| Basic Information | |
|---|---|
| Family ID | F020761 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 222 |
| Average Sequence Length | 45 residues |
| Representative Sequence | YLPYWLGFYGGGETVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 97.75 % |
| % of genes from short scaffolds (< 2000 bps) | 86.94 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.198 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.973 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.081 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.757 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.14% β-sheet: 20.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF16338 | AGL_N | 64.86 |
| PF13802 | Gal_mutarotas_2 | 10.81 |
| PF16011 | CBM9_2 | 4.95 |
| PF17137 | DUF5110 | 4.05 |
| PF09087 | Cyc-maltodext_N | 2.25 |
| PF11941 | DUF3459 | 1.80 |
| PF00128 | Alpha-amylase | 1.35 |
| PF16657 | Malt_amylase_C | 0.90 |
| PF12704 | MacB_PCD | 0.45 |
| PF01497 | Peripla_BP_2 | 0.45 |
| PF00378 | ECH_1 | 0.45 |
| PF06452 | CBM9_1 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
|---|---|---|---|
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.35 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.35 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.35 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 1.35 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.45 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.45 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.45 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.45 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.20 % |
| Unclassified | root | N/A | 1.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100749305 | All Organisms → cellular organisms → Bacteria | 4026 | Open in IMG/M |
| 3300000559|F14TC_100801908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300000955|JGI1027J12803_103489352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300001089|JGI12683J13190_1000668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4949 | Open in IMG/M |
| 3300001154|JGI12636J13339_1005283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2108 | Open in IMG/M |
| 3300001545|JGI12630J15595_10017925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1507 | Open in IMG/M |
| 3300001545|JGI12630J15595_10029461 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300001593|JGI12635J15846_10024143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4940 | Open in IMG/M |
| 3300001593|JGI12635J15846_10101611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2061 | Open in IMG/M |
| 3300001593|JGI12635J15846_10116534 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300001661|JGI12053J15887_10345408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100816855 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100897114 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101774040 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101887501 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10269640 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300004080|Ga0062385_10093054 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300004091|Ga0062387_100541112 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300004091|Ga0062387_101002923 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300004091|Ga0062387_101225343 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300004633|Ga0066395_10969280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300005163|Ga0066823_10006581 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300005186|Ga0066676_10447669 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005332|Ga0066388_107683416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300005434|Ga0070709_10524743 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005439|Ga0070711_100826142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300005445|Ga0070708_100544117 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300005468|Ga0070707_100475582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300005526|Ga0073909_10042002 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300005554|Ga0066661_10199894 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005558|Ga0066698_10900743 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005561|Ga0066699_10768511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300005586|Ga0066691_10433087 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005587|Ga0066654_10065066 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300005598|Ga0066706_10346781 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300005602|Ga0070762_11118205 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005610|Ga0070763_10393948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300005617|Ga0068859_100570327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1226 | Open in IMG/M |
