NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020793

Metagenome / Metatranscriptome Family F020793

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020793
Family Type Metagenome / Metatranscriptome
Number of Sequences 222
Average Sequence Length 166 residues
Representative Sequence MTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Number of Associated Samples 174
Number of Associated Scaffolds 222

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 23.41 %
% of genes near scaffold ends (potentially truncated) 53.15 %
% of genes from short scaffolds (< 2000 bps) 91.44 %
Associated GOLD sequencing projects 163
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (90.090 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(17.568 % of family members)
Environment Ontology (ENVO) Unclassified
(47.748 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(55.405 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 222 Family Scaffolds
PF01221Dynein_light 0.45



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.34 %
UnclassifiedrootN/A7.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001848|RCM47_1064047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella812Open in IMG/M
3300002408|B570J29032_109419386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300002835|B570J40625_100585059All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300003909|JGI26087J52781_1032878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella552Open in IMG/M
3300004112|Ga0065166_10097509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1063Open in IMG/M
3300004788|Ga0007742_10768651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella938Open in IMG/M
3300004788|Ga0007742_10793795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella904Open in IMG/M
3300004793|Ga0007760_11327794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea854Open in IMG/M
3300004794|Ga0007751_10755406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella595Open in IMG/M
3300004802|Ga0007801_10057883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1147Open in IMG/M
3300005662|Ga0078894_10394952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1250Open in IMG/M
3300005662|Ga0078894_10741277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella864Open in IMG/M
3300005662|Ga0078894_11029718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella707Open in IMG/M
3300005941|Ga0070743_10240694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila589Open in IMG/M
3300005987|Ga0075158_10630790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella585Open in IMG/M
3300005989|Ga0075154_10071985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2093Open in IMG/M
3300006037|Ga0075465_10033401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1055Open in IMG/M
3300006037|Ga0075465_10121703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila586Open in IMG/M
3300006164|Ga0075441_10109731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1055Open in IMG/M
3300006164|Ga0075441_10197377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300006165|Ga0075443_10299414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila590Open in IMG/M
3300006357|Ga0075502_1622582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea938Open in IMG/M
3300006372|Ga0075489_1285269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila610Open in IMG/M
3300006375|Ga0075490_1277772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella775Open in IMG/M
3300006392|Ga0075507_1531037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea768Open in IMG/M
3300006393|Ga0075517_1575004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella591Open in IMG/M
3300006394|Ga0075492_1512777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea833Open in IMG/M
3300006396|Ga0075493_1538181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea708Open in IMG/M
3300006397|Ga0075488_1529023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella907Open in IMG/M
3300006401|Ga0075506_1729268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea945Open in IMG/M
3300006401|Ga0075506_1772108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia636Open in IMG/M
3300006403|Ga0075514_1634501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia618Open in IMG/M
3300006415|Ga0099654_10284844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea923Open in IMG/M
3300006571|Ga0075505_1459845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila582Open in IMG/M
3300006803|Ga0075467_10219762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1046Open in IMG/M
3300006803|Ga0075467_10394314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea722Open in IMG/M
3300006805|Ga0075464_10509099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella737Open in IMG/M
3300007304|Ga0102689_1791292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella574Open in IMG/M
3300007543|Ga0102853_1084559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella584Open in IMG/M
3300007561|Ga0102914_1053106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1273Open in IMG/M
3300007561|Ga0102914_1124333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea801Open in IMG/M
3300007600|Ga0102920_1225733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella602Open in IMG/M
3300007670|Ga0102862_1128788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella642Open in IMG/M
3300008055|Ga0108970_11742464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella531Open in IMG/M
3300008117|Ga0114351_1395993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia590Open in IMG/M
3300008999|Ga0102816_1136853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea756Open in IMG/M
3300009001|Ga0102963_1219912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella755Open in IMG/M
3300009130|Ga0118729_1150801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1046Open in IMG/M
3300009159|Ga0114978_10256249All Organisms → Viruses → Predicted Viral1085Open in IMG/M
3300009182|Ga0114959_10476385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella604Open in IMG/M
3300009263|Ga0103872_1037299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella673Open in IMG/M
3300009433|Ga0115545_1099910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1051Open in IMG/M
3300009543|Ga0115099_10308017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300009543|Ga0115099_10757691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella703Open in IMG/M
3300009599|Ga0115103_1457384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella510Open in IMG/M
3300009599|Ga0115103_1658667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea931Open in IMG/M
3300009606|Ga0115102_10776767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300009677|Ga0115104_10671304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1021Open in IMG/M
3300009677|Ga0115104_10770188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella618Open in IMG/M
3300010305|Ga0129320_130736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella527Open in IMG/M
3300010307|Ga0129319_1043230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella588Open in IMG/M
3300010885|Ga0133913_12814800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1171Open in IMG/M
3300011009|Ga0129318_10140333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella728Open in IMG/M
3300011995|Ga0153800_1017962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella716Open in IMG/M
3300012012|Ga0153799_1092588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella539Open in IMG/M
3300012518|Ga0129349_1058058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea920Open in IMG/M
3300012523|Ga0129350_1092451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea932Open in IMG/M
3300012523|Ga0129350_1346224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella770Open in IMG/M
3300012528|Ga0129352_10283355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella578Open in IMG/M
