in IMG/M |
| 3300001734|JGI24668J20090_10164149 | Not Available | 621 | Open in IMG/M |
| 3300001734|JGI24668J20090_10178620 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 598 | Open in IMG/M |
| 3300001734|JGI24668J20090_10201061 | Not Available | 567 | Open in IMG/M |
| 3300001734|JGI24668J20090_10205122 | Not Available | 562 | Open in IMG/M |
| 3300001734|JGI24668J20090_10224609 | Not Available | 539 | Open in IMG/M |
| 3300001734|JGI24668J20090_10258539 | Not Available | 504 | Open in IMG/M |
| 3300001741|JGI24671J20093_10055858 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 853 | Open in IMG/M |
| 3300001741|JGI24671J20093_10125913 | Not Available | 634 | Open in IMG/M |
| 3300001741|JGI24671J20093_10224634 | Not Available | 501 | Open in IMG/M |
| 3300001742|JGI24673J20094_10035715 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1125 | Open in IMG/M |
| 3300001742|JGI24673J20094_10153300 | Not Available | 645 | Open in IMG/M |
| 3300001742|JGI24673J20094_10166686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 622 | Open in IMG/M |
| 3300001742|JGI24673J20094_10188793 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 589 | Open in IMG/M |
| 3300001742|JGI24673J20094_10199635 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 575 | Open in IMG/M |
| 3300001742|JGI24673J20094_10210067 | Not Available | 562 | Open in IMG/M |
| 3300001742|JGI24673J20094_10227037 | Not Available | 542 | Open in IMG/M |
| 3300001744|JGI24669J20092_10022143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1073 | Open in IMG/M |
| 3300001744|JGI24669J20092_10049413 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 804 | Open in IMG/M |
| 3300001744|JGI24669J20092_10060179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 750 | Open in IMG/M |
| 3300001744|JGI24669J20092_10072660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 701 | Open in IMG/M |
| 3300001744|JGI24669J20092_10143895 | Not Available | 546 | Open in IMG/M |
| 3300001744|JGI24669J20092_10147994 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 540 | Open in IMG/M |
| 3300001746|JGI24672J20091_10022120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1059 | Open in IMG/M |
| 3300001746|JGI24672J20091_10026262 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 996 | Open in IMG/M |
| 3300001746|JGI24672J20091_10029018 | Not Available | 960 | Open in IMG/M |
| 3300001746|JGI24672J20091_10041737 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 844 | Open in IMG/M |
| 3300001746|JGI24672J20091_10071806 | Not Available | 699 | Open in IMG/M |
| 3300002181|JGI24670J26820_11244058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 546 | Open in IMG/M |
| 3300002181|JGI24670J26820_11252992 | Not Available | 552 | Open in IMG/M |
| 3300002181|JGI24670J26820_11282870 | Not Available | 575 | Open in IMG/M |
| 3300002181|JGI24670J26820_11304063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 593 | Open in IMG/M |
| 3300002181|JGI24670J26820_11372965 | Not Available | 661 | Open in IMG/M |
| 3300002181|JGI24670J26820_11467166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 798 | Open in IMG/M |
| 3300002181|JGI24670J26820_11473909 | Not Available | 811 | Open in IMG/M |
| 3300002181|JGI24670J26820_11487698 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 840 | Open in IMG/M |
| 3300002181|JGI24670J26820_11492642 | Not Available | 851 | Open in IMG/M |
| 3300002181|JGI24670J26820_11509133 | Not Available | 891 | Open in IMG/M |
| 3300002181|JGI24670J26820_11540760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 987 | Open in IMG/M |
| 3300002181|JGI24670J26820_11609867 | Not Available | 1473 | Open in IMG/M |
| 3300002181|JGI24670J26820_11617775 | Not Available | 1620 | Open in IMG/M |
| 3300003801|Ga0056138_1007036 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1488 | Open in IMG/M |
| 3300003801|Ga0056138_1014474 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 942 | Open in IMG/M |
| 3300003801|Ga0056138_1068861 | Not Available | 516 | Open in IMG/M |
| 3300003829|Ga0056137_1019021 | Not Available | 689 | Open in IMG/M |
| 3300004098|Ga0065184_10048732 | All Organisms → cellular organisms → Eukaryota | 1523 | Open in IMG/M |
| 3300004098|Ga0065184_10055466 | Not Available | 1441 | Open in IMG/M |
| 3300004098|Ga0065184_10084975 | Not Available | 1184 | Open in IMG/M |
| 3300004098|Ga0065184_10092710 | Not Available | 1135 | Open in IMG/M |
| 3300004098|Ga0065184_10230784 | Not Available | 678 | Open in IMG/M |
| 3300004098|Ga0065184_10243648 | Not Available | 655 | Open in IMG/M |
| 3300004122|Ga0065185_10187797 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 765 | Open in IMG/M |
| 3300004122|Ga0065185_10339665 | Not Available | 530 | Open in IMG/M |
| 3300027500|Ga0209145_1253776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 544 | Open in IMG/M |
| 3300027540|Ga0209791_1002643 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 4496 | Open in IMG/M |
| 3300027540|Ga0209791_1012026 | Not Available | 2566 | Open in IMG/M |
| 3300027540|Ga0209791_1026123 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2000 | Open in IMG/M |
| 3300027540|Ga0209791_1031407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1882 | Open in IMG/M |
| 3300027540|Ga0209791_1078594 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1330 | Open in IMG/M |
| 3300027540|Ga0209791_1088298 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1266 | Open in IMG/M |
| 3300027540|Ga0209791_1156342 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 963 | Open in IMG/M |
| 3300027540|Ga0209791_1210852 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 810 | Open in IMG/M |
| 3300027540|Ga0209791_1263482 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 695 | Open in IMG/M |
| 3300027540|Ga0209791_1292872 | Not Available | 644 | Open in IMG/M |
| 3300027540|Ga0209791_1309925 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 616 | Open in IMG/M |
| 3300027540|Ga0209791_1349506 | Not Available | 557 | Open in IMG/M |