| 3300005618|Ga0068864_101665206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300005841|Ga0068863_101479843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300005921|Ga0070766_10453023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300005921|Ga0070766_10575054 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005994|Ga0066789_10147372 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005995|Ga0066790_10464159 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006059|Ga0075017_100909806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300006059|Ga0075017_100968047 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006173|Ga0070716_101294196 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006174|Ga0075014_100773002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300006354|Ga0075021_10514465 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300006804|Ga0079221_10452855 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006854|Ga0075425_101252136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300006871|Ga0075434_100938159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300006881|Ga0068865_100105373 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300006954|Ga0079219_12348027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300007265|Ga0099794_10135597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1245 | Open in IMG/M |
| 3300007265|Ga0099794_10753040 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009038|Ga0099829_11121535 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300009038|Ga0099829_11568473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300009088|Ga0099830_10654257 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009088|Ga0099830_10761556 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009088|Ga0099830_11463782 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009143|Ga0099792_10022506 | All Organisms → cellular organisms → Bacteria | 2827 | Open in IMG/M |
| 3300010043|Ga0126380_10306538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300010043|Ga0126380_11125955 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010047|Ga0126382_10348491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1134 | Open in IMG/M |
| 3300010303|Ga0134082_10161515 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300010320|Ga0134109_10452009 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010358|Ga0126370_10208121 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300010358|Ga0126370_10536439 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010359|Ga0126376_11869013 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010360|Ga0126372_10257304 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300010360|Ga0126372_10331397 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300010360|Ga0126372_10399526 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300010360|Ga0126372_11012855 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300010362|Ga0126377_12035482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300010364|Ga0134066_10225319 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010400|Ga0134122_10356727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300011269|Ga0137392_10122185 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300011269|Ga0137392_10256350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
| 3300011269|Ga0137392_10960570 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300011271|Ga0137393_10220595 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300011271|Ga0137393_10248645 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300011271|Ga0137393_10409279 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012096|Ga0137389_10273962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1423 | Open in IMG/M |
| 3300012096|Ga0137389_11101955 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012189|Ga0137388_11487638 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012198|Ga0137364_10647312 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300012199|Ga0137383_10364863 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300012205|Ga0137362_10809524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300012205|Ga0137362_11170465 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012211|Ga0137377_11737053 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012351|Ga0137386_10671318 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012359|Ga0137385_10512988 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300012361|Ga0137360_10197008 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300012362|Ga0137361_10201147 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300012363|Ga0137390_10348621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
| 3300012363|Ga0137390_11542610 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012582|Ga0137358_10412046 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012685|Ga0137397_10753353 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012917|Ga0137395_10479423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300012923|Ga0137359_10384813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1245 | Open in IMG/M |
| 3300012923|Ga0137359_10572573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300012924|Ga0137413_10211216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300012924|Ga0137413_10738895 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012924|Ga0137413_11120278 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012925|Ga0137419_10762129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300012929|Ga0137404_10077760 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300012944|Ga0137410_10554226 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 945 | Open in IMG/M |
| 3300012976|Ga0134076_10380972 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012984|Ga0164309_10055731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2313 | Open in IMG/M |