3300012707|Ga0157623_1222318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella689Open in IMG/M
3300012725|Ga0157610_1211901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella636Open in IMG/M
3300012725|Ga0157610_1237612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella636Open in IMG/M
3300012726|Ga0157597_1003615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella553Open in IMG/M
3300012731|Ga0157616_1203953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella506Open in IMG/M
3300012734|Ga0157615_1072594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella587Open in IMG/M
3300012734|Ga0157615_1224590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea863Open in IMG/M
3300012756|Ga0138272_1014022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella847Open in IMG/M
3300012782|Ga0138268_1285523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella885Open in IMG/M
3300012782|Ga0138268_1715637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella541Open in IMG/M
3300012953|Ga0163179_10497706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1007Open in IMG/M
3300012953|Ga0163179_10728615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea844Open in IMG/M
3300012962|Ga0129335_1088673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella925Open in IMG/M
3300012965|Ga0129346_1202477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella567Open in IMG/M
3300012970|Ga0129338_1363966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella908Open in IMG/M
3300013004|Ga0164293_11006734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella520Open in IMG/M
3300013005|Ga0164292_10472892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella825Open in IMG/M
3300013014|Ga0164295_11059114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella629Open in IMG/M
3300013295|Ga0170791_12039880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella691Open in IMG/M
3300013295|Ga0170791_12528564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella964Open in IMG/M
3300013295|Ga0170791_14793625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea732Open in IMG/M
3300013372|Ga0177922_10383376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella576Open in IMG/M
3300016726|Ga0182045_1261935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella560Open in IMG/M
3300016742|Ga0182052_1256137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea828Open in IMG/M
3300016758|Ga0182070_1364995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300016776|Ga0182046_1104968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300017788|Ga0169931_10107181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella2657Open in IMG/M
3300017949|Ga0181584_10301273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1025Open in IMG/M
3300018413|Ga0181560_10334811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella703Open in IMG/M
3300018420|Ga0181563_10257889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1036Open in IMG/M
3300018565|Ga0188826_119885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella540Open in IMG/M
3300018684|Ga0192983_1014202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1009Open in IMG/M
3300018780|Ga0193472_1021439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea707Open in IMG/M
3300018782|Ga0192832_1062064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella519Open in IMG/M
3300018846|Ga0193253_1073269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea832Open in IMG/M
3300018848|Ga0192970_1032729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella974Open in IMG/M
3300018871|Ga0192978_1053072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella759Open in IMG/M
3300018871|Ga0192978_1103603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea511Open in IMG/M
3300018926|Ga0192989_10103854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300018926|Ga0192989_10144495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella578Open in IMG/M
3300018980|Ga0192961_10078168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea988Open in IMG/M
3300018980|Ga0192961_10078521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea986Open in IMG/M
3300018982|Ga0192947_10107550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea926Open in IMG/M
3300018989|Ga0193030_10066568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1025Open in IMG/M
3300019033|Ga0193037_10348822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella523Open in IMG/M
3300019048|Ga0192981_10113146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1067Open in IMG/M
3300019048|Ga0192981_10164580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea875Open in IMG/M
3300019123|Ga0192980_1066934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella672Open in IMG/M
3300019123|Ga0192980_1071374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella645Open in IMG/M
3300019149|Ga0188870_10132489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella577Open in IMG/M
3300019277|Ga0182081_1349294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea857Open in IMG/M
3300019459|Ga0181562_10402895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella661Open in IMG/M
3300020014|Ga0182044_1255264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella566Open in IMG/M
3300020014|Ga0182044_1256528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella500Open in IMG/M
3300020183|Ga0194115_10091232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1730Open in IMG/M
3300020205|Ga0211731_11505202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella582Open in IMG/M
3300021108|Ga0214162_1013650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1486Open in IMG/M
3300021140|Ga0214168_1082571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella708Open in IMG/M
3300021169|Ga0206687_1753195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea935Open in IMG/M
3300021303|Ga0210308_1079022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella537Open in IMG/M
3300021342|Ga0206691_1777174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella582Open in IMG/M
3300021350|Ga0206692_1483471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea945Open in IMG/M
3300021350|Ga0206692_1720681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea713Open in IMG/M
3300021353|Ga0206693_1303076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella772Open in IMG/M
3300021355|Ga0206690_10193430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella615Open in IMG/M
3300021872|Ga0063132_129744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella881Open in IMG/M
3300021898|Ga0063097_1024009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella949Open in IMG/M
3300021898|Ga0063097_1037767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea953Open in IMG/M
3300021910|Ga0063100_1048966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella863Open in IMG/M
3300021911|Ga0063106_1058386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea934Open in IMG/M
3300021913|Ga0063104_1088552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella652Open in IMG/M
3300021921|Ga0063870_1038598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella795Open in IMG/M
3300021925|Ga0063096_1052699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella714Open in IMG/M
3300021927|Ga0063103_1102013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea890Open in IMG/M
3300021941|Ga0063102_1060474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella961Open in IMG/M
3300022369|Ga0210310_1017919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300022375|Ga0210313_1044821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella529Open in IMG/M
3300025138|Ga0209634_1116380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1149Open in IMG/M
3300025399|Ga0208107_1029502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea947Open in IMG/M
3300025451|Ga0208426_1017756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1055Open in IMG/M
3300025451|Ga0208426_1057577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella599Open in IMG/M