| 3300027540|Ga0209791_1392853 | Not Available | 501 | Open in IMG/M |
| 3300027551|Ga0209338_1000990 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 9065 | Open in IMG/M |
| 3300027551|Ga0209338_1010887 | Not Available | 4182 | Open in IMG/M |
| 3300027551|Ga0209338_1030311 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2906 | Open in IMG/M |
| 3300027551|Ga0209338_1040948 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2575 | Open in IMG/M |
| 3300027551|Ga0209338_1043559 | Not Available | 2512 | Open in IMG/M |
| 3300027551|Ga0209338_1047415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2425 | Open in IMG/M |
| 3300027551|Ga0209338_1088973 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| 3300027551|Ga0209338_1143438 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1344 | Open in IMG/M |
| 3300027551|Ga0209338_1159098 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1252 | Open in IMG/M |
| 3300027551|Ga0209338_1165214 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1219 | Open in IMG/M |
| 3300027551|Ga0209338_1166357 | Not Available | 1213 | Open in IMG/M |
| 3300027551|Ga0209338_1217678 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 990 | Open in IMG/M |
| 3300027551|Ga0209338_1279153 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 793 | Open in IMG/M |
| 3300027551|Ga0209338_1302218 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 729 | Open in IMG/M |
| 3300027551|Ga0209338_1302369 | Not Available | 729 | Open in IMG/M |
| 3300027551|Ga0209338_1303188 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 727 | Open in IMG/M |
| 3300027551|Ga0209338_1304813 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 722 | Open in IMG/M |
| 3300027551|Ga0209338_1333856 | Not Available | 653 | Open in IMG/M |
| 3300027551|Ga0209338_1397602 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 520 | Open in IMG/M |
| 3300027556|Ga0209743_1012853 | Not Available | 2949 | Open in IMG/M |
| 3300027556|Ga0209743_1015217 | Not Available | 2796 | Open in IMG/M |
| 3300027556|Ga0209743_1021090 | Not Available | 2514 | Open in IMG/M |
| 3300027556|Ga0209743_1065416 | Not Available | 1660 | Open in IMG/M |
| 3300027556|Ga0209743_1102447 | Not Available | 1350 | Open in IMG/M |
| 3300027556|Ga0209743_1136374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1167 | Open in IMG/M |
| 3300027556|Ga0209743_1141450 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1144 | Open in IMG/M |
| 3300027556|Ga0209743_1196970 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae → Onychostoma → Onychostoma macrolepis | 945 | Open in IMG/M |
| 3300027556|Ga0209743_1308873 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 680 | Open in IMG/M |
| 3300027556|Ga0209743_1314480 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 670 | Open in IMG/M |
| 3300027564|Ga0209428_1039246 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2297 | Open in IMG/M |
| 3300027564|Ga0209428_1098282 | Not Available | 1533 | Open in IMG/M |
| 3300027564|Ga0209428_1127469 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1330 | Open in IMG/M |
| 3300027564|Ga0209428_1164672 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1142 | Open in IMG/M |
| 3300027564|Ga0209428_1206714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 983 | Open in IMG/M |
| 3300027564|Ga0209428_1211854 | Not Available | 967 | Open in IMG/M |
| 3300027564|Ga0209428_1270484 | Not Available | 800 | Open in IMG/M |
| 3300027564|Ga0209428_1283122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 769 | Open in IMG/M |
| 3300027564|Ga0209428_1364321 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 605 | Open in IMG/M |
| 3300027564|Ga0209428_1397218 | Not Available | 549 | Open in IMG/M |
| 3300027584|Ga0209637_1027570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2763 | Open in IMG/M |
| 3300027584|Ga0209637_1078224 | Not Available | 1791 | Open in IMG/M |
| 3300027584|Ga0209637_1091371 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1661 | Open in IMG/M |
| 3300027584|Ga0209637_1105303 | All Organisms → cellular organisms → Eukaryota | 1542 | Open in IMG/M |
| 3300027584|Ga0209637_1108496 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
| 3300027584|Ga0209637_1110759 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1500 | Open in IMG/M |
| 3300027584|Ga0209637_1138131 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1320 | Open in IMG/M |
| 3300027584|Ga0209637_1142947 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1292 | Open in IMG/M |
| 3300027584|Ga0209637_1188880 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1080 | Open in IMG/M |
| 3300027584|Ga0209637_1193299 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1063 | Open in IMG/M |
| 3300027584|Ga0209637_1208646 | Not Available | 1008 | Open in IMG/M |
| 3300027584|Ga0209637_1270854 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 823 | Open in IMG/M |
| 3300027584|Ga0209637_1274429 | Not Available | 814 | Open in IMG/M |
| 3300027584|Ga0209637_1306529 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 735 | Open in IMG/M |
| 3300027584|Ga0209637_1310045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 727 | Open in IMG/M |
| 3300027584|Ga0209637_1321456 | Not Available | 702 | Open in IMG/M |
| 3300027584|Ga0209637_1360965 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 625 | Open in IMG/M |
| 3300027584|Ga0209637_1381738 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 587 | Open in IMG/M |
| 3300027584|Ga0209637_1408503 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 541 | Open in IMG/M |
| 3300027585|Ga0209150_1004033 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 3772 | Open in IMG/M |
| 3300027585|Ga0209150_1023443 | Not Available | 2181 | Open in IMG/M |
| 3300027585|Ga0209150_1027830 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2062 | Open in IMG/M |
| 3300027585|Ga0209150_1085633 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1345 | Open in IMG/M |