| 3300014166|Ga0134079_10362911 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015242|Ga0137412_10321486 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300015245|Ga0137409_10083720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2975 | Open in IMG/M |
| 3300015264|Ga0137403_10251899 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300016294|Ga0182041_10620516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300016357|Ga0182032_10015613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4278 | Open in IMG/M |
| 3300017656|Ga0134112_10472552 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018088|Ga0187771_11449116 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300018468|Ga0066662_10653241 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300019887|Ga0193729_1262470 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300020062|Ga0193724_1004768 | All Organisms → cellular organisms → Bacteria | 2929 | Open in IMG/M |
| 3300020579|Ga0210407_10045980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3253 | Open in IMG/M |
| 3300020579|Ga0210407_10362708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300020579|Ga0210407_10476637 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300020580|Ga0210403_10258218 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300020580|Ga0210403_11146092 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300020581|Ga0210399_10246357 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300020581|Ga0210399_10404436 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300020581|Ga0210399_10429419 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300020581|Ga0210399_11598141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300020583|Ga0210401_11401348 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021088|Ga0210404_10276509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300021088|Ga0210404_10295089 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300021168|Ga0210406_10046657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3811 | Open in IMG/M |
| 3300021168|Ga0210406_10596140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300021170|Ga0210400_10011087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7252 | Open in IMG/M |
| 3300021171|Ga0210405_10449197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300021178|Ga0210408_10859160 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300021181|Ga0210388_10836121 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300021181|Ga0210388_11457044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300021401|Ga0210393_10268991 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300021420|Ga0210394_10024715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5481 | Open in IMG/M |
| 3300021420|Ga0210394_10580985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300021420|Ga0210394_11033527 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300021432|Ga0210384_11853706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300021475|Ga0210392_10964822 | Not Available | 638 | Open in IMG/M |
| 3300021477|Ga0210398_10701191 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300021478|Ga0210402_11740857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300021479|Ga0210410_10205661 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300021559|Ga0210409_10631076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300021560|Ga0126371_10427510 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300024283|Ga0247670_1037689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300024288|Ga0179589_10477144 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300024330|Ga0137417_1497916 | Not Available | 2609 | Open in IMG/M |
| 3300024331|Ga0247668_1109363 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300025475|Ga0208478_1011552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1956 | Open in IMG/M |
| 3300025916|Ga0207663_10665299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300026301|Ga0209238_1008437 | All Organisms → cellular organisms → Bacteria | 4075 | Open in IMG/M |
| 3300026322|Ga0209687_1216175 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300026335|Ga0209804_1079617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1536 | Open in IMG/M |
| 3300026355|Ga0257149_1038071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300026514|Ga0257168_1153224 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300026547|Ga0209156_10254450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300026551|Ga0209648_10371691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300026557|Ga0179587_10778826 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300027172|Ga0208098_1002402 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300027381|Ga0208983_1001280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3898 | Open in IMG/M |
| 3300027591|Ga0209733_1055884 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300027629|Ga0209422_1017783 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300027629|Ga0209422_1133261 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300027635|Ga0209625_1063623 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300027643|Ga0209076_1000110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10484 | Open in IMG/M |