3300025591|Ga0208496_1040253All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300025887|Ga0208544_10140300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1046Open in IMG/M
3300025896|Ga0208916_10135027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1056Open in IMG/M
3300027571|Ga0208897_1142789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella595Open in IMG/M
3300027714|Ga0209815_1185480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella648Open in IMG/M
3300027736|Ga0209190_1137395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1075Open in IMG/M
3300027769|Ga0209770_10310349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300027771|Ga0209279_10172269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea637Open in IMG/M
3300027771|Ga0209279_10204007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella590Open in IMG/M
3300027782|Ga0209500_10168452All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300027797|Ga0209107_10221643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea923Open in IMG/M
3300027885|Ga0209450_10358459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1060Open in IMG/M
3300027885|Ga0209450_10869925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella646Open in IMG/M
3300028286|Ga0256331_1157729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella513Open in IMG/M
3300028329|Ga0210315_1020059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300030591|Ga0247626_1181842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella593Open in IMG/M
3300030610|Ga0247613_10181239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella722Open in IMG/M
3300030653|Ga0307402_10360731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea835Open in IMG/M
3300030670|Ga0307401_10194496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea914Open in IMG/M
3300030671|Ga0307403_10245820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea944Open in IMG/M
3300030709|Ga0307400_10349703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella938Open in IMG/M
3300030788|Ga0073964_11454718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea927Open in IMG/M
3300030856|Ga0073990_11811591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella864Open in IMG/M
3300030869|Ga0151492_1015499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea921Open in IMG/M
3300031005|Ga0073974_1782722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea884Open in IMG/M
3300031036|Ga0073978_1508324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella526Open in IMG/M
3300031036|Ga0073978_1635453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea921Open in IMG/M
3300031445|Ga0073952_11364959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea901Open in IMG/M
3300031710|Ga0307386_10221248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella922Open in IMG/M
3300031710|Ga0307386_10228154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella910Open in IMG/M
3300031710|Ga0307386_10428929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella683Open in IMG/M
3300031725|Ga0307381_10096483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea967Open in IMG/M
3300031725|Ga0307381_10409442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella501Open in IMG/M
3300031729|Ga0307391_10243843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea960Open in IMG/M
3300031738|Ga0307384_10154573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella987Open in IMG/M
3300031738|Ga0307384_10157150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella980Open in IMG/M
3300031738|Ga0307384_10318121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea713Open in IMG/M
3300031738|Ga0307384_10525970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella561Open in IMG/M
3300031739|Ga0307383_10292341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea787Open in IMG/M
3300031758|Ga0315907_10587553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella866Open in IMG/M
3300031784|Ga0315899_10833466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella840Open in IMG/M
3300031951|Ga0315904_11475766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella502Open in IMG/M
3300031963|Ga0315901_10767325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella704Open in IMG/M
3300032093|Ga0315902_10919413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella670Open in IMG/M
3300032708|Ga0314669_10416865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300032708|Ga0314669_10464401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella696Open in IMG/M
3300033572|Ga0307390_10522923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea735Open in IMG/M
3300033572|Ga0307390_10929884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella550Open in IMG/M
3300033978|Ga0334977_0388834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella653Open in IMG/M
3300033984|Ga0334989_0216528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1047Open in IMG/M
3300033984|Ga0334989_0344654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea781Open in IMG/M
3300033995|Ga0335003_0167113All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300034019|Ga0334998_0780058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella502Open in IMG/M
3300034096|Ga0335025_0223889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1046Open in IMG/M
3300034355|Ga0335039_0476061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella629Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.57%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.12%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater8.11%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.41%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.96%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.96%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.15%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.35%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.90%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.90%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.90%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.90%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.90%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.90%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.45%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.45%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.45%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.45%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.45%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.45%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.45%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.45%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.45%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.45%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.45%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.45%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.45%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001848Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3aEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006372Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010305Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010307Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012734Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016758Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021140Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025399Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025591Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028286Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030610Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030869Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_S_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
RCM47_106404723300001848Marine PlanktonMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
