| Basic Information | |
|---|---|
| Family ID | F020750 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 222 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DDEVNPIASTAAFAHFQDGHADRREGGVDQQTATLVGAYITTID |
| Number of Associated Samples | 199 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.59 % |
| % of genes near scaffold ends (potentially truncated) | 84.23 % |
| % of genes from short scaffolds (< 2000 bps) | 88.74 % |
| Associated GOLD sequencing projects | 189 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.090 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.117 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.532 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 0.00% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 5.41 |
| PF12681 | Glyoxalase_2 | 4.95 |
| PF00106 | adh_short | 4.05 |
| PF07883 | Cupin_2 | 2.25 |
| PF00296 | Bac_luciferase | 2.25 |
| PF02567 | PhzC-PhzF | 1.80 |
| PF00583 | Acetyltransf_1 | 1.80 |
| PF04134 | DCC1-like | 1.80 |
| PF07081 | DUF1349 | 1.80 |
| PF14572 | Pribosyl_synth | 1.35 |
| PF06723 | MreB_Mbl | 1.35 |
| PF04075 | F420H2_quin_red | 1.35 |
| PF07676 | PD40 | 0.90 |
| PF00581 | Rhodanese | 0.90 |
| PF01022 | HTH_5 | 0.90 |
| PF03992 | ABM | 0.90 |
| PF07992 | Pyr_redox_2 | 0.90 |
| PF00440 | TetR_N | 0.90 |
| PF04657 | DMT_YdcZ | 0.90 |
| PF00027 | cNMP_binding | 0.90 |
| PF00561 | Abhydrolase_1 | 0.90 |
| PF07040 | DUF1326 | 0.90 |
| PF13673 | Acetyltransf_10 | 0.90 |
| PF02371 | Transposase_20 | 0.90 |
| PF01636 | APH | 0.90 |
| PF12730 | ABC2_membrane_4 | 0.90 |
| PF06224 | HTH_42 | 0.90 |
| PF03061 | 4HBT | 0.45 |
| PF05065 | Phage_capsid | 0.45 |
| PF07690 | MFS_1 | 0.45 |
| PF00931 | NB-ARC | 0.45 |
| PF13424 | TPR_12 | 0.45 |
| PF01208 | URO-D | 0.45 |
| PF13181 | TPR_8 | 0.45 |
| PF00239 | Resolvase | 0.45 |
| PF02683 | DsbD | 0.45 |
| PF13400 | Tad | 0.45 |
| PF00355 | Rieske | 0.45 |
| PF03069 | FmdA_AmdA | 0.45 |
| PF04069 | OpuAC | 0.45 |
| PF05532 | CsbD | 0.45 |
| PF13527 | Acetyltransf_9 | 0.45 |
| PF01243 | Putative_PNPOx | 0.45 |
| PF04261 | Dyp_perox | 0.45 |
| PF02720 | DUF222 | 0.45 |
| PF08818 | DUF1801 | 0.45 |
| PF08448 | PAS_4 | 0.45 |
| PF13560 | HTH_31 | 0.45 |
| PF00482 | T2SSF | 0.45 |
| PF04250 | DUF429 | 0.45 |
| PF02738 | MoCoBD_1 | 0.45 |
| PF13539 | Peptidase_M15_4 | 0.45 |
| PF10604 | Polyketide_cyc2 | 0.45 |
| PF11746 | DUF3303 | 0.45 |
| PF03795 | YCII | 0.45 |
| PF13298 | LigD_N | 0.45 |
| PF08327 | AHSA1 | 0.45 |
| PF05988 | DUF899 | 0.45 |
| PF06745 | ATPase | 0.45 |
| PF03704 | BTAD | 0.45 |
| PF01872 | RibD_C | 0.45 |
| PF02518 | HATPase_c | 0.45 |
| PF13417 | GST_N_3 | 0.45 |
| PF08241 | Methyltransf_11 | 0.45 |
| PF01544 | CorA | 0.45 |
| PF01844 | HNH | 0.45 |
| PF13847 | Methyltransf_31 | 0.45 |
| PF12867 | DinB_2 | 0.45 |
| PF14016 | DUF4232 | 0.45 |
| PF13336 | AcetylCoA_hyd_C | 0.45 |
| PF13183 | Fer4_8 | 0.45 |
| PF16916 | ZT_dimer | 0.45 |
| PF13460 | NAD_binding_10 | 0.45 |
| PF04828 | GFA | 0.45 |
| PF12840 | HTH_20 | 0.45 |
| PF02082 | Rrf2 | 0.45 |
| PF05231 | MASE1 | 0.45 |
| PF12697 | Abhydrolase_6 | 0.45 |
| PF08734 | GYD | 0.45 |
| PF02899 | Phage_int_SAM_1 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.25 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.80 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 1.80 |
| COG3506 | Regulation of enolase protein 1 (function unknown), concanavalin A-like superfamily | Function unknown [S] | 1.80 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 1.35 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.90 |
| COG3238 | Uncharacterized membrane protein YdcZ, DUF606 family | Function unknown [S] | 0.90 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.90 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.45 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.45 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.45 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.45 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.45 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.45 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.45 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.45 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.45 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.45 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.45 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.45 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.45 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.45 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.45 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.45 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.45 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.45 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.45 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.45 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.45 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.45 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.45 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.45 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.45 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.45 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.45 |
| COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 0.45 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.45 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.45 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.09 % |
| Unclassified | root | N/A | 9.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig190720 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 2140918007|ConsensusfromContig48233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
| 3300000891|JGI10214J12806_11657612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300000956|JGI10216J12902_111166926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1283 | Open in IMG/M |
| 3300001538|A10PFW1_11873221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 719 | Open in IMG/M |