| 3300027651|Ga0209217_1053073 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300027678|Ga0209011_1028442 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300027787|Ga0209074_10076744 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300027862|Ga0209701_10211513 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300027875|Ga0209283_10029082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3437 | Open in IMG/M |
| 3300027875|Ga0209283_10366775 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300027875|Ga0209283_10570149 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300027882|Ga0209590_10795865 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027884|Ga0209275_10047487 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300027884|Ga0209275_10107597 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300027884|Ga0209275_10812481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300027889|Ga0209380_10433583 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300027910|Ga0209583_10361807 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027915|Ga0209069_10295629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300028281|Ga0247689_1042363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300028800|Ga0265338_10403074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300028906|Ga0308309_10861020 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300028906|Ga0308309_11091989 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300028906|Ga0308309_11338340 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300029636|Ga0222749_10819569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300030878|Ga0265770_1001816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2906 | Open in IMG/M |
| 3300031057|Ga0170834_102829388 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031057|Ga0170834_111077876 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300031128|Ga0170823_12948818 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031128|Ga0170823_16688149 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300031231|Ga0170824_117708499 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031469|Ga0170819_16033268 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031573|Ga0310915_10268412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300031708|Ga0310686_102751496 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031708|Ga0310686_108918530 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031708|Ga0310686_114592176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3452 | Open in IMG/M |
| 3300031718|Ga0307474_11124705 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031720|Ga0307469_12336956 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031744|Ga0306918_10952599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300031748|Ga0318492_10593296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300031754|Ga0307475_11580971 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031819|Ga0318568_11042836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300031823|Ga0307478_11601461 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031890|Ga0306925_10119256 | All Organisms → cellular organisms → Bacteria | 2822 | Open in IMG/M |
| 3300031897|Ga0318520_10496241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300031962|Ga0307479_10027501 | All Organisms → cellular organisms → Bacteria | 5403 | Open in IMG/M |
| 3300031962|Ga0307479_10649826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300031962|Ga0307479_11794332 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031962|Ga0307479_12025882 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032174|Ga0307470_10540898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300032180|Ga0307471_100585971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1273 | Open in IMG/M |
| 3300032180|Ga0307471_102086673 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300032180|Ga0307471_102917060 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.15% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1007493051 | 3300000364 | Soil | LXLPYWLGFYGSEDCLRCRVMDAVRRRIEGSRASAXIEQWLAR* |
| F14TC_1008019082 | 3300000559 | Soil | HLPYWLGFYGSEDCLRCRVMDAVRRRIEGSRASALIEQWLAR* |
| JGI1027J12803_1034893522 | 3300000955 | Soil | PGEIHLPYWLGFYGTHENLRCRVMDAVRRRVEGARASALFEQWLAA* |
| JGI12683J13190_10006684 | 3300001089 | Forest Soil | LHLPYWLGFYGGAGIVRCRVMDAVRRRIEGAKASAFFEEWLTA* |
| JGI12636J13339_10052831 | 3300001154 | Forest Soil | FKLRRRGLAIIREPVEMYLPYWLGFHEKRGAITCRVMDAVRRRIEGAKASAFFEEWLTA* |
| JGI12630J15595_100179253 | 3300001545 | Forest Soil | QEFCMPYWLGFYGKDGTLRCRVMDAVRRRMEGPKAVSLFETWLIEQ* |
| JGI12630J15595_100294612 | 3300001545 | Forest Soil | FYSSGDIVRCRVMDAVRRRIEGAKASAFFEQWLAA* |
| JGI12635J15846_100241431 | 3300001593 | Forest Soil | HLPYWLGFYGGAGIVRCRVMDAVRRRIEGAKASAFFEEWLTA* |
| JGI12635J15846_101016113 | 3300001593 | Forest Soil | EMYLPYWLGFHEKRGAITCRVMDAVRRRIEGAKASAFFEEWLTA* |
| JGI12635J15846_101165342 | 3300001593 | Forest Soil | HLPYWLAFYGSNGAAKCRVMDAVRRRIEGAKAASFFEEWLAA* |
| JGI12053J15887_103454082 | 3300001661 | Forest Soil | YGGSGSVRCRVLDAVRRRIEGAKASAFFEQWLAA* |
| JGIcombinedJ26739_1008168552 | 3300002245 | Forest Soil | YWLGFYGNTTLRCRVMDAVRRRIEGAKASALFEAWLAA* |
| JGIcombinedJ26739_1008971141 | 3300002245 | Forest Soil | YWLGFYASGGIVRCRVMDAVRRRIEGAKASAFFEQWLAA* |
| JGIcombinedJ26739_1017740401 | 3300002245 | Forest Soil | PLELHMPYWLGFYGNVTLRCRVLNAVRRRMEGAKASALFESWLAA* |