B570J29032_10941938623300002408FreshwaterMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTK
B570J40625_10058505923300002835FreshwaterMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
JGI26087J52781_103287813300003909MarineQMCAANSSAEACFNDKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDYNKGRSVSDLKLKTWDYGKAHNMRSDSLWQDDRYNPTKYSHPHRFDNVNFPEQEFKDFFGGTVGTAEAAEYERHTLSMDGTSQAMHAHRAEKRMAKLRDAVKTVDDLNKQE*
Ga0065166_1009750933300004112Freshwater LakeMKNSKYMTLRPNFIPRGCYKEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDFFGGTKGTAEAAEYEANRLSITSGSS*
Ga0007742_1076865113300004788Freshwater LakeMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
Ga0007742_1079379513300004788Freshwater LakeMTLRPNFIPRGCYKEIRSYQMCKSKASEDACFADKISIMEVCPDHVLDALREKKKWYLRAEMIDNDTYKRAMSVSDFNKDRSVSDLKLKTWDYGKTANLRSDSLWQDDRWDPTKFSHPHRNDNVNFPD*
Ga0007760_1132779423300004793Freshwater LakeMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0007751_1075540613300004794Freshwater LakeRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDFFGGTKGTAEAAEYEANRLSITSGSS*
Ga0007801_1005788313300004802FreshwaterMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKHSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
Ga0078894_1039495223300005662Freshwater LakeMTLRPNFIPRGCYKEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDFFGGTKGTAEAAEYEANRLSITSGSS*
Ga0078894_1074127713300005662Freshwater LakeMTLRPNFIPRGCIKEIRTYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSSG
Ga0078894_1102971813300005662Freshwater LakeGNCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCASKKGTDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDYNKGKSVSDLTLKTWEYGKGGNLRSDSLWQDDRYNPTKFSHPHRNDNTNFPEQEYKDIFGGTKGTAE*
Ga0070743_1024069413300005941EstuarineSKYMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFTQKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK*
Ga0075158_1063079013300005987Wastewater EffluentMTLTPSFIPRGCYKEIRKYQLCSSKNGKEACLNDKLSIMEVCPEHVLEGLREKKKWHLRAEVIDNDTYKRAMQVSDYNRGRSVTDLKLKTWEHGKAGHLRSDTYWQDDRYDPVKYPHNHRYDNVNFPDQEYRDIFGGTLGQYEQKE*
Ga0075154_1007198533300005989Wastewater EffluentMTLTPSFIPRGCYKEIRKYQLCSSKNGKEACLNDKLSIMEVCPEHVLEGLREKKKWHLRAEVIDNDTYKRAMQVSDYNRGRSVTDLKLKTWEHGKAGYLRSDTYWQDDRYDPVKYPHNHRYDNVNFPDQEYRDIFGGTLGQYEQKE*
Ga0075465_1003340123300006037AqueousMKNSKFMTLRPNFIPRGCYKEIRSYQLCVAKSSADACFADKISIMEVCPDHVLELLREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLQLKTWDYGKTANMRSDSLWQDDRWLPTKHSHPHRYDNVNFAEQEYMDFFGGTKGTAETEEYARNKIGVLSDTSQAIR*
Ga0075465_1012170313300006037AqueousQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
Ga0075441_1010973113300006164MarineMSLRPSFIPRGCFKEIRSYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQH*
Ga0075441_1019737713300006164MarineMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDATSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNVERSVTDLKLKTWDYGKAANLSSDSLWQDDRYDPTKYSHPHRYDNVNFPAQEYNDFFGGTKGEAEAKEYEKNTLGLMDGSSVAIRQA*
Ga0075443_1029941413300006165MarineAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQH*
Ga0075502_162258223300006357AqueousMTLKHNLIPRGCYKEIRAYQHCVARSSKDECFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMQVSDFNKDRSVSDLKLKTWDYGKTRNLRTDTLWQDDRYNPLKYSHPHRYDNINFPEQEYTDFFGGTRGDAEMADYEDNRLGMFDQTSKAMRDHQSEKRKLRFVVEEVKDLNEKKE*
Ga0075489_128526913300006372AqueousMTLRPNFIPRGCYKEIRSYQMCKSKASEDACFADKISIMEVCPDHVLDALREKKKWYLRAEMIDNDTYKRAMSVSDFNKDRSVSDLKLKTWDYGKTANMRSDSLWQDDRWLPTKHSHPHRYDNVNFAEQEYMDFFGGTKGTAETEEYARNKIGVLSDTSQAIR*
Ga0075490_127777223300006375AqueousMKNSKFMTLRPNFIPRGCYKEIRSYQLCVAKSSADACFADKISIMEVCPDHVLELLREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLQLKTWDYGKTANMRSDSLWQDDRWLPTKHSHPHRYDNVNFAEQEYMDFFGGTKGTAETEE
Ga0075507_153103713300006392AqueousMTLKHNLIPRGCYKEIRAYQHCVARSSKDECFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMQVSDFNKDRSVSDLQLKTWDYGKTRNLRTDTLWQDDRYNPLKYSHPHRYDNINFPEQEYTDFFGGTRGDAEM
Ga0075517_157500413300006393AqueousNSPIGKNSKYMGIVRDMVPRGCRREIEKYTACKKDSGADKCFDQKISIMEVCPDHILEGLRENRKWMLRAEVIDNETYRRAMEVSDYNRGRSVSDLKLKTWEYGMAQNLRSDSLYQDDRYHPNKFSHPHRKDAHSFPEQEYSDFFGGTVGTA*
Ga0075492_151277723300006394AqueousMKTSKYMTLRPSYIPRGCYKEIRKYQQCAAKSSAEACFSDKISIMEVCPDHVLAGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWEYGKACNLRSDSLFQDDRYNPTKYSHPHRMDNVNFPEQEYKDFFGGTEGTAEVAEYEKHRLNLVDGQSTAINQHMAEKRKNKLKDVVG
Ga0075493_153818113300006396AqueousMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVTDLKLKTWDYGKTANLRSDGMWQDDRWDPTVNSHPHRYDNVNFPEQEYRDFFGGTIGTAESEEYERNRLDMSGNSNAIRQHQSQKRMNKLKGVVAEVKDLNEKSE*
Ga0075488_152902323300006397AqueousMKSSKYMTLQPNYIPRGCYKEIRKYQMCHSKNGKDACFNDKISIMEVCPDHILEGLHEKKKWMLRAELIDNETYKRAMTVSDYNKGRSVSDLKLKTWDYGKGANLRSDTLYQDDRYNPTKYSHPHRYDNVNFPEQEYRDFFGGTVGESEAAEYQKHKL*
Ga0075506_172926823300006401AqueousMTLKHNLIPRGCYKEIRAYQHCVARSSKDECFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMQVSDFNKDRSVSDLQLKTWDYGKTRNLRTDTLWQDDRYNPLKYSHPHRYDNINFPEQEYTDFFGGTRGDAEMADYEDNRLGMFDQTSKAMRDHQSEKRKLRFVVEEVKDLNEKKE*
Ga0075506_177210813300006401AqueousRGCRREIEKYTACKKDSGADKCFDQKISIMEVCPDHILEGLRENRKWMLRAEVIDNETYRRAMEVSDYNRGRSVSDLKLKTWEYGMAQNLRSDSLYQDDRYHPNKFSHPHRKDAHSFPEQEYSDFFGGTVGTA*
Ga0075514_163450113300006403AqueousRKQKTLGAKQGGFNSPIGKNSKYMGIVRDMVPRGCRREIEKYTACKKDSGADKCFDQKISIMEVCPDHILEGLRENRKWMLRAEVIDNETYRRAMEVSDYNRGRSVSDLKLKTWEYGMAQNLRSDSLYQDDRYHPNKFSHPHRKDAHSFPEQEYSDFFGGTVGTA*
Ga0099654_1028484423300006415LakeMTLRPNFMPRGCYKEVRSYQMCVAKSSAEACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0075505_145984513300006571AqueousQCSAAKGADACFNEKIDIMEVCPDHILEGLREKKKWALRAELIDNQTYKRAMTVGDYNKGRSVSDLKLKTWDDGCMDNLRSDSLYADDRYDPTKYSHPHRYDNVNFPEQEYKDFFGGTVGTAEAEEYERHRLDLFSGTSKAMREYAQEKKFSKLRDAAKDVKDLNKQE*
Ga0075467_1021976213300006803AqueousMKTSKYMTLRPSYIPRGCYKEIRKYQQCAAKSSAEACFSDKISIMEVCPDHVLAGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWEYGKACNLRSDSLFQDDRYNPTKYSHPHRMDNVNFPEQEYKDFFGGTEGTAEVAEYEKHRLNLVDGQSTAINQHMAEKRKNKLKDVVGKVNDLNKK*
Ga0075467_1039431423300006803AqueousMKTSKYMTLRPSYIPRGCYKEIRKYQQCAAKSSAEACFSDKISIMEVCPDHVLAGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWDYGKACNLRSDSLFQDDRYNPTKYS
Ga0075467_1062670213300006803AqueousVCPDHVLAGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWEYGKACNLRSDSLFQDDRYNPTKYSHPHRMDNVNFPEQEYKDFFGGTEGTAEVAEYEKHRLNLVDGQSTAINQHMAEKRKNKLKDVVGKVNDLNKK*
Ga0075464_1050909913300006805AqueousKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSNFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKFSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
Ga0102689_179129213300007304Freshwater LakePNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0102853_108455913300007543EstuarineQMCKAKTGSEDACFTQKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK*
Ga0102914_105310623300007561EstuarineMTLRPNFIPRGCIKEIRTYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSSGNSQAIRQH*
Ga0102914_112433323300007561EstuarineMPRGCYKEVRSYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0102920_122573313300007600EstuarineEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPEQEYIDFFGGTKGTAEAAEYEANRLSITSGSS*
Ga0102862_112878813300007670EstuarineMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFTQKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK*
Ga0105737_115181413300007862Estuary WaterGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDM
Ga0108970_1174246413300008055EstuaryMKNSKYMTLRPNFMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0114351_139599313300008117Freshwater, PlanktonMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0102816_113685313300008999EstuarineSEDACFTQKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK*
Ga0102963_121991213300009001Pond WaterCCPIMQNSKYMTLVPQVIPRGCYKEIRKYQIGSSKTAAEACFDDKISIMEVCPDHVLQALREKKKWYLRAEVIDNETYKRAMTVSDYNKGKSVSDLQLKTWAYGKTGNLRSDSLYQDDRYNPTKFSHPHRNDNVNFPEQEYTDFFGGTLGTAQSAEYEKHRLNMSGTSQAIQEHQAAKRMAKIRNVVDEVKDLNEKK*
Ga0118729_115080113300009130MarineMKNSKYMTLRPNMIPRGCYKEIRKYQKCVDDKSKDACFSDKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKRAMQVSDFNAHRSVSDLALKTWAYGKANHLKSDSLWQDDRWDPTAYLHPHRYDNVNFPEQEYQDFFGGTKGTAEKEMYDQHKIGLFSGESDASRAHRAQKYREKSEIEKAVDEVEAHNQSE*