| 3300027585|Ga0209150_1185100 | Not Available | 916 | Open in IMG/M |
| 3300027585|Ga0209150_1202994 | Not Available | 867 | Open in IMG/M |
| 3300027585|Ga0209150_1207669 | Not Available | 855 | Open in IMG/M |
| 3300027585|Ga0209150_1225827 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 808 | Open in IMG/M |
| 3300027585|Ga0209150_1266750 | Not Available | 719 | Open in IMG/M |
| 3300027585|Ga0209150_1315978 | Not Available | 632 | Open in IMG/M |
| 3300027585|Ga0209150_1322495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 621 | Open in IMG/M |
| 3300027585|Ga0209150_1351100 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 578 | Open in IMG/M |
| 3300027585|Ga0209150_1386762 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 528 | Open in IMG/M |
| 3300027585|Ga0209150_1390794 | Not Available | 523 | Open in IMG/M |
| 3300027613|Ga0209122_1103087 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1363 | Open in IMG/M |
| 3300027613|Ga0209122_1196172 | Not Available | 954 | Open in IMG/M |
| 3300027613|Ga0209122_1270381 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 758 | Open in IMG/M |
| 3300027613|Ga0209122_1317520 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 665 | Open in IMG/M |
| 3300027613|Ga0209122_1317770 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 664 | Open in IMG/M |
| 3300027613|Ga0209122_1352247 | Not Available | 606 | Open in IMG/M |
| 3300027613|Ga0209122_1361852 | Not Available | 591 | Open in IMG/M |
| 3300027613|Ga0209122_1371612 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 575 | Open in IMG/M |
| 3300027613|Ga0209122_1390449 | Not Available | 546 | Open in IMG/M |
| 3300027613|Ga0209122_1409427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 520 | Open in IMG/M |
| 3300027613|Ga0209122_1416180 | Not Available | 511 | Open in IMG/M |
| 3300027620|Ga0209260_10014685 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1533 | Open in IMG/M |
| 3300027620|Ga0209260_10037862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1148 | Open in IMG/M |
| 3300027620|Ga0209260_10100908 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 841 | Open in IMG/M |
| 3300027620|Ga0209260_10206620 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 637 | Open in IMG/M |
| 3300027626|Ga0209149_1011096 | All Organisms → cellular organisms → Eukaryota | 6531 | Open in IMG/M |
| 3300027626|Ga0209149_1013843 | Not Available | 6029 | Open in IMG/M |
| 3300027626|Ga0209149_1017865 | Not Available | 5479 | Open in IMG/M |
| 3300027626|Ga0209149_1022678 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 4978 | Open in IMG/M |
| 3300027626|Ga0209149_1035147 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 4102 | Open in IMG/M |
| 3300027626|Ga0209149_1057565 | Not Available | 3191 | Open in IMG/M |
| 3300027626|Ga0209149_1059122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 3143 | Open in IMG/M |
| 3300027626|Ga0209149_1059917 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 3118 | Open in IMG/M |
| 3300027626|Ga0209149_1064132 | Not Available | 3000 | Open in IMG/M |
| 3300027626|Ga0209149_1070692 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2833 | Open in IMG/M |
| 3300027626|Ga0209149_1088702 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2461 | Open in IMG/M |
| 3300027626|Ga0209149_1095754 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2340 | Open in IMG/M |
| 3300027626|Ga0209149_1099435 | Not Available | 2280 | Open in IMG/M |
| 3300027626|Ga0209149_1126075 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1911 | Open in IMG/M |
| 3300027626|Ga0209149_1126994 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1900 | Open in IMG/M |
| 3300027626|Ga0209149_1132621 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1837 | Open in IMG/M |
| 3300027626|Ga0209149_1138268 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1775 | Open in IMG/M |
| 3300027626|Ga0209149_1148512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1673 | Open in IMG/M |
| 3300027626|Ga0209149_1157492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1588 | Open in IMG/M |
| 3300027626|Ga0209149_1160249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1562 | Open in IMG/M |
| 3300027626|Ga0209149_1160397 | Not Available | 1560 | Open in IMG/M |
| 3300027626|Ga0209149_1190940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1316 | Open in IMG/M |
| 3300027626|Ga0209149_1214202 | Not Available | 1164 | Open in IMG/M |
| 3300027626|Ga0209149_1216176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1152 | Open in IMG/M |
| 3300027626|Ga0209149_1225127 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1100 | Open in IMG/M |
| 3300027626|Ga0209149_1238451 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300027626|Ga0209149_1268458 | Not Available | 888 | Open in IMG/M |
| 3300027626|Ga0209149_1300735 | Not Available | 755 | Open in IMG/M |
| 3300027626|Ga0209149_1315590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 702 | Open in IMG/M |
| 3300027626|Ga0209149_1324920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 671 | Open in IMG/M |
| 3300027626|Ga0209149_1348683 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 596 | Open in IMG/M |
| 3300027632|Ga0209339_1027570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 3938 | Open in IMG/M |
| 3300027632|Ga0209339_1062252 | Not Available | 2692 | Open in IMG/M |
| 3300027632|Ga0209339_1089071 | Not Available | 2206 | Open in IMG/M |
| 3300027632|Ga0209339_1090217 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 2190 | Open in IMG/M |
| 3300027632|Ga0209339_1118419 | Not Available | 1845 | Open in IMG/M |
| 3300027632|Ga0209339_1152965 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1538 | Open in IMG/M |
| 3300027632|Ga0209339_1175704 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1376 | Open in IMG/M |
| 3300027632|Ga0209339_1218327 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida | 1137 | Open in IMG/M |
| 3300027632|Ga0209339_1298535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 823 | Open in IMG/M |