| JGIcombinedJ26739_1018875012 | 3300002245 | Forest Soil | WLGFYSSGEVVRCRVMDAVRRRIEGAKASAFFEQWLAA* |
| JGIcombinedJ51221_102696402 | 3300003505 | Forest Soil | DLQLEIALLPLELHVPYWLGFYGNAAARCRVLNAVRRRIEGAKASALFESWLAA* |
| Ga0062385_100930542 | 3300004080 | Bog Forest Soil | AREAAELHLPYWLGFYGANSGVRCRVMDAVRRRMEGAKASAFFEEWLAA* |
| Ga0062387_1005411122 | 3300004091 | Bog Forest Soil | ELHLPYWLAFYGSNGTVKCRVMDAVRRRIEGAKASSFFEEWLAA* |
| Ga0062387_1010029232 | 3300004091 | Bog Forest Soil | GVEFHIPYWLGFYGDEKIARCRVMDAVRRRVEGAKASAFFEEWLAA* |
| Ga0062387_1012253431 | 3300004091 | Bog Forest Soil | LPYWLAFYGSDGSVKCRVMDAVRRRIEGAKASSFFEEWLAA* |
| Ga0066395_109692802 | 3300004633 | Tropical Forest Soil | AVQLEIEKLPDEIYLPYWLGFYGPRENLRCRVMDAVRRRIEGARASALFEQWLAA* |
| Ga0066823_100065812 | 3300005163 | Soil | LPYWLGFYGENNSLRCRVMDAVRRRVEGAKASALFEQWLAA* |
| Ga0066676_104476691 | 3300005186 | Soil | GCELHLPYWLGFHERDGSVRCRVMDAVRRRIEGAKASAFFEQWLAA* |
| Ga0066388_1076834162 | 3300005332 | Tropical Forest Soil | LPYWLGFYGTRENLRCRVMDAVRRRIEGARASALFEQWLAT* |
| Ga0070709_105247431 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PYWLGFYGRAFLRCRVLNAVRRRMEGAKASALFESWLTA* |
| Ga0070711_1008261422 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IELETERLPGEIYLPYWLGLYGSRDGLRCRVMDAVRRRVEGAKASALFEHWLAA* |
| Ga0070708_1005441171 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PEPLELHVPYWLGFYGNVALRCRVLNAVRRRMEGAKACALFESWLAA* |
| Ga0070707_1004755822 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QTEQLPGEIYLPYWLGFYGSSQDLRCRVIDAVRRRIEGARASALFEHWLAA* |
| Ga0073909_100420021 | 3300005526 | Surface Soil | YGTREDLRCRVLDAVRRRIEGAKASALFEQWLAA* |
| Ga0066661_101998942 | 3300005554 | Soil | AREPGEMYLPYWLGFYGTNGLVHCRVMDAVRRRIEGAKASAFFEKWLTA* |
| Ga0066698_109007432 | 3300005558 | Soil | LHLPYWLGLYGRESSVRCRVMDAVRRKIEGAKASAFFEHWLAA* |
| Ga0066699_107685111 | 3300005561 | Soil | PGEIHLPYWLGFYGPPANLRFRVMDAVRRRIEGAKVSMLFEEWFAA* |
| Ga0066691_104330871 | 3300005586 | Soil | PVRCELHLPYWLGFYERDGTVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0066654_100650661 | 3300005587 | Soil | LEISLVPCELDLPYWLGFYGRESSVRCRVMDALRRRIEGTKASAFFEHWLAV* |
| Ga0066706_103467812 | 3300005598 | Soil | RLDIAREQGEVYLPYWLGFYGRNGLVRCRVMDALRRRVEGAKASAFFEQWLVA* |
| Ga0070762_111182051 | 3300005602 | Soil | RERIDLHLPYWLAFYGDTTARCRVMDATRRRIEGAKASAFFEQWLAA* |
| Ga0070763_103939481 | 3300005610 | Soil | AFYGRDTVRCRVLDATRNRIEGAKATALFETWLAS* |
| Ga0068859_1005703272 | 3300005617 | Switchgrass Rhizosphere | RPPGEIHLPYWLGFYGTHENLRCRVMDAVRRRVEGARASALFEQWLAA* |
| Ga0068864_1016652061 | 3300005618 | Switchgrass Rhizosphere | LPGELHLPYWLGFYGTHENLRCRVMDAVRRRVEGARASALFEQWLAA* |
| Ga0068863_1014798432 | 3300005841 | Switchgrass Rhizosphere | PYWLGFYGTRENLSCRVMDAVRRRIEGARASALFEQWLTA* |
| Ga0070766_104530231 | 3300005921 | Soil | WLGFYGDERTVRCRVLDAVRRRIEGAKASAFFEQWLAA* |
| Ga0070766_105750542 | 3300005921 | Soil | FYGSHEAAKCRVMDAVRRRIEGAKAASFFEEWLAA* |
| Ga0066789_101473722 | 3300005994 | Soil | PDLVHLPYWLGFYASGEIVRCRVMDAVRRRIEGAKASAFFEQWLAA* |
| Ga0066790_104641592 | 3300005995 | Soil | QVTREAAEFYVPYWLAFHGDAKAVRCRVLNAVRRRIEGAKASAFFEQWLAA* |
| Ga0075017_1009098061 | 3300006059 | Watersheds | HLPYWLAFYGNNGAAKCRVMDAVRRRIEGAKAASFFEEWLAA* |
| Ga0075017_1009680471 | 3300006059 | Watersheds | QLEIALLPLELHVPYWLGFYGNAAARCRVLNAVRRRIEGAKASALFESWLAA* |
| Ga0070716_1012941961 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LELHIPYWLGFYGRAFLRCRVLNAVRRRMEGAKAAALFESWLTA* |
| Ga0075014_1007730021 | 3300006174 | Watersheds | IEFSMPYWLGLYGPDGGLRCRVMDAVRRRMEGEKATELFENWLAA* |
| Ga0075021_105144652 | 3300006354 | Watersheds | RSELYLPYWLGFHERDGAVRCRVMDAVRRRMEGAKACAFFEHWLAA* |
| Ga0079221_104528552 | 3300006804 | Agricultural Soil | LTFIDTMHLPYWLGFYGRESSVRCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0075425_1012521361 | 3300006854 | Populus Rhizosphere | LPVEIYLPYWLGFYGTRETLRCRVMDAVRRRIEGAKASALFEQWLAA* |
| Ga0075434_1009381592 | 3300006871 | Populus Rhizosphere | KLEIERLPGEIHLPYWLGFYGTHENLRCRVMDAVRRRVEGARASALFEQWLAA* |
| Ga0068865_1001053732 | 3300006881 | Miscanthus Rhizosphere | LEIERLPDEIHLPYWLGFYGTRENLSCRVMDAVRRRIEGARASALFEQWLTA* |
| Ga0079219_123480272 | 3300006954 | Agricultural Soil | GCELHLPYWLGFHERDGSVHCRVMDAIRRRIEGAKASAFFEQWLAA* |
| Ga0099794_101355972 | 3300007265 | Vadose Zone Soil | EITPVRCELHLPYWLGFYERDGSVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0099794_107530401 | 3300007265 | Vadose Zone Soil | TPVRCELHLPYWLGFYERDGSVRCRVMDAVRRRMEGAKECAFFEQWLAA* |
| Ga0099829_111215352 | 3300009038 | Vadose Zone Soil | DARLEITPVGCELHLPYWLGFYGRDGAVRCRVMDAVRRRMEGAKACAFFEHWLAA* |
| Ga0099829_115684731 | 3300009038 | Vadose Zone Soil | RDARIEITPVRCELHLPYWLGFYERDGSVRCRVMDAVRRHMEGAKACAFFEQWLAA* |
| Ga0099830_106542571 | 3300009088 | Vadose Zone Soil | IPYWLGFYGNRVVRCRVMDAVRRRIEGAKASHFFEQWLAA* |
| Ga0099830_107615562 | 3300009088 | Vadose Zone Soil | LEPLELHVPYWLGFYGNAAARCRVLNAVRRRMEGAKASALFESWLAA* |
| Ga0099830_114637822 | 3300009088 | Vadose Zone Soil | ARIEITPVRCELHLPYWLGFYERDGAVRCRVMDAVRRHMEGAKACAFFEQWLAA* |
| Ga0099792_100225063 | 3300009143 | Vadose Zone Soil | PYWLGFHERDGAVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0126380_103065381 | 3300010043 | Tropical Forest Soil | LGFYGSERLRCRVLDAVRRRVEGAKASALFEEWLAA* |
| Ga0126380_111259552 | 3300010043 | Tropical Forest Soil | YGHAGTAKCRVLDAVRRRIEGGKAASFFEEWLAA* |