Ga0114978_1025624913300009159Freshwater LakeMKESKYMTLRPNYIPRGCYKEIRKYQICAAKSSAEHCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSSFNKGRSVTDLKLKTWDWGKTANLRSDSFWQDDRYDPTKFSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
Ga0114959_1047638513300009182Freshwater LakeMKNSKYMTLRPNFIPRGCYKEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDFFGGTKGTAEAA
Ga0103872_103729913300009263Surface Ocean WaterRGCVKEIKKYRQCSAAKGADACFNEKIDIMEVCPDHILEGLREKKKWALRAELIDNQTYKRAMTVGDYNKGRSVSDLKLKTWDDGCMDNLRSDSLYADDRYDPTKYSHPHRYDNVNFPEQEYKDFFGGTVGTAEAEEYERHRLDLFSGTSKAMREYAQEKKFSKLRDAAKDVKDLNKQE*
Ga0115545_109991013300009433Pelagic MarineMEVCPDHVLEALREKKKWYMRAEMIDNDTYKRAMQVSDFNKDRSVSDLQLKTWDYGKTKNLRTDSLWQDDRYNPQKYSHPHRFDNINFPEQEYTDFFGGTRGDGEMADYENHRLGMADQTSKAMRDHQSEKRKLRFVVEEVKDLNEEKKE*
Ga0115099_1030801723300009543MarineMKTSKYMTLRPSYIPRGCYKEIRKYQQCAAKNSSEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVTDLTIKSWEHGKACNMRSDSYFQDDRYNPTKFSHAH
Ga0115099_1075769113300009543MarineHKNGSECNPNLKSSKYMTLQPNYIPRGCYKEIRKYQMCHSKNGADACFNDKISIMEVCPDHILEGLREKKKWMLRAELIDNETYKRAMTVSDYNKGRSVSDLKLKTWDYGKGANLRSDTLYQDDRYNPTKYSHPHRYDNVNFPEQEYKDFFGGTVGESEAAEYAKHKL*
Ga0115103_145738413300009599MarineDRKNKTLGHRQGSMCQPNMKTSKYLTLVPQFIPRGCYKEIRKYQICASKNGAGNCLNDKLDIMEVCPDHVLEGLRERKKWYMRAEMIDNDTYRRAMEVSEYNKGRSVSELKLKTWDHGSAKNLRSDSLWQDDRWDPTVHSHNHRYDNVNFPEQEYRDFFGGTIGQEESK
Ga0115103_165866723300009599MarineMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNMERSVSDLKLKTWDYGKTANLRSDSLWQDDKYDPTKYSHPHRYDNVNFPAQEYNDFFGGTKGEAEAKEYEKHTLGLFDGSSTAIRQAQSDKRKSKLAAATEIVEELKKEE*
Ga0115102_1002838813300009606MarineDKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVTDLKLKTWDYGKTANMRSDGMWQDDRWDPTVHSHPHRYDNVTFPEQEYRDFFGGTIGTAEAEEYERNRLDMSGNSNAIRQHQSQKRMNKLKGVVAEVKDLNEKKE*
Ga0115102_1077676713300009606MarineYYQSHDDWYPDRKSKTLGHKNGGMCQPIMKTSKYMTLVPNFIPRGCYKEIRKYQICSAKNSAEACLPDKISIMEVCPDHVLEGLREKKKWYLRAELIDNDTYKRAMSVSDYNKGRSVSELKLKTWDYGKTKNLRSDSTWQDDRYEPTKYSHNHRFDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLGLTTGQSQAMAEHRSQSRIAKLRGAVNEVDELNKKSE*
Ga0115104_1067130423300009677MarineMSLKPDFAPRGCAKEIRKYQQCASEKGASSCFNEKIDIMEVCPDHVLEGLREKKKWTLRAEMIDNDTYKRAMEVSDFNVGRSVSDLKLKTWEFGKSCNLRGDGLYQDDRWNPTVYQHPHRFDNVNFPDQEYKDFFGGTVGEGEKADYKHHRLSMSDGTSEAMHAFKAEKRKSKISAAKSAVDAANKD*
Ga0115104_1077018813300009677MarineMIPRGCFREIRKYQKCASDKGAGQCFSDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPVKYSHPHRMDNVNFPEQEYKDFFGGTLGEAEKESYDHHTLSMTDGTSPAMHAHMAQKRKSKIASAKA
Ga0129320_13073613300010305AqueousKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFPQQEFKDFFGGTEGTAAKEEYEKHRLNLSDGTSKAMHEHASNKRMAKLRDAVAEVDNLNHDKKGHH*
Ga0129319_104323013300010307AqueousMKNSKFMTLRPNFIPRGCYKEIRSYQLCVAKSSADACFADKISIMEVCPDHVLELLREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLQLKTWDYGKTANMRSDSLWQDDRWLPTKHSHPHRYDNVNFAEQEYMDFFGGTKGTAETEEY
Ga0133913_1281480013300010885Freshwater LakePDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPEQEYKDIFGGTKGTAE*
Ga0129318_1014033313300011009Freshwater To Marine Saline GradientMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
Ga0153800_101796213300011995FreshwaterAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFPQQEFKDFFGGTEGTAAKEEYEKHRLNLSDGTSKAMHEHASNKRMAKLRDAVAEVDNLNHDKKGHH*
Ga0153799_109258813300012012FreshwaterIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFPQQEFKDFFGGTEGTAAKEEYEKHRLNLSDGTSKAMHEHASNKRMAKLRDAVAEVDNLNHDKKGHH*
Ga0129349_105805813300012518AqueousMSLKPDFAPRGCAKEIRKYQQCASEKGASSCFNEKIDIMEVCPDHVLEGLREKKKWTLRAEMIDNDTYKRAMQVSDFNVGRSVSDLKLKTWEYGKSCNLRGDGLYQDDRWNPTVYQHPHRFDNVNFPDQEYKDFFGGTVGEAEKADYEHHTLSMSDGTSAAMHAFKAEKRKSKISAAKSAVDAANKE*
Ga0129350_109245123300012523AqueousMKNSKYMTLKPNMIPRGCYKEIRAYQKCVDKNSKEECFADKINIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMQVSDYNKNRSVSDLQLKTWDHGKTANLRSDSLWQDDRYNPTVYAHPHRYDKYNFPEQEYSDFFGGTKGEAELKDYEEHQLGLFSNSSAAIRKHQNEKRQSKLKEAMESVDQANKEQK*
Ga0129350_134622413300012523AqueousLKPDFAPRGCAKEIRKYQQCASEKGASSCFNEKIDIMEVCPDHVLEGLREKKKWTLRAEMIDNDTYKRAMQVSDFNVGRSVSDLKLKTWEYGKSCNLRGDGLYQDDRWNPTVYQHPHRFDNVNFPDQEYKDFFGGTVGEAEKADYEHHTLSMSDGTSAAMHAFKAEKRKSKISAAKSAVDAANKE*
Ga0129352_1028335513300012528AqueousNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMEVSDFNKNRSVSDLQLKTWEHGKAKNLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEFQDFFGGTKGTAEREDYEKHQLGLFDGSSTAIRQHQAKKRSDLLAAVQEVEELNQKHE*
Ga0157623_122231813300012707FreshwaterDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0157610_121190113300012725FreshwaterFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0157610_123761213300012725FreshwaterKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSSGNSTAIRQHQSQKRMNKLKGVVAEVKDLNEKDHKH
Ga0157597_100361513300012726FreshwaterPNFMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0157616_120395313300012731FreshwaterEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0157615_107259413300012734FreshwaterRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0157615_122459023300012734FreshwaterMPRGCYKEVRAYQMCLAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0138272_101402223300012756Freshwater LakeMKNSKYMTLRPNFIPRGCYKEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDFFGGTKGTAEAAEYEANRLSITSGSSQAIAKHQSTKRMAKIRNVVDE
Ga0138268_128552323300012782Polar MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNKEVCLNDKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNVERSVTDLKLKTWDYGKAANLSSDSLWQDDRYDPTKYSHPHRYDNVNFPAQEYNDFFGGTKGEAEAKEYEKNTLGLMDGSSVAIRQA*
Ga0138268_171563713300012782Polar MarineKNSKYMTLIPNFMPRGCYREVRKYQECAATIGKEFEQCVNQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMKNLRSDTLYQDDRYDPTQFSHPHRYDNVNFPEQEYKDFFGGTMGIKEGEERTKHTLDMSGSSVAIKEFQSQRRVAKL
Ga0163179_1049770613300012953SeawaterMKNSKYMTLIPNMIPRGCYREIRKYQHCAATVGKEFEVCKNKKISIMEVCPDHVLEGLREKKKHMMRAEVIDNETYRRSMEVSDYNRNRSVSDLKLKTWAHGSAGNLRSENLYQDDRYNPTKFSHPHRYDNVNFPEQEYRDFFGGTMGTAQKEEYDKHTLGMDGTSKAMQ*
Ga0163179_1072861513300012953SeawaterMKNSKYMTLIPNMIPKGCYREIRKYQHCAATVGKEFEVCKNKKISIMEVCPDHVLEGLREKKKHMLRAEVIDNETYRRSMQVSDYNRSRSVSDLKLKTWAYGSAKNLRSDSTYQDDRYNPTKFSHPHRYDNVNFPEQEYKDFFGGTIGTSVKEEY
Ga0129335_108867323300012962AqueousMTLKPNFIPRGCTKEIRAYQMCKAKATSEDACFSDKISIMEVCPDHVLDSLRERKKWYLRAEMIDNDTYKRAMSVSDFNKDRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKFSHPHRNDNVNFPEQEYKDFFGGTIGDAERADYEKHRLGLFNDTSAAIREHQATKRMSKLKTAVAEVKDLNAHSAPKHH*
Ga0129346_120247713300012965AqueousPNFIPRGCFREIRKYQLCAAEKNADACFADKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKRAMTVSDFNAHRSVADLQLKTWDHGKTQNLRSDSLYQDDRYNPTKFSHPHRYDNVNFPDQEFSDLVGGTKGEGETNDMAHHELDFWGNTSAAIRQHRAERRRARSAVAEVADLNKKHE*
Ga0129338_136396623300012970AqueousMTLKPNFIPRGCTKEIRAYQMCKAKATSEDACFSDKISIMEVCPDHVLDSLRERKKWYLRAEMIDNDTYKRAMSVSDFNKDRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKFSHPHRNDNVNFPEQEYKDFFGGTIGDAERADYEKHRLGLFNDTSAAIREHQATKRMSKLKTAVAEVKDLNAHSA
Ga0164293_1100673413300013004FreshwaterHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE*
Ga0164292_1047289213300013005FreshwaterMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0164295_1105911413300013014FreshwaterIPRGCYKEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDFFGGTKGTAEAAEYEANRLSLTSGSS*
Ga0170791_1203988013300013295FreshwaterHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGTTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0170791_1252856413300013295FreshwaterMKNSKYMTLIPNFIPRGCYKEIRKFQLCATKRGADHCLNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVTDLQLKTWEHGKGGHLRSDSLWEDDRYNPVKHSHPHRYDNVNFPEQEYKDIFGGTLGTAEAKEQEYFAVHIAGKSKATQDWSRQ*
Ga0170791_1479362513300013295FreshwaterMKNSKYMTLRPNFIPRGCYKEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDF
Ga0177922_1038337613300013372FreshwaterRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFPQQEFKDFFGGTEGTAAKEEYEKHRLNLSDGTSKAMHEHASNKRMAKLRDAVAEVDNLNHDKKGHH*
Ga0182045_126193513300016726Salt MarshVKEIRTYQMCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVTDLKLKTWDYGKTANLRSDGMWQDDRWDPTVNSHPHRYDNVNFPEQEYRDFFGGTIGTAESEEYERNRLDMSGNSNAIRQHQSQKRMNKLKGVVAEVKDLNEKSE
Ga0182052_125613723300016742Salt MarshMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKSANLRSDGMWQDDRWDPTVNSHPHRYDNVNFPEQEYRDFFGGTIGTAESEEYERNRLDMSGNSNAIRQHQ