| 3300001593|JGI12635J15846_10326913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 949 | Open in IMG/M |
| 3300002244|JGI24742J22300_10026592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
| 3300002459|JGI24751J29686_10049718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 864 | Open in IMG/M |
| 3300004022|Ga0055432_10120363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300004114|Ga0062593_102034139 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300004157|Ga0062590_100165013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1543 | Open in IMG/M |
| 3300004463|Ga0063356_103252865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300005093|Ga0062594_102281636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300005172|Ga0066683_10348311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 919 | Open in IMG/M |
| 3300005176|Ga0066679_10624282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300005178|Ga0066688_10575764 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005329|Ga0070683_100348576 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300005331|Ga0070670_100541361 | Not Available | 1038 | Open in IMG/M |
| 3300005364|Ga0070673_101045719 | Not Available | 761 | Open in IMG/M |
| 3300005435|Ga0070714_101123427 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005445|Ga0070708_100425704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1252 | Open in IMG/M |
| 3300005467|Ga0070706_101159007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
| 3300005471|Ga0070698_101073059 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300005518|Ga0070699_101839405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300005535|Ga0070684_101033792 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005536|Ga0070697_101594855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300005536|Ga0070697_101794718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300005537|Ga0070730_11058959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 504 | Open in IMG/M |
| 3300005561|Ga0066699_11077637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300005568|Ga0066703_10560752 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005575|Ga0066702_10385959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
| 3300005586|Ga0066691_10012499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4005 | Open in IMG/M |
| 3300005586|Ga0066691_10258097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
| 3300005616|Ga0068852_100444806 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300005618|Ga0068864_101975925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300006055|Ga0097691_1007241 | All Organisms → cellular organisms → Bacteria | 5934 | Open in IMG/M |
| 3300006174|Ga0075014_100687035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 594 | Open in IMG/M |
| 3300006354|Ga0075021_10182783 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300006354|Ga0075021_11185552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300006574|Ga0074056_10590553 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006580|Ga0074049_13197395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
| 3300006604|Ga0074060_12050794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300006642|Ga0075521_10670636 | Not Available | 511 | Open in IMG/M |
| 3300006854|Ga0075425_102432601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300006881|Ga0068865_101277954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
| 3300006893|Ga0073928_11230698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300006903|Ga0075426_10053600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 2881 | Open in IMG/M |
| 3300006953|Ga0074063_13266091 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300007982|Ga0102924_1114098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1327 | Open in IMG/M |
| 3300009012|Ga0066710_101023224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1275 | Open in IMG/M |
| 3300009012|Ga0066710_101586926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1004 | Open in IMG/M |
| 3300009029|Ga0066793_10881826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300009090|Ga0099827_11861527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300009137|Ga0066709_100369031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1979 | Open in IMG/M |
| 3300009137|Ga0066709_100816970 | Not Available | 1352 | Open in IMG/M |
| 3300009137|Ga0066709_100976309 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300009137|Ga0066709_102091595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 783 | Open in IMG/M |
| 3300009176|Ga0105242_11393433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300009177|Ga0105248_13006519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300009545|Ga0105237_11943539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
| 3300009551|Ga0105238_12418318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300009801|Ga0105056_1032573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
| 3300010335|Ga0134063_10606651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
| 3300010371|Ga0134125_11690907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300010375|Ga0105239_10626876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
| 3300010400|Ga0134122_13189886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300010880|Ga0126350_11780879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300011999|Ga0120148_1072718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 677 | Open in IMG/M |
| 3300011999|Ga0120148_1076975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300012001|Ga0120167_1112596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300012004|Ga0120134_1060842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300012010|Ga0120118_1123447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