| Ga0126382_103484913 | 3300010047 | Tropical Forest Soil | SAHLEISFVPCELHLPYWLGFYGRNTSARCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0134082_101615152 | 3300010303 | Grasslands Soil | FYGRNGSMRCRVMDALRRRVEGAKASAFFEQWLVA* |
| Ga0134109_104520091 | 3300010320 | Grasslands Soil | HARLEISLVPDELHLPYWLGLYGRESSVRCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0126370_102081211 | 3300010358 | Tropical Forest Soil | IHLPYWLGFYGRGDNLRCRVMDAVRRRIEGARASALFEQWLAA* |
| Ga0126370_105364391 | 3300010358 | Tropical Forest Soil | LHLPYWLGFYGRESSVRCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0126376_118690131 | 3300010359 | Tropical Forest Soil | PYWLGFYGANNSLRCRVMDAVRRRIEGAKASAFFEQWLAA* |
| Ga0126372_102573041 | 3300010360 | Tropical Forest Soil | VPCELHLPYWLGFYGRASSARCRVMDAVRRRIEGEKASAFFEHWLAA* |
| Ga0126372_103313972 | 3300010360 | Tropical Forest Soil | GEIYLPYWLAFYGPGNALRCRVMDAVRRRLEGAKASAFFEQWLAA* |
| Ga0126372_103995262 | 3300010360 | Tropical Forest Soil | RCELYLPYWLGFYGRSNLARCRVMDAVRRRMEGAKASAFFEHWLAA* |
| Ga0126372_110128552 | 3300010360 | Tropical Forest Soil | WLAFYGSNNALRCRAMDAVRRRLEGAKACTFFEQWLAV* |
| Ga0126377_120354821 | 3300010362 | Tropical Forest Soil | IHLPYWLGFYGTSQTLRCRVMDAVRRRMEGARATALVEQWLTA* |
| Ga0134066_102253192 | 3300010364 | Grasslands Soil | VPCELHLPYWLGFYGRESSVRCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0134122_103567271 | 3300010400 | Terrestrial Soil | RLPGEIHLPYWLGFYGTRHNLRCRVMDAVRRRIEGARASALFEQWLAA* |
| Ga0137392_101221851 | 3300011269 | Vadose Zone Soil | YGTSEDLRCRAMDAVRRRIEGARASALFEHWLAA* |
| Ga0137392_102563502 | 3300011269 | Vadose Zone Soil | IEITPVRCELHLPYWLGFYERDGSVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0137392_109605701 | 3300011269 | Vadose Zone Soil | KVRDLNLEIAREPLELHIPYWLGFYGHVAAHCRVLNAVRRRMEGAKASALFESWLAA* |
| Ga0137393_102205952 | 3300011271 | Vadose Zone Soil | LGFYGNAAARCRVLNAVRRRMEGAKASVLFESWLAA* |
| Ga0137393_102486451 | 3300011271 | Vadose Zone Soil | GEIHLPYWLGFYGASDALRCRVMDAVRRRLEGAKASAFFEQWLAA* |
| Ga0137393_104092792 | 3300011271 | Vadose Zone Soil | LEIAREPLELHVPYWLGFYGHAAARCRVLNAVRRRMEGAKASALFESWLAA* |
| Ga0137389_102739621 | 3300012096 | Vadose Zone Soil | LGFYERDGSVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0137389_111019551 | 3300012096 | Vadose Zone Soil | VPYWLAFYGDRFLRCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0137388_114876382 | 3300012189 | Vadose Zone Soil | PYWLGFYERDGSVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0137364_106473121 | 3300012198 | Vadose Zone Soil | EVYLPYWLGFYGRNGSMRCRVMDALRRRVEGAKASAFFEQWLVA* |
| Ga0137383_103648632 | 3300012199 | Vadose Zone Soil | YGRNGSMRCRVMDALRRRVEGAKASAFFEQWLVA* |
| Ga0137362_108095242 | 3300012205 | Vadose Zone Soil | GFYGGGETARCRVLDAVRRRIEGAKASAFFEQWLAA* |
| Ga0137362_111704652 | 3300012205 | Vadose Zone Soil | VSCELHLPYWLGFHERDGAVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0137377_117370531 | 3300012211 | Vadose Zone Soil | DIAREQGEVYLPYWLGFYGRNVSVRCRVMDALRRRVEGAKASAFFEQWLVA* |
| Ga0137386_106713181 | 3300012351 | Vadose Zone Soil | YWLGFYERSGSVHCRVMDAIRRRMEGAKASAFFEQWLAA* |
| Ga0137385_105129881 | 3300012359 | Vadose Zone Soil | EITPVRFELHLPYWLGFHERDGSVHCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0137360_101970081 | 3300012361 | Vadose Zone Soil | LHLPYWLGFYERDGAVRCRVMDAVRRRMEGAKACAFFEQWLAA* |
| Ga0137361_102011472 | 3300012362 | Vadose Zone Soil | PLELHVPYWLGFYGNTVARCRAMDAVRRRIEGAKASALFESWLAA* |
| Ga0137390_103486212 | 3300012363 | Vadose Zone Soil | DARIEITPVRCELHLPYWLGFHERGGAVRCRVMDAVRRRMEGSKACAFFEQWLAA* |
| Ga0137390_115426101 | 3300012363 | Vadose Zone Soil | HVPYWLAFYGDRFLRCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0137358_104120462 | 3300012582 | Vadose Zone Soil | VPYWLGFYGHVAARCRVLNAVRRRMEGAKASALFESWLAA* |
| Ga0137397_107533532 | 3300012685 | Vadose Zone Soil | ELHVPYWLGFYGHVAARCRVLNAVRRRMEGAKASALFESWLAA* |
| Ga0137395_104794232 | 3300012917 | Vadose Zone Soil | RDARIEITPVRCELHLPYWLGFYERDGAVRCRVMDAVRRRMEGAKARAFFEQWLAA* |
| Ga0137359_103848131 | 3300012923 | Vadose Zone Soil | ETEQLPGEIYLPYWLGFYGSSRDLRCRVMDAVRRRIEGARASALFEHWLAA* |
| Ga0137359_105725734 | 3300012923 | Vadose Zone Soil | GLAVVHEPLELHLPYWLGLYGARGVVRCRVMDAVRRCVEGAKASAFFEQWLAA* |
| Ga0137413_102112162 | 3300012924 | Vadose Zone Soil | HFAYWLAFYGKETVRCRVLDATRGKIEGAKAAALFESWLAA* |
| Ga0137413_107388951 | 3300012924 | Vadose Zone Soil | KVRDLNLEIAREPLDLHVPYWLGFYGHVAARCRVLNAVRRRMEGAKASALFESWLAA* |
| Ga0137413_111202781 | 3300012924 | Vadose Zone Soil | LEIAREPLELHVPYWLGFYGHVAARCRVLNAVRRRMEGAKASALFESWLAA* |
| Ga0137419_107621291 | 3300012925 | Vadose Zone Soil | PVSCELHLPYWLGFHERGGAVHCRVMDAVRRRIEGAKASAFFEHWLAA* |
| Ga0137404_100777601 | 3300012929 | Vadose Zone Soil | RLDITREACEIYLPYWLGFYGGGETARCRVMDAVRRRIEGGKASAFFEQWLAA* |
| Ga0137410_105542262 | 3300012944 | Vadose Zone Soil | MLHLPYWLGFYGKPEDLRCRAMDAVRRRIEGARASALFEHWLAA* |
| Ga0134076_103809721 | 3300012976 | Grasslands Soil | TPVGCALHLPYWLGFHERYGSVHCRVMDAIRRRIEGSKASAFFEQWLAA* |
| Ga0164309_100557312 | 3300012984 | Soil | FYGTREDLRCRVLDAVRRRVEGAKASALFESWLAA* |
| Ga0134079_103629111 | 3300014166 | Grasslands Soil | DIAREQGEVYLPYWLGFYGRNGSMRCRVMDALRRRVEGAKASAFFEQWLVA* |
| Ga0137412_103214861 | 3300015242 | Vadose Zone Soil | YWLGFYGHVAARCRVLNAVRRRMEGAKASALFETWLAA* |
| Ga0137409_100837201 | 3300015245 | Vadose Zone Soil | FYGGGETARCRVLDAVRRRIEGAKASAFFEQWLAA* |
| Ga0137403_102518991 | 3300015264 | Vadose Zone Soil | WLGFYGASDALRCRVMDAVRRRLEGAKASAFFEQWLAA* |