Ga0182070_136499523300016758Salt MarshMKSSKYMTLRPNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWMLRAELIDNETYKRAMSVSDYNKGRSVSDLKLKSWDHGKGANLKSESLWQDDRYNPTKYSHPHR
Ga0182046_110496823300016776Salt MarshMTLKHNLIPRGCYKEIRAYQHCVARSSKDECFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMQVSDFNKDRSVSDLQLKTWDYGKTRNLRTDTLWQDDRYNPLKYSHPHRYDNINFPEQEYT
Ga0169931_1010718123300017788FreshwaterMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0181584_1030127313300017949Salt MarshMKSSKYMTLRPNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMEVSDFNKNRSVSDLKLKTWEHGKAKNLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEFQDFFGGTKGTAEREDYEKHQLGLFDGSSTAIRQHQAKKRSDLLAAVQEVEELNKKHE
Ga0181560_1033481113300018413Salt MarshKTLGHKNGSFCSPTLKQSKYMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVTDLKLKTWDYGKTANLRSDGMWQDDRWDPTVNSHPHRYDNVNFPEQEYRDFFGGTIGTAESEEYERNRLDMSGNSNAIRQHQSQKRMNKLKGVVAEVKDLNEKSE
Ga0181563_1025788913300018420Salt MarshMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVTDLKLKTWDYGKTANLRSDGMWQDDRWDPTVNSHPHRYDNVNFPEQEYRDFFGGTIGTAESEEYERNRLDMSGNSNAIRQHQSQKRMNKLKGVVAEVKDLNEKSE
Ga0188826_11988523300018565Freshwater LakeEIRKYQMCAAKNSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0192983_101420223300018684MarineMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDATSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNVERSVTDLKLKTWDYGKAANLSSDSLWQDDRYDPTKYSHPHRYDNVNFPAQEYNDFFGGTKGEAEAKEYEKNTLGLMDGSSVAIRQA
Ga0192983_105044413300018684MarineLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQHXDEVSECFYFTANHH
Ga0193472_102143913300018780MarineMTLVPQQIPRGCYKEIRQYQKCVDQNGKDKCFADKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKRAMQVSDFNKDRSVSDLKLKTWDHGKTANMRSDSLWQDDRWDPTKYSHAHRYDNVNFPNQEYQDFFGGTKGTALKEEYEKHELGLFDNSSNAIREHHNEKRKATLAAALNEVQDLNKSE
Ga0192832_106206413300018782MarineIPNFMPRGCYREVRKYQQCAATIGKEFSQCVNQKINIMEVCPDHVLEGLREKKKHMLRAEVIDNETYKRAMSVSDFNRGRSVSDLQLKTWDYGTAKNLRSDTIYQDDRYDPTKFSHPHRNDNVNFPEQEYKDFFGGTMGTAESEEREKHTLNMSGSSKAIQEYQSQRRMARL
Ga0193253_107326923300018846MarineMTLRPNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMQVSDFNKNRSVSDLTLKTWEHGKAKNLRSDSLWQDDRYNPTKYSHPHRYDNINFPEQEY
Ga0192970_103272913300018848MarineMTLIPNMMPKGCYREVRKYQECAATIGKEISQCINQKISIMEVCPDHVLEGLREKKKHMLRAEVIDNETYRRAMQVSDFNRERSVSGLQLKTWEHGAANNLRSDSLYQDDRYDPTKFSHAHRYDNVNFPE
Ga0192978_105307213300018871MarineMCQPNMKTSKFMTLAPSFIPRGCYKEIRKYQICEAAKSSAECINDKISIMEVCPEHVLEGLREKKKWFLRAESIDNETYKRAMEVSDYNRGRSVSDLKLKTWDYSYKLHSGSTWEDDRYNPTKYSHAHRFDNVNFPDQEYNDFFGGTKGTAEKEEREQNRLGLMDGRSQAMNDHAKAQRMEKMKLRDVVDEVNALNSQAH
Ga0192978_110360313300018871MarineMSLRPSFIPRGCFKEIRSYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLTLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFP
Ga0192989_1010385413300018926MarineHDDWYPDRKNKTLGVDQGGQNQPIMQSSKYMTLVPTRIPRGCYKEIRKYKKCSADKGSKACFNEKIDIMEVCPDHILEGLREKKKWSLRAEVIDNQTYKRAMTVGSYNKGRSVSELKLKTWDEGSLDSLRGDSLYQDDRYDPTKFSHPHRYDNVNFPEQEYKDFFGGTVGTAESEEYERHRIDLFSGTSKAMREHATEKKFSKLKDAAKDVKDLNKQE
Ga0192989_1014449513300018926MarineSKYMTLRPNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMQVSDFNKNRSVSDLTLKTWEHGKAKNLRSDSLWQDDRYNPTKYSHPHRYDNINFPEQEY
Ga0192961_1007816813300018980MarineMTLKHNLIPRGCYKEIRTYQHCVARTGSKDECFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMQVSDFNKDRSVSDLKLKTWDYGKTRNLRTDSLWQDDRYNPLKYSHPHRFDNINFPEQEFTDFFGGTRGDAEMADYEDNRLGMLDQTSKAMRDHQSEKRKLRFVVEEVKDLNEKKE
Ga0192961_1007852113300018980MarineMTLKHNLIPRGCYKEIRTYQHCVARTGSKDECFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMQVSDFNKDRSVSDLKLKTWDYGKTRNLRTDSLWQDDRYNPLKYSHPHRFDNINFPEQEFTDFFGGTRGDAEMADYEDNRLGMLDQTSKAMRDHQSEKRKMRFVVQDVAEMNKATDEAEK
Ga0192947_1010755023300018982MarineMKNSKYMTLRPTMIPRGCYKEIRSYQNCVASSNKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNAHRSVSDLKLKTWDHGKTANMRSDSLWQDDRYDPTKYSHAHRYDNVNFPEQEYEDFFGGTKGTAEIEEHEKY
Ga0193030_1006656813300018989MarineMKNSKYMTLIPNMIPRGCYREIRKYQHCAATVGKEFEVCKNKKISIMEVCPDHVLEGLREKKKHMMRAEVIDNETYRRSMEVSDYNRNRSVSDLKLKTWAHGSAGNLRSENLYQDDRYNPTKFSHPHRYDNVNFPEQEYRDFFGGTMGTAQKEEYDKHTLGMDGTSKAMQ
Ga0193030_1013056613300018989MarineNLDYSFQKYHKHYQGHDDWLPDRKNKTLGAKQGGMNQPIMKNSKYMTLIPNMIPKGCYREIRKYQHCAATVGKEFEVCKNKKISIMEVCPDHVLEGLREKKKHMLRAEVIDNETYRRSMQVSDYNRSRSVSDLKLKTWAYGSAKNLRSDSTYQDDRYNPTKFSHPHRYDNVNFPEQEYKDFFGGTMGTSVKEEYDKHTLGMDGTSKAMQDHASQKRMNKLKDVVAEVDKINGKQ
Ga0193569_1029478113300019017MarineDRKNKTLGAKQGGMNQPIMKNSKYMTLIPNMIPKGCYREIRKYQHCAATVGKEFEVCKNKKISIMEVCPDHVLEGLREKKKHMLRAEVIDNETYRRSMQVSDYNRSRSVSDLKLKTWAYGSAKNLRSDSTYQDDRYNPTKFSHPHRYDNVNFPEQEYKDFFGGTMGTSVKEEYDKHTLGMDGTSKAMQDHASQKRMNKLKDVVAEVDKINGKQ
Ga0193037_1034882213300019033MarineMALQGTTIPRGCYKEILKYKKTKDFNDKMSIMEVCPDHVLEGLREKKKWLLRAEVIDNQTYKRAMKVGDYNKGRSVSDLVLKTWAHGKTLRSDSLYEDDRYDPTKFSHPHRNDGINFPKQEYKDFFGGTVGNAEAAEYDNHTLDFFGDDSRAMQEARAENRRSRQVADEVSGM
Ga0192981_1011314613300019048MarineMSLRPSFIPRGCFKEIRSYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLTLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQH
Ga0192981_1016458023300019048MarineMSLRPSIIPRGCFKEIRNYHKCATAKGAANCFTDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVTELQLKTWDFGKSCNMRSDSLYQDDRYNPTKYSHPHRFDNVNFPDQEYKDFFGGTVGEGEKADYEHNQLSFSDGTSDAMHAHQAQKRKSKLGQAKDAVNAANSH
Ga0193356_1011764113300019053MarineMPDRKNKTLGAKQGGMNQPIMKNSKYMTLIPNFMPRGCYREVRKYQQCAATSGKEFSQCVNQKINIMEVCPDHVLEGLREKKKHMLRAEVIDNETYKRAMTVSDFNRGRSVSDLQLKTWDYGTAKNLRSDTLYQDDRYDPTKFSHPHRNDNVNFPEQEYKDFFGGTMGTAEAEEREKYTLNYSGTSKGIQEHQSQRRMARLSDVVKEVDDLNKEK
Ga0193102_101524313300019099MarinePDRKNKTLGAKQGGMNQPIMKNSKYMTLIPNFMPRGCYREVRKYQQCAATIGKEFSQCVNQKINIMEVCPDHVLEGLREKKKHMLRAEVIDNETYKRAMSVSDFNRGRSVSDLQLKTWDYGTAKNLRSDTIYQDDRYDPTKFSHPHRNDNVNFPEQEYKDFFGGTMGTAEAEEREKHTLNYSGSSKAIQEHQSQRRMARLSDVVKEVDSLNAEK
Ga0192980_106693413300019123MarineGQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLTLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQHXDEVSECFYFTANHH
Ga0192980_107137413300019123MarinePSIIPRGCFKEIRNYHKCATAKGAANCFTDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVTELQLKTWDFGKSCNMRSDSLYQDDRYNPTKYSHPHRFDNVNFPDQEYKDFFGGTVGEGEKADYEHNQLSFSDGTSDAMHAHQAQKRKSKLGQAKDAVNAANSH
Ga0193047_113483713300019139MarineCFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNTERSVSDLKLKTWDYGKTANLRSDSLWQDDKYDPTKYSHPHRYDNVNFPAQEYNDFFGGTKGEAEAKEYEKHTLGLFDGSSTAIRQAQSDKRKSKLAAATEIVEDLKKEE
Ga0188870_1013248913300019149Freshwater LakeYRQCSAAKGADACFNEKIDIMEVCPDHILEGLREKKKWAMRAELIDNQTYKRAMTVGDYNKGRSVSDLKLKTWDDGCMDNLRSDSLYSDDRYDPTKYSHPHRYDNVNFPEQEYKDFFGGTVGTAEAEEYERHRLDLFSGTSKAMREYAQEKKFSKLRDAAKDVKDLNKQE
Ga0182081_134929423300019277Salt MarshMKSSKYMTLRPNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMEVSDFNKNRSVSDLQLKTWEHGKAKNLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEFQDFCGGTKGTAEREEYEKHQLGLFDGSSTAIRQHQAKKRSDLLAAVQEVEELN
Ga0181562_1040289513300019459Salt MarshLKQSKYMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANLRSDGMWQDDRWDPTVNSHPHRYDNVNFPEQEYRDFFGGTIGTAESEEYERNRLDMSGNSNAIRQHQSQKRMNKLKGVVAEVKDLNEKSE
Ga0182044_125526413300020014Salt MarshMKSSKYMTLQPNYIPRGCYKEIRKYQMCHSKNGQDACFNDKISIMEVCPDHILEGLHEKKKWMLRAELIDNETYKRAMTVSDYNKGRSVSDLKLKTWDYGKGANLRSDTLYQDDRYNPTKYSHPHRYDNVNFPEQEYRDFFGGTVGESEAAEYQKHKL
Ga0182044_125652813300020014Salt MarshCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVTDLKLKTWDYGKTANLRSDGMWQDDRWDPTVNSHPHRYDNVNFPEQEYRDFFGGTIGTAESEEYERNRLDMSGNSNAIRQHQSQKRMNKLKGVVAEVKDLNDK
Ga0194115_1009123223300020183Freshwater LakeMTLRPNFIPRGCIKEIRAYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSSGNSQAIRQH
Ga0194131_1040753313300020193Freshwater LakeVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVSDLVLKTWDHGKTANMRSDSIWQDDRYNPIQYSHPHRNDNVNFPSQEYKDFFGGTEGTAAKEEYEKFKLSLSDGTSKAMHEHASNKRMAKLRDAVAEVDHLNHEKKGHH
Ga0211731_1150520213300020205FreshwaterEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFPQQEFKDFFGGTEGTAAKEEYEKHRLNLSDGTSKAMHEHASNKRMAKLRDAVAEVDNLNHDKKGHH
Ga0214162_101365013300021108FreshwaterMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0214168_108257113300021140FreshwaterRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFPQQEFKDFFGGTEGTAAKEEYEKHRLNLSDGTSKAMHEHASNKRMAKLRDAVAEVDNLNHDKKGHH