| 3300012096|Ga0137389_10143720 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300012189|Ga0137388_11850050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300012198|Ga0137364_10891921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300012201|Ga0137365_10486312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300012201|Ga0137365_10925110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300012204|Ga0137374_10412944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
| 3300012206|Ga0137380_11600958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300012207|Ga0137381_10863352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300012208|Ga0137376_10860520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300012209|Ga0137379_10458100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
| 3300012353|Ga0137367_10586807 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012355|Ga0137369_10334122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| 3300012356|Ga0137371_10364114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1123 | Open in IMG/M |
| 3300012358|Ga0137368_10035850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4413 | Open in IMG/M |
| 3300012358|Ga0137368_10044752 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300012362|Ga0137361_11891118 | Not Available | 514 | Open in IMG/M |
| 3300012363|Ga0137390_11614040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300012683|Ga0137398_10747985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300012897|Ga0157285_10220442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300012908|Ga0157286_10350146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300012915|Ga0157302_10422888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300012925|Ga0137419_11566043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
| 3300012941|Ga0162652_100090759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300012951|Ga0164300_10865920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
| 3300012961|Ga0164302_10249018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1127 | Open in IMG/M |
| 3300012961|Ga0164302_11458144 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012972|Ga0134077_10334000 | Not Available | 643 | Open in IMG/M |
| 3300012984|Ga0164309_11077146 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012988|Ga0164306_11035193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300012989|Ga0164305_10300301 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300013100|Ga0157373_10094400 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300013102|Ga0157371_10222390 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300013105|Ga0157369_10138450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2576 | Open in IMG/M |
| 3300013105|Ga0157369_10935543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300013297|Ga0157378_13061070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300013763|Ga0120179_1125214 | Not Available | 564 | Open in IMG/M |
| 3300013763|Ga0120179_1131401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300013772|Ga0120158_10032597 | All Organisms → cellular organisms → Bacteria | 3940 | Open in IMG/M |
| 3300013772|Ga0120158_10126709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1465 | Open in IMG/M |
| 3300013772|Ga0120158_10286885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 803 | Open in IMG/M |
| 3300014052|Ga0120109_1093834 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300014058|Ga0120149_1207736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300014156|Ga0181518_10479102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300014160|Ga0181517_10028201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3712 | Open in IMG/M |
| 3300014325|Ga0163163_11697076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
| 3300014326|Ga0157380_10182664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1844 | Open in IMG/M |
| 3300014501|Ga0182024_10091724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4468 | Open in IMG/M |
| 3300014501|Ga0182024_11548525 | Not Available | 754 | Open in IMG/M |
| 3300015052|Ga0137411_1274467 | All Organisms → cellular organisms → Bacteria | 5994 | Open in IMG/M |
| 3300015241|Ga0137418_10891611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
| 3300015264|Ga0137403_10369742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1318 | Open in IMG/M |
| 3300015372|Ga0132256_102505660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300015374|Ga0132255_101189709 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300017988|Ga0181520_10023416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 6881 | Open in IMG/M |
| 3300018031|Ga0184634_10280449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
| 3300018071|Ga0184618_10106345 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300018469|Ga0190270_13476574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300018920|Ga0190273_12212048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300019269|Ga0184644_1370851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
| 3300019873|Ga0193700_1044726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 708 | Open in IMG/M |
| 3300019875|Ga0193701_1034774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300019875|Ga0193701_1045306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300020016|Ga0193696_1092602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300020059|Ga0193745_1022541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1375 | Open in IMG/M |
| 3300020581|Ga0210399_10763134 | Not Available | 792 | Open in IMG/M |
| 3300021078|Ga0210381_10299352 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300021081|Ga0210379_10543842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300021441|Ga0213871_10279590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300021559|Ga0210409_11645057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300022557|Ga0212123_10389111 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300022756|Ga0222622_10202639 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300025319|Ga0209520_10119128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1682 | Open in IMG/M |