| Ga0182041_106205161 | 3300016294 | Soil | KLPGEIHFPYWLGFYGRRENLRCRVMDAVRRRIEGARAAALFEQWLAT |
| Ga0182032_100156134 | 3300016357 | Soil | FYGSEHRLHCRVMDAVRRRMEGAKATALFERWLAA |
| Ga0134112_104725522 | 3300017656 | Grasslands Soil | YWLGFYGASDALSCRAMDAVRRKLEGAKASAFFEQWLAA |
| Ga0187771_114491162 | 3300018088 | Tropical Peatland | LGFYERDGAVRCRVMDAVRRRIEGAKASAFFEHWLAA |
| Ga0066662_106532412 | 3300018468 | Grasslands Soil | AREQGEVYLPYWLGFYGRNGLVRCRVMDALRRRVEGAKASAFFEQWLVA |
| Ga0193729_12624702 | 3300019887 | Soil | LRDYKLQCTREPVDLHLPYWLAFYGDDTARCRVMDAVRRRIEGAKASAFFEEWLAA |
| Ga0193724_10047683 | 3300020062 | Soil | FYGTPEDLRCRAMDAVRRRIEGARASALFEHWLAA |
| Ga0210407_100459801 | 3300020579 | Soil | LQLEIALLPLELYVPYWLGFYGNAAARCRVLNAVRRRMEGAKASALFESWLAG |
| Ga0210407_103627082 | 3300020579 | Soil | WLGFHERAGAVRCRVMDAVRRRMEGAKACAFFEHWLAA |
| Ga0210407_104766372 | 3300020579 | Soil | LHLPYWLAFYGSNGAAKCRVMDAVRRRIEGAKAASFFEEWLAA |
| Ga0210403_102582181 | 3300020580 | Soil | AREPGEMYLPYWLGFYGSSGSVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210403_111460921 | 3300020580 | Soil | LACIRERIDLHLPYWLAFYGDTTARCRVMDATRRRIEGAKASAFFEQWLAA |
| Ga0210399_102463571 | 3300020581 | Soil | LDITREPSEIYLPYWLGFYGGGETVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210399_104044362 | 3300020581 | Soil | VHLPYWLAFYGSNGAAKCRVMDAVRRRIEGAKAASFFEEWLAA |
| Ga0210399_104294192 | 3300020581 | Soil | WLAFYGNNSAAKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0210399_115981412 | 3300020581 | Soil | MPYWLGFYGTDGTLRCRVMDAVRRRMEGSKATALFETWLASE |
| Ga0210401_114013481 | 3300020583 | Soil | DITREPSEIYLPYWLGFYGGGETVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210404_102765091 | 3300021088 | Soil | RHLRLDITREPSEVYLPYWLGFYGGGETVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210404_102950892 | 3300021088 | Soil | DARLEITPVRCELHLPYWLGFHERGGSVHCRVMDAVRRRMEGAKAAAFFEQWLAA |
| Ga0210406_100466571 | 3300021168 | Soil | LPYWLAFYGSNETAKCRVMDAVRRRIEGSKARSFFEEWLAA |
| Ga0210406_105961401 | 3300021168 | Soil | MPYWLGFYGVDGRLRCRVMDAVRRRMEGTKASQLFENWLEAA |
| Ga0210400_100110876 | 3300021170 | Soil | LPLELYVPYWLGFYGNAAARCRVLNAVRRRMEGAKASALFESWLAG |
| Ga0210405_104491972 | 3300021171 | Soil | KLRQLRLDITREPSEIYLPYWLGFYGGGETVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210408_108591601 | 3300021178 | Soil | WLGFYSSSEIVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210388_108361212 | 3300021181 | Soil | PYWLAFYGQRTAHCRVMDAVRHRIEGAKASALFEQWLAG |
| Ga0210388_114570441 | 3300021181 | Soil | RGLRLQIQKSAIEFSMPYWLGLFGPDGGLRCRVMDAVRRRMEGEKATELFENWLAA |
| Ga0210393_102689911 | 3300021401 | Soil | LKVEIERMPIELHLPYWLAFYGSHGAVKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0210394_100247151 | 3300021420 | Soil | VPYWLGFYGDAKIARCRVMDAVRRRVEGAKASAFFEEWLAA |
| Ga0210394_105809851 | 3300021420 | Soil | YLPYWLGFYGGGETVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210394_110335272 | 3300021420 | Soil | PYWLGFYSSSEIVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0210384_118537062 | 3300021432 | Soil | WLGFYGGGETVRCRVLDAVRRRIEGAKASAFFEQWLAA |
| Ga0210392_109648221 | 3300021475 | Soil | IERMPLNLHLAYWLAFYGKDTARCRVLDATRNRIEGGKASALFESWLSSEPEPKA |
| Ga0210398_107011912 | 3300021477 | Soil | ERMPMEIHLPYWLAFYGSNGAAKCRVMDAVRRRIEGGKASSFFEEWLAA |
| Ga0210402_117408571 | 3300021478 | Soil | CELHLPYWLGFHERAGAVRCRVMDAVRRRMEGAKACAFFEHWLAA |
| Ga0210410_102056612 | 3300021479 | Soil | VDIERMPVELHLPYWLAFYGSNGAAKCRVMDAVRRRIEGAKAASFFEEWLAT |
| Ga0210409_106310761 | 3300021559 | Soil | MPYWLGLYGPDGGLRCRVMDAVRRRMEGEKAAELFENWLAA |
| Ga0126371_104275102 | 3300021560 | Tropical Forest Soil | YLPYWLGFYGRSSSARCRVMDAVRRRIEGGKASAFFERWLAA |
| Ga0247670_10376892 | 3300024283 | Soil | ERLPGEIHLPYWLGFYGTQENLRCRVMDAVRRRVEGARASALFEQWLAA |
| Ga0179589_104771441 | 3300024288 | Vadose Zone Soil | REPLELHVPYWLGFYGHVAARCRVLNAVRRRMEGAKASALFETWLAA |
| Ga0137417_14979164 | 3300024330 | Vadose Zone Soil | LHVPYWLGFYGNAAARCRVLNAVRRRMEGAKASALRFESWLAA |
| Ga0247668_11093631 | 3300024331 | Soil | SLEIEVLPAEIHLPYWLGFYGASDMLRCRVMDAVRRRLEGARASAFFEQWLAA |
| Ga0208478_10115522 | 3300025475 | Arctic Peat Soil | IIPFAIPYWLGFYGQDGTLGCRVLDAVRGRMEGQKATVFFERWLMEE |
| Ga0207663_106652991 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RIELETERLPGEIYLPYWLGLYGSRDGLRCRVMDAVRRRVEGAKASALFEHWLAA |
| Ga0207665_100067791 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LEIERLPGEIHLPYWLGFYGTQENLRCRVMDAVRRRVEGARASALFEQWLAA |
| Ga0209238_10084373 | 3300026301 | Grasslands Soil | EASLEIEAVPGEIHLPYWLGFYGASDALRCRVMDAVRRRLEGAKASAFFEQWLAA |
| Ga0209687_12161752 | 3300026322 | Soil | LHLPYWLGFYGRENSVSCRVMDAVRRRIEGAKASVFFEHWLAA |
| Ga0209804_10796171 | 3300026335 | Soil | ARLEITPVDCALHLPYWLGFHERHGSVHCRVMDAIRRRIEGSKASAFFEQWLAA |
| Ga0257149_10380711 | 3300026355 | Soil | GFYGTSEDLRCRAMDAVRRRIEGARASVMFEHWLAA |
| Ga0257168_11532242 | 3300026514 | Soil | WLGFYGNAAARCRVLNAVRRRMEGAKASALFESWLAA |
| Ga0209156_102544501 | 3300026547 | Soil | DARLEITPVGCELHLPYWLGFHERDGSVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0209161_104539232 | 3300026548 | Soil | ASLEIEALPGEIHLPYWLGFYGASDTLRCRVMDAVRRRLEGAKASAFFEQWLAA |
| Ga0209648_103716912 | 3300026551 | Grasslands Soil | PCGLHLPYWLGFHERDGLVHCRVMDAVRRRMEGAKASALFEQWLAA |
| Ga0179587_107788261 | 3300026557 | Vadose Zone Soil | LHLPYWLGFHERAGAVRCRVMDAVRRRMEGAKACAFFEHWLAA |