| 3300027632|Ga0209339_1317622 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 763 | Open in IMG/M |
| 3300027632|Ga0209339_1328415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 731 | Open in IMG/M |
| 3300027632|Ga0209339_1377473 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 606 | Open in IMG/M |
| 3300027632|Ga0209339_1418782 | Not Available | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont | 64.41% |
| Marine Gutless Worms Symbiont | Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont | 35.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001734 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 | Host-Associated | Open in IMG/M |
| 3300001741 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 | Host-Associated | Open in IMG/M |
| 3300001742 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 | Host-Associated | Open in IMG/M |
| 3300001744 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 | Host-Associated | Open in IMG/M |
| 3300001746 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 | Host-Associated | Open in IMG/M |
| 3300002181 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 | Host-Associated | Open in IMG/M |
| 3300003801 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 | Host-Associated | Open in IMG/M |
| 3300003829 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI | Host-Associated | Open in IMG/M |
| 3300004098 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2) | Host-Associated | Open in IMG/M |
| 3300004122 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2) | Host-Associated | Open in IMG/M |
| 3300027500 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027540 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027551 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027556 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027557 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027564 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027584 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027585 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027613 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027620 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027626 | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027632 | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24668J20090_100101104 | 3300001734 | Marine Gutless Worms Symbiont | LNRDQIVKIARFTGCKNFVGNRKKFIVNVFIDLKPVERFENM* |
| JGI24668J20090_100531763 | 3300001734 | Marine Gutless Worms Symbiont | IVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERCENGSDM* |
| JGI24668J20090_100707333 | 3300001734 | Marine Gutless Worms Symbiont | LNKDQIVKIARLTGCKNFVGKRKFIFNAFVDLKPVETFKNGSDM* |
| JGI24668J20090_100978062 | 3300001734 | Marine Gutless Worms Symbiont | LNIYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVKRFENGSDM* |
| JGI24668J20090_101295071 | 3300001734 | Marine Gutless Worms Symbiont | VGTARGLNKDQIVKIARLTGCKNFVGKKKKFIFNALVDLKPVERFENGSDM* |
| JGI24668J20090_101471952 | 3300001734 | Marine Gutless Worms Symbiont | CWRYRAACDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERSENGSDM* |
| JGI24668J20090_101514881 | 3300001734 | Marine Gutless Worms Symbiont | WARKGHNRRGAGTARELNRDQIVKIARLTGCKKFLGKRKKFIFNAFVDLKPVERFENGSDM* |
| JGI24668J20090_101641491 | 3300001734 | Marine Gutless Worms Symbiont | QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM* |
| JGI24668J20090_101786201 | 3300001734 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKKFVGKRKKFIFNAFVDLKPVERF* |
| JGI24668J20090_102010612 | 3300001734 | Marine Gutless Worms Symbiont | MRSGTVRGLNRDNIVKIAKLTGCKNFVGKRKKFIFNAFVDHKPVERFENGSDI* |
| JGI24668J20090_102051221 | 3300001734 | Marine Gutless Worms Symbiont | VRGLYRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSDNRSDM* |
| JGI24668J20090_102246091 | 3300001734 | Marine Gutless Worms Symbiont | ISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM* |
| JGI24668J20090_102585391 | 3300001734 | Marine Gutless Worms Symbiont | LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENGSDM* |
| JGI24671J20093_100558581 | 3300001741 | Marine Gutless Worms Symbiont | LNRDKIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENGSDM* |
| JGI24671J20093_101259133 | 3300001741 | Marine Gutless Worms Symbiont | LNRVQIVKIARLTGCKNFVGKRMKFTFNVFVDLKPVERFENGSDM* |
| JGI24671J20093_101413442 | 3300001741 | Marine Gutless Worms Symbiont | MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVDLKPVERLENGSDYVRI* |
| JGI24671J20093_102246342 | 3300001741 | Marine Gutless Worms Symbiont | RGLNRDQIVKIVRLTGCKNFVGKRKKFIFNVFVDLNPAERFKNGSDM* |
| JGI24673J20094_100357152 | 3300001742 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDLKPVERFDFENGSDM* |
| JGI24673J20094_101533002 | 3300001742 | Marine Gutless Worms Symbiont | GLNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM* |
| JGI24673J20094_101666861 | 3300001742 | Marine Gutless Worms Symbiont | LNRDQIVKIARLSGCRNSVGKIKKFIFNAFADLKPVERFENGSDM* |
| JGI24673J20094_101887933 | 3300001742 | Marine Gutless Worms Symbiont | RGLNKDQIVKIARLTGFKNFVGKRKKFRPILNAFVDLKPVERFDNGSDM* |
| JGI24673J20094_101996352 | 3300001742 | Marine Gutless Worms Symbiont | DQIVKIARLTGCKNFVSKKKKFIFNAFIDLKPVERFENGSDM* |
| JGI24673J20094_102100671 | 3300001742 | Marine Gutless Worms Symbiont | LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPVERLENWSDNNVRI* |
| JGI24673J20094_102270371 | 3300001742 | Marine Gutless Worms Symbiont | GLNRDQIVKXXRLTGCKNFVGKRKKFIFSAFVDLKPVERFENGSNH* |
| JGI24669J20092_100221431 | 3300001744 | Marine Gutless Worms Symbiont | MTRWLVGLNRDQIVKIARLTGCKNFVGKREKFIFNASVDLKPVERSENRSDM* |
| JGI24669J20092_100494132 | 3300001744 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERXENRSDM* |
| JGI24669J20092_100601792 | 3300001744 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM* |
| JGI24669J20092_100726601 | 3300001744 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGTDM* |