Ga0206687_175319513300021169SeawaterMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNMERSVSDLKLKTWDYGKTANLRSDSLWQDDKYDPTKYSHPHRYDNVNFPAQEYNDFFGGTKGEAEAKEYEKHTLGLFDGSSTAIRQAQSDKRKSKLAAATEIVEELKKEE
Ga0210308_107902213300021303EstuarineYQMCKAKTGSEDACFSEKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK
Ga0206691_177717413300021342SeawaterGCNRDIRKYQACAASDGQGACVNQKVSIMEVCREHILEGLREKKKWYLRAESIDNETYKRAMSVGDYNRNRSVSDLELKTWDYGKKIRSDSTWEDDRYNPTKFSHPHRYDNVNFPDQEYSDFFGGTKGTAEAEEFERNTLNRTSGNSPAINQYASEKRMKLREAVNEVNNLNKE
Ga0206692_148347113300021350SeawaterMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDAANGDKQACFSDKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKRAMQVSDFNKDRSVSDLSLKTWEYGKAKNLKSDSLWQDDRYNPTKYTHPHRYDNINFPEQEYQDFFGGTKGQSEVEE
Ga0206692_172068113300021350SeawaterMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMQVSDFNKNRSVSDLTLKTWEHGKAKNLRSDSLWQDDRYNPTKYSHPHRYDNINFPEQEY
Ga0206693_130307613300021353SeawaterMVQPNFKTSKYMTLQPQQIPRGCYKEIRKYQLCEANKSGECFNEKISIMEVCPDHVLEGLREKKKWYLRAESIDNETYKRAMKVGDYNRGRSVSDLKLKTWEYGRTLHSGSTWEDDRFNPTKFSHAHRYDNVNFPDQEYKDFFGGTLGQAENEEREKHRLDLMSGRSQAMNDFDKARRLEKLKLSDVVSEVNDLNAKAD
Ga0206690_1019343023300021355SeawaterMRKYQQCARSNGEKNCFADKLSIMEVCPDHVLSGLREKKKWVLRAEVIDNQTYKRAMKISDYNKGRSVSDLELKTWEQGTNEAMRSDSYWQDDRYNPKTYPHPHRYDDKNFPEQEYKDIFGGTMGDAARAHKEKHRLGFFSGKSG
Ga0206690_1063282313300021355SeawaterMEVCPDHVLEGLREKKKWYLRAEVIDNDTYKRAMQVSDFNKGRSVSDLKLKTWDYGKTANLRSDTWYQDDRWDPTKYAHNHRYDNVNFPEQEFRDFFGGTWGTAEEEEREKHRLGVMSGQSAAMADHRSANRMAKLRGAVAEVNDLNKE
Ga0063132_12974423300021872MarineMSLRPSMIPRGCFREIRKYQKCASDKGAGQCFSDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPVKYSHPHRMDNVNFPEQEYKDFFGGTLGEAEKESYDHHTLSMTDGTSPAMHAHMAQKRKSKIANAKAAVDGANGH
Ga0063097_102400923300021898MarineMKNSKYMTLQPSFIPRGCYKEIRKYQICSSQAGADACFQDKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYRRAMEVSDFNKGRSVTELELKTWAHGKAKNLRSDSYFQDDRYEPTVFPHNHRYDNVNFPEQEFKDFFGGTIGTAEKEDYEKHRLGMFGAPSKAMSDHASAQRVANLRGAVAEVNKLNEKK
Ga0063097_103776723300021898MarineMTLVPTRIPRGCYKEIRKYKKCSAEKGTQSCFNEKIDIMEVCPDHILEGLREKKKWSLRAEVIDNQTYKRAMTVGNYNKGRSVSELKLKTWDEGSLDSLRSDSLYQDDRYDPTKFSHPNRYDNVNFPEQEYKDFFGGTVGTAESEEYERHRIDLFSGTSKAMREHATEKKFSKLKDAAKDVKDLNKQEXMXSTSVIKCLLLNAYLS
Ga0063100_104896623300021910MarineMKNSKYMTLQPSFIPRGCYKEIRKYQICSSQAGADACFQDKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYRRAMEVSDFNKGRSVTELELKTWAHGKAKNLRSDSYFQDDRYEPTVFPHNHRYDNVNFPEQEFKDFFGGTIGTAEKEDYEKHRLGMFGAPSKAMSDHASAQRVANLRG
Ga0063106_105838623300021911MarineMTLVPTRIPRGCYKEIRKYKKCSAEKGTQSCFNEKIDIMEVCPDHILEGLREKKKWSLRAEVIDNQTYKRAMTVGNYNKGRSVSELKLKTWDEGSLDSLRSDSLYQDDRYDPTKFSHPNRYDNVNFPEQEYKDFFGGTVGTAESEEYERHRIDLFSGTSKAMREHATEKKFSKLKDAAKDVKDLNKQEXMXSTSVIKCLLL
Ga0063104_108855213300021913MarineGGQCSPILRNSKFMSLRPSIIPRGCFKEIRNYHKCATAKGAANCFADKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNLGRSVTELQLKTWDFGKSCNMRSDSLYQDDRYNPTKYSHPHRFDNVNFPEQEYKDFFGGTMGEGEKADYEHNQLSFTDGTSDAMHAHQAQKRKSKLNQAKDAVNAANSH
Ga0063870_103859823300021921MarineMTQPNMKNSKYMTLVPNFMPRGCYKEVRKYQMCAAKENKEACLADKISIMEVCPDHVLEGLREKKKWYLRAESIDNETYKRAMTVGDYNRGRSVSNLNMKTWAHGKTLRSDSTWEDDRWNPTVYKHPHRNDGQNNPEQEYSDFFGGTHGTQEAKDYEDNKLNMSG
Ga0063096_105269923300021925MarineMTLVPNFMPRGCYKEVRKYQMCAAKENKEACLADKISIMEVCPDHVLEGLREKKKWYLRAESIDNETYKRAMTVGDYNRGRSVSNLNMKTWAHGKTLRSDSTWEDDRWNPTVYKHPHRNDGQNNPEQE
Ga0063103_110201313300021927MarineMSLRPSIIPRGCFKEIRNYHKCATAKGAANCFADKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNLGRSVTELQLKTWDFGKSCNMRSDSLYQDDRYNPTKYSHPHRFDNVNFPEQEYKDFFGGTMGEGEKADYEHNQLSFTDGTSDAMHAHQAQKRKSKLNQAKDAVNAANSHXDD
Ga0063102_106047423300021941MarineMCQPNMKTSKFMTLTPSFIPRGCYKEIRKYQICEASKSSAECINDKISIMEVCPEHVLEGLREKKKWFLRAESIDNETYKRAMEVSDYNRGRSVSDLKLKSWDCSYKLHSGSTWEDDRYNPTKYSHPHRFDNVNFPDQEYNDFFGGTKGTAEKEDREAHRLGLMDGRSQAMNDHAKAQRMEKMKLRDVVDEVNALNSQAH
Ga0210310_101791913300022369EstuarineMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKCYLRAEMIDNDTYKRAMKVSDFNMERSVSDLKLKTWDYGKTANLRSDSLWQDDKYDPTKYSHPHRYDNVNFPAQEYNDFF
Ga0210313_104482113300022375EstuarineYQMCKAKTGSEDACFTQKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK
Ga0244777_1085863713300024343EstuarineSIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK
Ga0209634_111638013300025138MarineMIPRGCFREIRKYQKCASDKGAGQCFSDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVTDLKLKTWDYGKSCNLRSDSLYQDDRYNPVKYSHPHRMDNVNFPEQEYKDFFGGTLGEAEKESYDHHTLSMTDGTSPAMHAHMAQKRKSKIASAKAAVDGANG
Ga0208107_102950213300025399FreshwaterMKNSKYMTLRPNFIPRGCYKEIRKYQICASKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSEFNKGRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYIDFFGGTKGTAEAAEYEANRLSITSGSSQAIAKHQSTKRMAKIRSV
Ga0208426_101775623300025451AqueousMKNSKFMTLRPNFIPRGCYKEIRSYQLCVAKSSADACFADKISIMEVCPDHVLELLREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLQLKTWDYGKTANMRSDSLWQDDRWLPTKHSHPHRYDNVNFAEQEYMDFFGGTKGTAETEEYARNKIGVLSDTSQAIR
Ga0208426_105757713300025451AqueousQDKISIMEVCPDHVLDALREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSELKLKTWAHGKNGNLRSDSFWQDDRYDPTKYAHNHRYDNVNFPEQEFKDFFGGTIGTAESEEYEKNRIGLFGAPSKAMSEHASATRMAKLRGAVDEVKKLNEHDKKH
Ga0208496_104025323300025591FreshwaterMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKHSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0208544_1014030013300025887AqueousMKTSKYMTLRPSYIPRGCYKEIRKYQQCAAKSSAEACFSDKISIMEVCPDHVLAGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWEYGKACNLRSDSLFQDDRYNPTKYSHPHRMDNVNFPEQEYKDFFGGTEGTAEVAEYEKHRLNLVDGQSTAINQHMAEKRKNKLKDVVGKVNDLNKK
Ga0208916_1013502723300025896AqueousMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSNFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKFSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0208897_114278913300027571EstuarineSKYMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFTQKISIMEVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMSVSDFNRNRSVSDLKLKTWDYGKTANMRSDSMWQDDRWDPTAFSHAHRFDNVNFPEQEYNDFFGGTKGTAESEEYERNRLDMSGNSTAIRQHQSQKRMNKLKGIVDEVKGLNESK
Ga0209815_118548013300027714MarinePSFIPRGCFKEIRSYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQH
Ga0209190_113739513300027736Freshwater LakeMTLRPNFIPRGCYKEIRSYQMCKSKASEDACFADKISIMEVCPDHVLDALREKKKWYLRAEMIDNDTYKRAMSVSDFNKDRSVSDLKLKTWDYGKTANLRSDSLWQDDRWDPTKFSHPHRNDNVNFPD
Ga0209770_1031034923300027769Freshwater LakeMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHP
Ga0209279_1017226913300027771MarineMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDATSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNVERSVTDLKLKTWDYGKAANLSSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEYNDFFGGTKGEAEAKEYEKNTLGLMDGSSVAMRQA
Ga0209279_1020400713300027771MarineAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQH
Ga0209500_1016845213300027782Freshwater LakeMTLRPNYIPRGCYKEIRKYQICAAKSSAEHCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSSFNKGRSVTDLKLKTWDWGKTANLRSDSFWQDDRYDPTKFSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0209107_1022164323300027797Freshwater And SedimentMTLRPNFMPRGCYKEVRSYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFPE
Ga0209450_1035845913300027885Freshwater Lake SedimentMKESKYMTLRPNYIPRGCYKEIRKYQICAAKSSAEHCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSSFNKGRSVTDLKLKTWDWGKTANLRSDSFWQDDRYDPTKFSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0209450_1086992513300027885Freshwater Lake SedimentPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0256331_115772913300028286FreshwaterGEKSGRESTGMTLQPRTIPRGCYREIRNYNLCKDKANPEACFHEKLSIMEVCPEVVLEGLREKRKHYLRAEAIDNETYKRAMTVSSFNKGRSVSDLKLKTWDYGSSLRSDSYYADDRWDATKYSHPHRYDNVNFPEQEYSNMIGGTVGEAAAAERERHTLDFTQTTSKAI
Ga0210315_102005923300028329EstuarineMTLRPNFMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFPE
Ga0247626_118184213300030591SoilDRKGKTLGVKNGGSMENNKRISKYMTLQPNFIPRGCYKEIRKYQMCAGKNGNEACVNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGSYNKNKSVTDLELKTWEHGKGGNLKSDSLWQDDRYNPTKYSHPHRYDNVNFKE
Ga0247613_1018123913300030610SoilGGSMENNKRISKYMTLQPNFIPRGCYKEIRKYQMCAGKNGNEACVNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGSYNKNKSVTDLELKTWEYGKGGNLKSDSLWQDDRYNPTKYSHPHRYDNVNFKE
Ga0307402_1033209513300030653MarineMNQPNMKNSKYMTLIPNFMPRGCYREVRKYQECAATIGKEFEQCVNQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMKNLRSDTLYQDDRYDPTQFSHPHRYDNVNFPEQEYKDFFGGTMGIKEGEERTKHTLDMSGSSVAIKEFQSQRRVAKLSDA