| Ga0208098_10024021 | 3300027172 | Forest Soil | FYGSHGAVKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0208983_10012801 | 3300027381 | Forest Soil | LPEGQRGIFVGGGGSVRCRVLDAVRRRIEGAKASAFFEQWLAA |
| Ga0209733_10558842 | 3300027591 | Forest Soil | DRVHLPYWLGFYSSGEIVRCRVMDAVRRRIEGAKASAFFEQWLTA |
| Ga0209422_10177832 | 3300027629 | Forest Soil | LGFYSGGEIVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0209422_11332611 | 3300027629 | Forest Soil | GFYSSGEIVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0209625_10636232 | 3300027635 | Forest Soil | WLAFYGNRVVRCRVMDAVRRRIEGAKASQFFEQWLAA |
| Ga0209076_10001109 | 3300027643 | Vadose Zone Soil | GFYGNAAARCRVLNAVRRRMEGAKASALFESWLAA |
| Ga0209217_10530731 | 3300027651 | Forest Soil | WPYWLGFYASGGIVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0209011_10284421 | 3300027678 | Forest Soil | WLAFYGNTVLRCRVMDAVRRRIEGAKASAFFEEWLAAA |
| Ga0209074_100767443 | 3300027787 | Agricultural Soil | ELHLPYWLAFYGTNGTAKCRVMDAVRRRIEGAKASSFFEQWLAA |
| Ga0209701_102115131 | 3300027862 | Vadose Zone Soil | YWLGFYGARGVVRCRVLDAVRRRVEGAKASAFFEQWLAV |
| Ga0209283_100290823 | 3300027875 | Vadose Zone Soil | YWLGFHERDGAVRCRVMDAVRRRMEGAKACAFFEQWLAA |
| Ga0209283_103667752 | 3300027875 | Vadose Zone Soil | LEIALEPIELHVPYWLGFYGNAAARCRVLNAVRRRMEGAKASALFESWLAA |
| Ga0209283_105701492 | 3300027875 | Vadose Zone Soil | LELHVPYWLGFYGHAAARCRVLNAVRRRMEGAKASALFESWLAA |
| Ga0209590_107958652 | 3300027882 | Vadose Zone Soil | PVSCELHLPYWLGFHERDGAVRCRVMDAVRRRMEGAKACAFFEQWLAA |
| Ga0209275_100474871 | 3300027884 | Soil | ALKVDITRMPGELHLPYWLAFYGSNETAKCRVMDAVRRRIEGSKARSFFEEWLAA |
| Ga0209275_101075972 | 3300027884 | Soil | LHLPYWLAFYGSNGTAKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0209275_108124811 | 3300027884 | Soil | SMPYWLGLYGPDGGLRCRVMDAVRRRMEGEKAAELFENWLAA |
| Ga0209380_104335831 | 3300027889 | Soil | YWLVFYGSHEAAKCRVMDAVRRRIEGAKAASFFEEWLAA |
| Ga0209583_103618071 | 3300027910 | Watersheds | LYLPYWLGFYGRKGLLHCRVMDAVRRRIEGAKASTFFEQWLAA |
| Ga0209069_102956292 | 3300027915 | Watersheds | MPYWLGFYGTDGTLRCRVMDAIRRRMEGSKAATLFETWLISD |
| Ga0247689_10423631 | 3300028281 | Soil | RLPGEIHLPYWLGFYGTQENLRCRVMDAVRRRVEGARASALFEQWLAA |
| Ga0265338_104030741 | 3300028800 | Rhizosphere | QFHIPYWLGIFGKDGHLRCRTIDAVRGRIEGQKVTRLFETWLAN |
| Ga0308309_108610202 | 3300028906 | Soil | IDLHLPYWLAFYGDATARCRVMDATRRRIEGAKASAFFEQWLAA |
| Ga0308309_110919891 | 3300028906 | Soil | WLGFYGDTRAVKCRVLDAVRRRVEGAKATAFFEQWLAA |
| Ga0308309_113383401 | 3300028906 | Soil | YWLAFYGYETPRCRVLDAVRRRIEGAKASAFFEEWLAA |
| Ga0222749_108195691 | 3300029636 | Soil | LHLPYWLGFHERDGAVRCRVMDAVRRRMEGAKACAFFEHWLAA |
| Ga0265770_10018163 | 3300030878 | Soil | AFYGSNGAVKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0170834_1028293881 | 3300031057 | Forest Soil | LGFYERDGAVRCRVMDAVRRRMEGAKACAFFEQWLAA |
| Ga0170834_1110778761 | 3300031057 | Forest Soil | RTPVELHLPYWLAFYGNNGAAKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0170823_129488182 | 3300031128 | Forest Soil | FYMPYWLGFYQGRGAVRCRVLDAVRRRVEGAKASAFFEQWLAA |
| Ga0170823_166881492 | 3300031128 | Forest Soil | REFKLDCTRESIDLHLPYWLAFYGEDTARCRVMDAVRRRIEGAKASAFFEEWLAA |
| Ga0170824_1177084991 | 3300031231 | Forest Soil | MPLELHLPYWLAFYGNNGTAKCRVMDAVRRRIEGAKAASFFEEWLAA |
| Ga0170819_160332682 | 3300031469 | Forest Soil | GFYSSGELVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0310915_102684122 | 3300031573 | Soil | FPYWLGFYGRRENLRCRVMDAVRRRIEGARAAALFEQWLAT |
| Ga0310686_1027514962 | 3300031708 | Soil | ERMPVELHLPYWLAFYGSEGSVKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0310686_1089185301 | 3300031708 | Soil | LPYWLAFYGSNGAVKCRVMDAVRRRIEGAKASSFFEEWLAA |
| Ga0310686_1145921763 | 3300031708 | Soil | VELHLPYWLAFYGSNGAVKCRVMDDVRRRIEGAKASSFFEEWLAA |
| Ga0307474_111247052 | 3300031718 | Hardwood Forest Soil | PCELHMPYWLGFHERDGAVRCRVMDAVRRRMEGAKACAFFEHWLAA |
| Ga0307469_123369562 | 3300031720 | Hardwood Forest Soil | LPVEIERTPVELHLPYWLAFYGNNGAAKCRVMDAVRRRIEGAKASSFFEEWLVA |
| Ga0306918_109525992 | 3300031744 | Soil | GEIHLPYWLGFYGTSRNLRCRVMDAVRRRMEGARATALFEHWLMA |
| Ga0318492_105932962 | 3300031748 | Soil | GFYGTSRNLRCRVMDAVRRRMEGARATALFEHWLMA |
| Ga0307475_115809712 | 3300031754 | Hardwood Forest Soil | LAFYGSNGAAKCRVMDAVRRRIEGAKAASFFEEWLAT |
| Ga0318568_110428362 | 3300031819 | Soil | WLGFYGSEHRLHCRVMDAVRRRMEGAKATALFERWLAA |
| Ga0307478_116014611 | 3300031823 | Hardwood Forest Soil | GFYGDTRAVKCRVLDAVRRRVEGAKATAFFEQWLAA |
| Ga0306925_101192561 | 3300031890 | Soil | PYWLGFYGTAESLRCRAIDAVRRQIEGARASALFEQWLAA |
| Ga0318520_104962411 | 3300031897 | Soil | HLPYWLGFYGTSRNLRCRVMDAVRRRMEGARATALFEHWLMA |
| Ga0307479_100275011 | 3300031962 | Hardwood Forest Soil | LPYWLGFHERNGAVHCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0307479_106498261 | 3300031962 | Hardwood Forest Soil | RLPDEIHLPYWLGFYGTSQNLRCRVMDAVRRRVEGAKASTLFEQWLAA |
| Ga0307479_117943322 | 3300031962 | Hardwood Forest Soil | GFYGNAAARCRVLNAVRRRIEGAKASALFESWLAA |
| Ga0307479_120258821 | 3300031962 | Hardwood Forest Soil | AHLEITPVRCELHLPYWLGFHERRGSVRCRVMDAVRRRMEGAKACAFFEQWLAA |
| Ga0307470_105408981 | 3300032174 | Hardwood Forest Soil | ITRERCEIYLPYWLGFYGAGETARCRVMDAVRRRIEGAKASAFFEQWLAA |
| Ga0307471_1005859711 | 3300032180 | Hardwood Forest Soil | ELHLPYWLGFHERHGAVRCRVMDAVRRRMEGAKACAFFEQWLAV |
| Ga0307471_1020866731 | 3300032180 | Hardwood Forest Soil | QPLELHVPYWLGFYGNAAARCRVLNAVRRRMEGAKASALFESWLAA |
| Ga0307471_1029170602 | 3300032180 | Hardwood Forest Soil | YWLGFYGGTGLVRCRVMDAVRRRIEGAKASAFFEQWLAA |
| ⦗Top⦘ |