| JGI24669J20092_101438951 | 3300001744 | Marine Gutless Worms Symbiont | KIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET* |
| JGI24669J20092_101479942 | 3300001744 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFEDGWE* |
| JGI24672J20091_100221202 | 3300001746 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDFKPVERCDFENGSDM* |
| JGI24672J20091_100262623 | 3300001746 | Marine Gutless Worms Symbiont | TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM* |
| JGI24672J20091_100290181 | 3300001746 | Marine Gutless Worms Symbiont | IVKIARLTGCKNFVGKRKKFIFNAFVDLKPVLRSENRSDM* |
| JGI24672J20091_100417373 | 3300001746 | Marine Gutless Worms Symbiont | GTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN* |
| JGI24672J20091_100718061 | 3300001746 | Marine Gutless Worms Symbiont | LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPXERLENWSDNNVRI* |
| JGI24672J20091_101720532 | 3300001746 | Marine Gutless Worms Symbiont | ARGLNRDKIVKIVRLNGCKNFVGKRKFIFNAFMDLKPVERFENGSDM* |
| JGI24670J26820_112440581 | 3300002181 | Marine Gutless Worms Symbiont | AGTARGLNRDQIVKIARLTGCKNFVGKRKEFIFNAFVDLKPVERSENRSDM* |
| JGI24670J26820_112529921 | 3300002181 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDVKPVERFENRSDMCGFRSLNNST |
| JGI24670J26820_112828701 | 3300002181 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKKKKFIFNAFVDLKPVERFENGSDIVRI* |
| JGI24670J26820_113040631 | 3300002181 | Marine Gutless Worms Symbiont | RGLNRDHIVQIARLTGCKDFVGKRKKFVFNMFIDLKPVERFENGGDM* |
| JGI24670J26820_113729652 | 3300002181 | Marine Gutless Worms Symbiont | MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFSAFIDLKPVERFENGSDM* |
| JGI24670J26820_114178172 | 3300002181 | Marine Gutless Worms Symbiont | RKGDNR*GAGTARGLNRDEIVKIARLTGCQNFIGRSLYSMRSFNFVDLKPVERSENGSDMICEV* |
| JGI24670J26820_114377092 | 3300002181 | Marine Gutless Worms Symbiont | KIARLTGCKNFVGKRKFIFNAFVDLKPVEKFENGSDM* |
| JGI24670J26820_114652472 | 3300002181 | Marine Gutless Worms Symbiont | MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVHLKPVERLENGSDYVRI* |
| JGI24670J26820_114671663 | 3300002181 | Marine Gutless Worms Symbiont | ARLTGCKNFVGKRKKFIFNVFVNLKPVERFENGSDM* |
| JGI24670J26820_114739091 | 3300002181 | Marine Gutless Worms Symbiont | LNRDKIVKIVRLNGCKNFVGKRKFIFNAFMDLKPVERFENGSDM |
| JGI24670J26820_114876982 | 3300002181 | Marine Gutless Worms Symbiont | AGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNSFVDLKPLERFENGSDM* |
| JGI24670J26820_114926422 | 3300002181 | Marine Gutless Worms Symbiont | LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPMERLENWSDNNVRI* |
| JGI24670J26820_115091331 | 3300002181 | Marine Gutless Worms Symbiont | NRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM* |
| JGI24670J26820_115407602 | 3300002181 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERFENGGDM* |
| JGI24670J26820_116098672 | 3300002181 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCENFVGKRKKFIFNAFVDLKPVERFENGSDM* |
| JGI24670J26820_116177754 | 3300002181 | Marine Gutless Worms Symbiont | MMSGYCEGLDRDQIVKIAGLTGCKNFVGKRKKFIFNAFVDLKPVERFGNRSDM* |
| Ga0056138_10070361 | 3300003801 | Marine Gutless Worms Symbiont | VGTARGLNKDQIVKIARLTGCKNFVGKRKKFIFNALVDLKPVERFENGSDM* |
| Ga0056138_10144741 | 3300003801 | Marine Gutless Worms Symbiont | MRSGYCVGLNRDQVVKIARLTGCKNFVGKRKKFIFNAFVDLTPVEKIENGSDM* |
| Ga0056138_10688612 | 3300003801 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKKFLGKRKKFIFNAFVDLKPVERFENGSDM* |
| Ga0056137_10190212 | 3300003829 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCTNSVGKRKKFIFNEFVDLKLVERFENANDM* |
| Ga0065184_100487322 | 3300004098 | Marine Gutless Worms Symbiont | IVKIARLTGCKNFVGKRKKFLFSAFVDVKPVERVENGSDM* |
| Ga0065184_100554661 | 3300004098 | Marine Gutless Worms Symbiont | GTARGLNRDQIVKIARSTGFKNLVGKRNKFVLNAFVDLKPVERFENGSHTARI* |
| Ga0065184_100849751 | 3300004098 | Marine Gutless Worms Symbiont | TARGLNRDQIVKVARLTGCKNFVCKRKKFIFDAFVDLKPVESLHVNACS* |
| Ga0065184_100927101 | 3300004098 | Marine Gutless Worms Symbiont | VTTGAGTARGLKRDQVVNIATLSDSKNFVCKRKKFIINAFVDLKPVERFENGSDMS |
| Ga0065184_102307841 | 3300004098 | Marine Gutless Worms Symbiont | RLKRDKIVKIARLSGCKNFARESQKFIFHAFVDLWPVERFVHCK* |
| Ga0065184_102436482 | 3300004098 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM* |
| Ga0065185_101877971 | 3300004122 | Marine Gutless Worms Symbiont | MRRWARKGNNRAGTARGLNKDQIAKIAGFTGCKNFVGKRKKFIFNAFIDFKPVERFENGSDM* |
| Ga0065185_103396652 | 3300004122 | Marine Gutless Worms Symbiont | LKVNQIVKTVRLPGCNNLVGRRKKFIFNVFVDLKPVERFENGSDMCRF |
| Ga0209145_12537761 | 3300027500 | Marine Gutless Worms Symbiont | RDQIVKIARLTSCKNFVGKRKKFIFNAFVDLKPVEKSENRSDR |
| Ga0209791_10026436 | 3300027540 | Marine Gutless Worms Symbiont | VLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRSDM |
| Ga0209791_10120262 | 3300027540 | Marine Gutless Worms Symbiont | VRGLNRDQIVKIARLTGCKNFVGKRKKFIFNVFTDLKPVERFENWSDM |
| Ga0209791_10261232 | 3300027540 | Marine Gutless Worms Symbiont | GLNRDQIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209791_10314071 | 3300027540 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKNFVSKRKKFIFDEFVDLKPVERSENGSDM |
| Ga0209791_10785942 | 3300027540 | Marine Gutless Worms Symbiont | VGTARGLNKDQIVKIARLTGCKNFVGKRKKFIFNALVDLKPVERFENGSDM |
| Ga0209791_10882982 | 3300027540 | Marine Gutless Worms Symbiont | VNRDQIVKIARLTGCKNFLGRRTKFIFNAFVDLKPVERSENRSDM |
| Ga0209791_11563421 | 3300027540 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM |
| Ga0209791_12108522 | 3300027540 | Marine Gutless Worms Symbiont | TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN |
| Ga0209791_12634821 | 3300027540 | Marine Gutless Worms Symbiont | MRSGYCEGVEMNRDQIVKTARLTGCKNFIGKRKKFIFNAFVDLKPVERSENRSDMRGFRSLNNSTSK |
| Ga0209791_12928721 | 3300027540 | Marine Gutless Worms Symbiont | VRGLNRDQIVKIARSIGCKNFVGKRKKFIFNAFTDLKPVQISENGSDM |
| Ga0209791_13099252 | 3300027540 | Marine Gutless Worms Symbiont | MRSGYCEGLKRDQVVKIARQTGYKNFVGKRKKFIFNTFVDLKPVERFQNGSDM |
| Ga0209791_13495062 | 3300027540 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET |
| Ga0209791_13787221 | 3300027540 | Marine Gutless Worms Symbiont | MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVDLKPVERLENGSDYVRI |
| Ga0209791_13928531 | 3300027540 | Marine Gutless Worms Symbiont | GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAYVDLKPVERSEHRSDIVRI |
| Ga0209338_10009905 | 3300027551 | Marine Gutless Worms Symbiont | MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFSAFIDLKPVERFENGSDM |
| Ga0209338_10108874 | 3300027551 | Marine Gutless Worms Symbiont | MRSGTVRGLNRDNIVKIAKLTGCKNFVGKRKKFIFNAFVDHKPVERFENGSDI |
| Ga0209338_10180835 | 3300027551 | Marine Gutless Worms Symbiont | MGTSRGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV |
| Ga0209338_10303114 | 3300027551 | Marine Gutless Worms Symbiont | NRDQTVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERSENRSDM |
| Ga0209338_10409483 | 3300027551 | Marine Gutless Worms Symbiont | QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRFENRSDM |
| Ga0209338_10435591 | 3300027551 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKKFVGKRKKFIFNAFVDLKPVETGEIGEWE |
| Ga0209338_10474152 | 3300027551 | Marine Gutless Worms Symbiont | MRRWARKGNNRAGTARGLNKDQIAKIAGFTGCKNFVGKRKKFIFNAFIDFKPVERFENGSDM |
| Ga0209338_10889732 | 3300027551 | Marine Gutless Worms Symbiont | VRGLHRDQIVKIARLTGCKNFVGKRQQLIFNTFTDLMPMERFET |
| Ga0209338_11434381 | 3300027551 | Marine Gutless Worms Symbiont | RGLNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM |
| Ga0209338_11590981 | 3300027551 | Marine Gutless Worms Symbiont | VRGLNRDQIVKIARLTGCKNFVGKRKKFVLNVFVDLKPVARFENRSDM |
| Ga0209338_11652141 | 3300027551 | Marine Gutless Worms Symbiont | GTAMGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSYVRI |
| Ga0209338_11663571 | 3300027551 | Marine Gutless Worms Symbiont | MKSGTARALNTDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFEDGV |
| Ga0209338_12176782 | 3300027551 | Marine Gutless Worms Symbiont | LNRDEIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENRGDM |
| Ga0209338_12791531 | 3300027551 | Marine Gutless Worms Symbiont | QIVKIARLTGCKNFVGTGNKKKFWPIFNAFVDLKPVERFENGSDI |
| Ga0209338_13022182 | 3300027551 | Marine Gutless Worms Symbiont | TARGLNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209338_13023691 | 3300027551 | Marine Gutless Worms Symbiont | NRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM |
| Ga0209338_13031882 | 3300027551 | Marine Gutless Worms Symbiont | VRGLKIDQTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM |
| Ga0209338_13048131 | 3300027551 | Marine Gutless Worms Symbiont | VKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM |
| Ga0209338_13338562 | 3300027551 | Marine Gutless Worms Symbiont | LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPMERLENWSDNNVRI |
| Ga0209338_13976022 | 3300027551 | Marine Gutless Worms Symbiont | VKIARLTGFKNFVGQRKKFIFNAFVDLKPVERFENWSDM |
| Ga0209743_10128531 | 3300027556 | Marine Gutless Worms Symbiont | ARRLKRDKIVKIARLSGCKNFARESQKFIFHAFVDLWPVERFVHCK |
| Ga0209743_10152171 | 3300027556 | Marine Gutless Worms Symbiont | LRGRGGLNRDQIVKIAKLTGCKNFVGKRKKFIFNAFIDLKSVERFENASDM |
| Ga0209743_10210903 | 3300027556 | Marine Gutless Worms Symbiont | MRSRYCEGIEQDYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209743_10654161 | 3300027556 | Marine Gutless Worms Symbiont | RGLNRDQIVKIARLTGCKNFEGKRKKFIFNAFVDLKPVLRSENRSDM |
| Ga0209743_11024471 | 3300027556 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKFIYNVFVDLKPVE |
| Ga0209743_11363742 | 3300027556 | Marine Gutless Worms Symbiont | LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDNYVRI |
| Ga0209743_11414502 | 3300027556 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDFKPVERCDFENGSDM |
| Ga0209743_11969701 | 3300027556 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFELE |
| Ga0209743_13088732 | 3300027556 | Marine Gutless Worms Symbiont | MKSGYCEGVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERFENGSDM |
| Ga0209743_13144801 | 3300027556 | Marine Gutless Worms Symbiont | ARRLNRDQIVKIARLTGCKNFVGKIKKFIFNAFVDLKPVERLE |
| Ga0209743_14045542 | 3300027556 | Marine Gutless Worms Symbiont | GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFVFNAFVDLKPLERFKNRSDM |
| Ga0209679_12079391 | 3300027557 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRS |
| Ga0209428_10392463 | 3300027564 | Marine Gutless Worms Symbiont | TARGLNRDQIVKIARLTSCKNFVGKRKKFIFNAFVDLKPVERSENRSDM |
| Ga0209428_10982821 | 3300027564 | Marine Gutless Worms Symbiont | QTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNESDM |
| Ga0209428_11274691 | 3300027564 | Marine Gutless Worms Symbiont | MRRVLNRDQIVKISRCTGCKNFVGKRKKFIFNAFIDLKLVERFENGSDM |
| Ga0209428_11646722 | 3300027564 | Marine Gutless Worms Symbiont | VGTARGLNRDQTVKIARLTGCKNNVGKRKKFIFNAFVDLKPVERSENRSDM |
| Ga0209428_11656882 | 3300027564 | Marine Gutless Worms Symbiont | LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDFKPVERFENRSDM |
| Ga0209428_12067141 | 3300027564 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209428_12118542 | 3300027564 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM |
| Ga0209428_12704841 | 3300027564 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209428_12831221 | 3300027564 | Marine Gutless Worms Symbiont | IVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM |
| Ga0209428_13643211 | 3300027564 | Marine Gutless Worms Symbiont | QPMRSGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV |
| Ga0209428_13972181 | 3300027564 | Marine Gutless Worms Symbiont | LNRDQIVKTARLSGCKNFVGKRKKFVFNAFVDLKPVERIGVICE |
| Ga0209637_10275702 | 3300027584 | Marine Gutless Worms Symbiont | VLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM |
| Ga0209637_10782242 | 3300027584 | Marine Gutless Worms Symbiont | MRSGSCEGVENRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGNDM |
| Ga0209637_10913712 | 3300027584 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGYKNFVGKRKKFIFNAFIDLKPVERFENGSDI |
| Ga0209637_11053031 | 3300027584 | Marine Gutless Worms Symbiont | MSQLAYSFRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVEIFENGSDV |
| Ga0209637_11084961 | 3300027584 | Marine Gutless Worms Symbiont | ARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM |
| Ga0209637_11107592 | 3300027584 | Marine Gutless Worms Symbiont | ARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRSENRSDRPM |
| Ga0209637_11381312 | 3300027584 | Marine Gutless Worms Symbiont | LNKDQIVKIARLTGFKNFVGKRKKFRPILNAFVDLKPVERFDNGSDM |
| Ga0209637_11429472 | 3300027584 | Marine Gutless Worms Symbiont | ARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVNLKPVERSENRSDM |
| Ga0209637_11888801 | 3300027584 | Marine Gutless Worms Symbiont | TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM |
| Ga0209637_11932992 | 3300027584 | Marine Gutless Worms Symbiont | GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFADLKPVERFENRSDM |
| Ga0209637_12086462 | 3300027584 | Marine Gutless Worms Symbiont | LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPVERLENWSDNNVRI |
| Ga0209637_12700331 | 3300027584 | Marine Gutless Worms Symbiont | LKRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPAQRRGVVS |
| Ga0209637_12708542 | 3300027584 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSLQLIEVCTL |
| Ga0209637_12744291 | 3300027584 | Marine Gutless Worms Symbiont | GTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM |
| Ga0209637_13065292 | 3300027584 | Marine Gutless Worms Symbiont | LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDM |
| Ga0209637_13100452 | 3300027584 | Marine Gutless Worms Symbiont | LNRDKIVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERSENRSDM |
| Ga0209637_13214561 | 3300027584 | Marine Gutless Worms Symbiont | DQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDVKI |
| Ga0209637_13609652 | 3300027584 | Marine Gutless Worms Symbiont | MGLNRDQIVKIARLTGCKNFVSKKKKFIFNAFIDLKPVERFENGSDM |
| Ga0209637_13817382 | 3300027584 | Marine Gutless Worms Symbiont | RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSGNGSDM |
| Ga0209637_14085031 | 3300027584 | Marine Gutless Worms Symbiont | VGTARGLNRDQTVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERSEYRSDM |
| Ga0209150_10040333 | 3300027585 | Marine Gutless Worms Symbiont | LNRDHTVKIARLTGCKNFAGKRKKFIFNAFIDLKPVERFENGSDM |
| Ga0209150_10157062 | 3300027585 | Marine Gutless Worms Symbiont | VLNRDEIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRSDM |
| Ga0209150_10234432 | 3300027585 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM |
| Ga0209150_10278303 | 3300027585 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFSVFIDLKLVERFENRSDM |
| Ga0209150_10856331 | 3300027585 | Marine Gutless Worms Symbiont | IARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM |
| Ga0209150_11851001 | 3300027585 | Marine Gutless Worms Symbiont | VRGLNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERLENGGDNYVRIQQT |
| Ga0209150_12029941 | 3300027585 | Marine Gutless Worms Symbiont | VRGLNRDQIVKIVRLTGCKNFVGKRKKFIFNVFVDLNPAERFENGSDM |
| Ga0209150_12076691 | 3300027585 | Marine Gutless Worms Symbiont | QGGAGTAIGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEICECE |
| Ga0209150_12258271 | 3300027585 | Marine Gutless Worms Symbiont | RGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209150_12667501 | 3300027585 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTSCKNFVSKRKKFIFNAFVDLKPVERFENGSDT |
| Ga0209150_13159782 | 3300027585 | Marine Gutless Worms Symbiont | LSRDQIVKIARLTGCKNFVGKRKKFNAFVDLKPVERSENRSDM |
| Ga0209150_13224951 | 3300027585 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFEDGWE |
| Ga0209150_13511002 | 3300027585 | Marine Gutless Worms Symbiont | NRDEIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN |
| Ga0209150_13867621 | 3300027585 | Marine Gutless Worms Symbiont | IARLTGCKNFVGKRKKFIFNVFVDLKPVERFENGSDM |
| Ga0209150_13907942 | 3300027585 | Marine Gutless Worms Symbiont | LNRDQVVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM |
| Ga0209122_11030872 | 3300027613 | Marine Gutless Worms Symbiont | LNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209122_11961721 | 3300027613 | Marine Gutless Worms Symbiont | AATARGLNRDQTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNESDM |
| Ga0209122_12703812 | 3300027613 | Marine Gutless Worms Symbiont | MRSGYCDGVVMNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209122_13175201 | 3300027613 | Marine Gutless Worms Symbiont | VRGLKRDQIVKIARLTGYKNFIGKRQKFIFNAFVDLKPVERFENRSDM |
| Ga0209122_13177702 | 3300027613 | Marine Gutless Worms Symbiont | MRSGTASGLNRDQIVRIARLTGCKNFVGKRKKFIFNAFINLKPVERLENRSDM |
| Ga0209122_13522471 | 3300027613 | Marine Gutless Worms Symbiont | VEIDPQVAHGRGDRDQIVKIARLTGCKNFVGKRKKFIFNAFVERFENGSDM |
| Ga0209122_13556841 | 3300027613 | Marine Gutless Worms Symbiont | GAGTARGLNRDQIVKIARLTGCKNFVGNRKKFIFNAFVDLKPVERFENRSDM |
| Ga0209122_13618522 | 3300027613 | Marine Gutless Worms Symbiont | VGEKGVNRRGAGTANGLNEYQTVKIATLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSD |
| Ga0209122_13716122 | 3300027613 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFADLKPVERFENGSDM |
| Ga0209122_13904491 | 3300027613 | Marine Gutless Worms Symbiont | RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET |
| Ga0209122_14094272 | 3300027613 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVELKPVERFENRSDM |
| Ga0209122_14161801 | 3300027613 | Marine Gutless Worms Symbiont | KDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDM |
| Ga0209260_100146851 | 3300027620 | Marine Gutless Worms Symbiont | MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFNAFIDLKPVERFENGSDM |
| Ga0209260_100206011 | 3300027620 | Marine Gutless Worms Symbiont | IARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM |
| Ga0209260_100378621 | 3300027620 | Marine Gutless Worms Symbiont | GLNRDQIVKIARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM |
| Ga0209260_101009081 | 3300027620 | Marine Gutless Worms Symbiont | RLTGCKNFAGKRKKFIFNAFIDLKPVERFENGSDM |
| Ga0209260_102066202 | 3300027620 | Marine Gutless Worms Symbiont | TASGLNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDLKPVERFDFENGSDM |
| Ga0209149_10110961 | 3300027626 | Marine Gutless Worms Symbiont | GLNRDQIVIARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM |
| Ga0209149_10138431 | 3300027626 | Marine Gutless Worms Symbiont | MRSGYTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDL |
| Ga0209149_10178653 | 3300027626 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKKKKFIFNAFVDLKPVERFENGSDIVRI |
| Ga0209149_10226783 | 3300027626 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKNFEGKRKKFIFNAFVDLKPVLRSENRSDM |
| Ga0209149_10351471 | 3300027626 | Marine Gutless Worms Symbiont | VKIARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM |
| Ga0209149_10575652 | 3300027626 | Marine Gutless Worms Symbiont | MKSGTARALNTDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFEDGVIM |
| Ga0209149_10591221 | 3300027626 | Marine Gutless Worms Symbiont | MRSRYCEGLNRDQIVKIARLTGCKNFVGKREKFIFNASVDLKPVERSENRSDM |
| Ga0209149_10599174 | 3300027626 | Marine Gutless Worms Symbiont | VTFNEETVTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDV |
| Ga0209149_10641321 | 3300027626 | Marine Gutless Worms Symbiont | GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERSENRSDM |
| Ga0209149_10642251 | 3300027626 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIATLTGCKNFVSKRKKFIFDEFVDLKPVERSENGSDM |
| Ga0209149_10706921 | 3300027626 | Marine Gutless Worms Symbiont | LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM |
| Ga0209149_10887022 | 3300027626 | Marine Gutless Worms Symbiont | MRSGYCDGVVMNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENTSDM |
| Ga0209149_10957541 | 3300027626 | Marine Gutless Worms Symbiont | RGLNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209149_10994353 | 3300027626 | Marine Gutless Worms Symbiont | DQVVKIARLTGCKNFVGKRKKFMFNAFVDLKPVQRFENRSDM |
| Ga0209149_11260753 | 3300027626 | Marine Gutless Worms Symbiont | MMRGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNGNNM |
| Ga0209149_11269941 | 3300027626 | Marine Gutless Worms Symbiont | MRNGYCEGLNRDQIIKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSNM |
| Ga0209149_11326212 | 3300027626 | Marine Gutless Worms Symbiont | VNRDQIVKIARLTGCKNFLGRRTKFIFNAFVDLKTVERSENRSNM |
| Ga0209149_11382681 | 3300027626 | Marine Gutless Worms Symbiont | QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209149_11485122 | 3300027626 | Marine Gutless Worms Symbiont | GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM |
| Ga0209149_11574923 | 3300027626 | Marine Gutless Worms Symbiont | GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDISYLRI |
| Ga0209149_11602492 | 3300027626 | Marine Gutless Worms Symbiont | LNKDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVDRSENRSDM |
| Ga0209149_11603971 | 3300027626 | Marine Gutless Worms Symbiont | RGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSGNGSDM |
| Ga0209149_11909403 | 3300027626 | Marine Gutless Worms Symbiont | RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDVKI |
| Ga0209149_12142021 | 3300027626 | Marine Gutless Worms Symbiont | MRSGYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSEN |
| Ga0209149_12161763 | 3300027626 | Marine Gutless Worms Symbiont | VRGLNRDQIVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERFENGGDM |
| Ga0209149_12251272 | 3300027626 | Marine Gutless Worms Symbiont | TARGSNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRFENRSDM |
| Ga0209149_12384511 | 3300027626 | Marine Gutless Worms Symbiont | MRSGYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDT |
| Ga0209149_12684581 | 3300027626 | Marine Gutless Worms Symbiont | VGTARGLNKDRIVKIARLTGCKNFVGKRKKFIFNALVDLKPVEIFENGSDM |
| Ga0209149_13007351 | 3300027626 | Marine Gutless Worms Symbiont | MRSQYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFE |
| Ga0209149_13155901 | 3300027626 | Marine Gutless Worms Symbiont | RLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM |
| Ga0209149_13249202 | 3300027626 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV |
| Ga0209149_13486831 | 3300027626 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERSENRNDT |
| Ga0209339_10275705 | 3300027632 | Marine Gutless Worms Symbiont | KIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209339_10433881 | 3300027632 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV |
| Ga0209339_10622521 | 3300027632 | Marine Gutless Worms Symbiont | AGTASGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM |
| Ga0209339_10890711 | 3300027632 | Marine Gutless Worms Symbiont | LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERLENGGDNYVRIQQT |
| Ga0209339_10902171 | 3300027632 | Marine Gutless Worms Symbiont | LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDYVRI |
| Ga0209339_11184192 | 3300027632 | Marine Gutless Worms Symbiont | MMSGYCEGLDRDQIVKIAGLTGCKNFVGKRKKFIFNAFVDLKPVERFGNRSDM |
| Ga0209339_11529651 | 3300027632 | Marine Gutless Worms Symbiont | VGTARGLNRDQIVKISRLTVCKNVVGKRKKFIFNAFYDLKPVERSENRSDM |
| Ga0209339_11755212 | 3300027632 | Marine Gutless Worms Symbiont | RDQIVKIARLTGCKNFVGKRKKFIFNSFVDLKPLERFENGSDM |
| Ga0209339_11757041 | 3300027632 | Marine Gutless Worms Symbiont | GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM |
| Ga0209339_12183271 | 3300027632 | Marine Gutless Worms Symbiont | VNRDQIVKIARLTGCKNIVGKRKMFIFNAFVDLKPEERFEKRND |
| Ga0209339_12484712 | 3300027632 | Marine Gutless Worms Symbiont | LNRDQIVKIPVARLTGCKNFVGKRKKFIFNAFVDFKPVERFDNGSDM |
| Ga0209339_12985351 | 3300027632 | Marine Gutless Worms Symbiont | IVKIARLTGCKKFVGKRKKFIFNAFVDLKPVERFENGSDI |
| Ga0209339_13176222 | 3300027632 | Marine Gutless Worms Symbiont | GTARGLNRYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM |
| Ga0209339_13284151 | 3300027632 | Marine Gutless Worms Symbiont | NRDQIVKIAKLTGCKNFVGKREKFIFNAFVDLKPVERFENGSDM |
| Ga0209339_13774732 | 3300027632 | Marine Gutless Worms Symbiont | DQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNGNNM |
| Ga0209339_14187821 | 3300027632 | Marine Gutless Worms Symbiont | KDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDNYVRI |
| ⦗Top⦘ |