Ga0307402_1036073123300030653MarineMSLRPSFIPRGCFKEIRSYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHM
Ga0307401_1019449623300030670MarineMIPRGCYKEIRSYQNCVASSNKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNAHRSVSDLKLKTWDHGKTANMRSDSLWQDDRYDPTKYSHAHRYDNVNFPEQEYEDFFGGTKGTAEIEEHEKY
Ga0307401_1022462323300030670MarineMNQPNMKNSKYMTLIPNFMPRGCYREVRKYQECAATIGKEFEQCVNQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMKNLRSDTLYQDDRYDPTQFSHPHRYDNVNFPEQEYKDFFGGTMGIKEGEERTKHTLDMSGSSVAIKEFQSQRRVAKLSDAVKEVDQLNEKK
Ga0307403_1024582023300030671MarineMIPRGCYKEIRSYQNCVASSNKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNAHRSVSDLKLKTWDHGKTANMRSDSLWQDDRYDPTKYSHAHRYDNVNFPEQEYEDFFGGTKGTAEIEEHEKFKIGIMDDSSNAIREHQSNKRRSKIAAAQAEVDALNSEKKE
Ga0307400_1034970313300030709MarineMSLRPSFIPRGCFKEIRSYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQH
Ga0307400_1039335023300030709MarineMNQPNMKNSKYMTLIPNFMPRGCYREVRKYQECAATIGKEFEQCVQQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMKNLRSDTLYQDDRYDPTQFSHPHRYDNVNFPEQEYKDFFGGTMGIKEGEERTKHTLDMSGSSVAIKEFQSQRRVAKLSDAVKEV
Ga0073964_1145471823300030788MarineMALKPSLAPRGCAREITKYQKCAEAKGSAQCFNEKIDIMEVCPDHVLEGMRERKKWTLRAQMIDNDTYKRAMTVSDFNVGRSVSDLKLKTWDYGKSCNLRSDGLYQDDRWNPTKYSHAHRFDNVNFPDQEYKDFFGGTVGEGEKADYEHH
Ga0073990_1181159123300030856MarineMKNSKYMTLVPNWIPRGCYREIRKFQMCSARNPDNAAEVCLNDKISIMEVCPEHILEALREKKKHMLRAEVIDNETYRRAMQVGEYNRNRSVSDLTLKTWAHGKTLRTETAYSDSRYNPTEYSHAHRNDNVNFPEQEYKDFFGGTVGTAEAADYDRHHIDLRSGTSEAMNDYTAARRMNKFKNVQADIDA
Ga0151492_101549913300030869MarineMTLVPQQIPRGCYKEIRAYQKCVDDKGKDKCFADKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDFNKNRSVSDLKLKTWDYGKTANMRSDSLWQDDRWDPTKYSHAHRYDNVNFPNQEYQDFFGGTKGEALKQEMDKHNLGLFDNSSNAIREHHNEKRKASLASALDEVKDLNK
Ga0073974_178272223300031005MarineMTLVPQQIPRGCYKEIRAYQKCVDDKGKDKCFADKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDFNKNRSVSDLKLKTWDYGKTANMRSDSLWQDDRWDPTKYSHAHRYDNVNFPNQEYQDFFGGTKGEALKQEMDKHNLGLFDNSSNAIREHHNEKRKASLASALDEVK
Ga0073978_150832413300031036MarineRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMEVSDFNKNRSVSDLQLKTWEHGKANNLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEFQDFFGGTKGTAEREDYEKHQLGLFDGSSTAIRQHQAKKRSDLLAAVQEVEEL
Ga0073978_163545323300031036MarineMKSSKYMTLRPNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMEVSDFNKNRSVSDLQLKTWEYGKAKNLRSDSLWQDDRYDPTKYSHPHRYDNVNFPEQEFQDFFGGTKGTAEREDYEKHQLGLFDGSSTAIRQHQAKKRSDLLNAVQEVEDLNKKHE
Ga0073952_1136495913300031445MarineMTLVPNQIPRGCYKEIRAYQKCVDKDGKDKCFGEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDYNKNRSVTDLKLKCWEHGKTANLRSDSLWQDDRWDPTKYSHAHRYDNVNFPKQEYQDFFGGTKGEQMAADYEKHTLGLFDDSSNAIREKQNEMRAKKHSPLADAAAELASLN
Ga0307489_1029509433300031569Sackhole BrineMEVCPDHVLEGLREKKKWFLRAEMIDNDTYKRAMTVSDFNKGRSVQDLQLKTWDYGKTVNMRSDSIWQDDRYLPTSYSHPHRNDNVNFPEQEYNDFFGGTKGNAESADYDKNRLSLTDGTSTAMHQYAAEKRINKLKGAVAAVNEANKQ
Ga0307386_1022124813300031710MarineMSLRPSFIPRGCFKEIRNYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSKIQNAKAAVDSANQH
Ga0307386_1022815413300031710MarineMKTSKFMTLTPSFIPRGCYKEIRKYQICEAAKSSSECINDKISIMEVCPEHVLEGLREKKKWFLRAESIDNETYKRAMEVSDYNRGRSVSDLELKTWEHSYKLHSGSTWEDDRYNPTAYSHAHRFDNVNFPDQEYNDFFGGTKGTAEKEDREHHRLGMADGRSQAMNDHNKAKRMEKMKLRDVVDQVNALNASKAD
Ga0307386_1042892913300031710MarineMCQPNMKTSKFMTLAPSFIPRGCYKEIRKYQICEAAKSSAECINDKISIMEVCPEHVLEGLREKKKWFLRAESIDNETYKRAMEVSDYNRGRSVSDLKLKTWDYSYKLHSGSTWEDDRYNPTKYSHAHRFDNVNFPDQEYNDFFGGTKGTAEKEDREQNRLGLMDGRSQAMNDHAKAQRMEKMKLRDVVDEVNALNSQ
Ga0307381_1009648313300031725MarineMALKPSMAPRGCAKEIKKYHKCAEEKGSATCFNEKIDIMEVCPDHVLEGMRERKKWTLRAQMIDNDTYKRAMTVSDFNIGRSVSDLKLKTWDFGKSCNLRGDGLYQDDRWNPTKYSHAHRFDNVNFPDQEYKDFFGGTIGDGEKADYEHHTLSLADG
Ga0307381_1040944213300031725MarineCVDENGKDKCFSDKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKRAMQVSDFNANRSVSDLKLKTWDHGKTANMRSDSLWQDDRWDPTKYSHAHRYDNVNFPNQEYQDFFGGTKGEALKEEYDKHTLGLFDDSSNAIREAHNDKRKSSLAAAMNEVQDLNTV
Ga0307391_1024384313300031729MarineMSLRPSIIPRGCFKEIRNYHKCATAKGAANCFTDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVTELTLKTWDYGKSCNMRSDSLYQDDRYNPTKYSHPHRFDNVNFPDQEYKDFFGGTVGEGEKADYEHNQLSFSDGTSEAMHAHQAQKRKSKLGQAKDAVNAANSH
Ga0307384_1015457323300031738MarineMTLVPNYIPRGCYKEIRKYKMCQANKSTEECVNEKISIMEVCPDHILEGLREKRKWSLRAESIDNETYKRAMKVGDYNRGRSVSDLHLKTWDHGSSLHSGSTWEDDRYNPTKFSHPHRYDNVNFPDQEYKDFFGGTLGQAENEERERHRLGLTNGRSQAMTDFDKARRMEKLKTRDIVNEVDELNATKAD
Ga0307384_1015715023300031738MarineMKTSKFMTLAPSFIPRGCYKEIRKYQICEASKSDAECINDKISIMEVCPEHVLEGLREKKKWFLRAESIDNETYKRAMEVSDYNRGRSITDLKLKTWDYGYKLHSGSTWEDDRYNPTKFSHAHRFDNVNFPDQEYNDFFGGTKGTAEKEDREQNRLGLMDGRSQAMNDHAKAQRMEKMKLRDVVDEVNALNSQAH
Ga0307384_1031812113300031738MarineMSLRPSFIPRGCFKEIRNYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFP
Ga0307384_1052597013300031738MarineMNQPNMKNSKYMTLIPNFMPRGCYREVRKYQECAATIGKEFEQCVQQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMKNLRSDTLYQDNRYDPTQFSHPHRYDNVNFPEQEYKDFFGGTMGIKEGEERTKHTLDMSGSSVAIKEF
Ga0307383_1029234123300031739MarineMSLRPSIIPRGCFKEIRNYHKCATAKGAANCFTDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNIGRSVTELTLKTWDFGKSCNMRSDSLYQDDRYNPTKYSHPHRFDNVNFPDQEYKDFFGGTVGEGEKADYEHNQLSFSDGTSDAMHAHQAQKRKSKLGQAKDAVNA
Ga0315907_1058755313300031758FreshwaterMTLKPNFIPRGCTKEIRAYQMCKAKATSEDACFSDKISIMEVCPDHVLDSLRERKKWYLRAEMIDNDTYKRAMSVSDFNKDRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKFSHPHRNDNVNFPEQEYKDFFGGTIGDAERADYEKHRLGLFNDTSAAIREHQATKRMSKLKTAVAEVKDLNAHSAPKHH
Ga0315899_1083346633300031784FreshwaterMKFSKYMTLIPNFIPRGCYKEIRKFQLCAARRDADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNLGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTKFSHPHRYDNVNFKDQEYKDIFGGTIGTAE
Ga0315904_1147576613300031951FreshwaterMTLRPNFIPRGCIKEIRTYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSS
Ga0315901_1076732513300031963FreshwaterPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE
Ga0315902_1091941313300032093FreshwaterKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSSGNSTAIRQHQSQKRMNKLKGVVAEVKDLNEKDHKHH
Ga0314669_1041686513300032708SeawaterMKTSKYMTLRPSYIPRGCYKEIRKYQQCAAKNSSEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVTDLTIKSWEHGKACNMRSDSYFQDDRYNPTKFSHAHRNDNVNFPEQEYKD
Ga0314669_1046440113300032708SeawaterKTLGHKQGSMCQPNMKNSKFMTLVPSFVPRGCVKEIKKYQQCANAKSQEACINDKISIMEVCPDHVLEGLREKKKWYLRAESIDNETYRRAMEVSDYNRGRSVSELKLKTWDYGCNLRTESVWQDDRYNPTKFSHPHRYDNVNFPDQEYSDFFGGTKGTAEAADYENHKMDMNGRSQAMNDHDKAKRMEKLKMRDAVAEVNDLNTKAE
Ga0307390_1048287923300033572MarineMNQPNMKNSKYMTLIPNFMPRGCYREVRKYQECAATIGKEFEQCVNQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMKNLRSDTLYQDDRYDPTQFSHPHRYDNVNFPEQEYKDFFGGTMGIKEGEERTKHTLDMSGSSVAIKEFQSQRRVAKLSDAVKEVD
Ga0307390_1052292313300033572MarineMSLRPSIIPRGCFKEIRNYHKCATAKGAANCFTDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDFNMGRSVTELTLKTWDYGKSCNMRSDSLYQDDRYNPTKYSHPHRFDNVNFPDQEYKDFFG
Ga0307390_1092988413300033572MarineCSPILRTSKFMSLRPSFIPRGCFKEIRSYQKCAADKGASQCFNDKISIMEVCPDHVLEGLREKKKWTLRAELIDNDTYKRAMQVSDLNMGRSVSDLKLKTWDYGKSCNLRSDSLYQDDRYNPIKYSHPHRMDNVNFPEQEYKDFFGGTLGDAEKESYEHHQLSMTDGTSKAMGAHMAQKRKSK
Ga0334977_0388834_2_4063300033978FreshwaterMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE
Ga0334989_0216528_417_7823300033984FreshwaterMPRGCYKEVRSYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFP
Ga0334989_0344654_61_5793300033984FreshwaterMCAAKNSTEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWDHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFPQQEFKDFFGGTEGTAAKEEYEKHRLNLSDGTSKAMHEHASNKRMAKLRDAVAEVDNLNHDKKGHH
Ga0335003_0167113_221_6853300033995FreshwaterMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKTWDYGKTANLRSDSFWQDDRYDPTKYSHPHRYDNVNFEEQEYIDFFGGTKGTAEAAEYE
Ga0334998_0780058_1_3843300034019FreshwaterMTLRPNFIPRGCIKEIRTYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFP
Ga0335025_0223889_266_6313300034096FreshwaterMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDDRYDPTKFSHPHRYDNVNFP
Ga0335039_0476061_158_6283300034355FreshwaterRGCIKEIRTYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDNVNFPEQEYKDFFGGTIGTAEAEEYERHRLDSSGNSQAIRQH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.