| 3300025495|Ga0207932_1003262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5448 | Open in IMG/M |
| 3300025633|Ga0208480_1003728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5230 | Open in IMG/M |
| 3300025899|Ga0207642_10033586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2172 | Open in IMG/M |
| 3300025909|Ga0207705_10820852 | Not Available | 721 | Open in IMG/M |
| 3300025912|Ga0207707_10379338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1215 | Open in IMG/M |
| 3300025914|Ga0207671_10247952 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300025916|Ga0207663_11243524 | Not Available | 600 | Open in IMG/M |
| 3300025925|Ga0207650_10453391 | Not Available | 1068 | Open in IMG/M |
| 3300025933|Ga0207706_11092352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300025934|Ga0207686_10580247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 880 | Open in IMG/M |
| 3300025960|Ga0207651_11033419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300026041|Ga0207639_10019906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4795 | Open in IMG/M |
| 3300026067|Ga0207678_10534481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1024 | Open in IMG/M |
| 3300026089|Ga0207648_10274048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1508 | Open in IMG/M |
| 3300026116|Ga0207674_10960324 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300026142|Ga0207698_12193768 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300026343|Ga0209159_1166909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 815 | Open in IMG/M |
| 3300027546|Ga0208984_1110004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300027562|Ga0209735_1098319 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027857|Ga0209166_10471190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300027862|Ga0209701_10411766 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300027882|Ga0209590_10715969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300028713|Ga0307303_10053419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 861 | Open in IMG/M |
| 3300028720|Ga0307317_10004213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4310 | Open in IMG/M |
| 3300028720|Ga0307317_10196488 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300028721|Ga0307315_10078879 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300028768|Ga0307280_10263877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 622 | Open in IMG/M |
| 3300028773|Ga0302234_10192549 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300028778|Ga0307288_10033693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
| 3300028802|Ga0307503_10177066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 991 | Open in IMG/M |
| 3300028807|Ga0307305_10182080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 968 | Open in IMG/M |
| 3300028814|Ga0307302_10512162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300028819|Ga0307296_10377883 | Not Available | 774 | Open in IMG/M |
| 3300028819|Ga0307296_10584383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300028819|Ga0307296_10648630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300028828|Ga0307312_10013498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4553 | Open in IMG/M |
| 3300028828|Ga0307312_10610327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300028875|Ga0307289_10321363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
| 3300028882|Ga0302154_10424066 | Not Available | 639 | Open in IMG/M |
| 3300028884|Ga0307308_10471311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 602 | Open in IMG/M |
| 3300028885|Ga0307304_10038280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1723 | Open in IMG/M |
| 3300029913|Ga0311362_10592846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 989 | Open in IMG/M |
| 3300030507|Ga0302192_10016380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4320 | Open in IMG/M |
| 3300030688|Ga0311345_10340319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1387 | Open in IMG/M |
| 3300030743|Ga0265461_11992204 | Not Available | 662 | Open in IMG/M |
| 3300031093|Ga0308197_10293252 | Not Available | 596 | Open in IMG/M |
| 3300031099|Ga0308181_1110537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300031226|Ga0307497_10415181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 646 | Open in IMG/M |
| 3300031226|Ga0307497_10740783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300031232|Ga0302323_103303366 | Not Available | 514 | Open in IMG/M |
| 3300031235|Ga0265330_10076828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1441 | Open in IMG/M |
| 3300031251|Ga0265327_10530036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300031546|Ga0318538_10701450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia alpina | 549 | Open in IMG/M |
| 3300031547|Ga0310887_10920544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300031573|Ga0310915_11200817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300031680|Ga0318574_10849183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia alpina | 535 | Open in IMG/M |
| 3300031713|Ga0318496_10433392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300031736|Ga0318501_10194738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1059 | Open in IMG/M |
| 3300031768|Ga0318509_10344731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 834 | Open in IMG/M |
| 3300031777|Ga0318543_10115332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1163 | Open in IMG/M |
| 3300031778|Ga0318498_10062113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1669 | Open in IMG/M |
| 3300031858|Ga0310892_10411340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 883 | Open in IMG/M |
| 3300031962|Ga0307479_10507306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1190 | Open in IMG/M |
| 3300032010|Ga0318569_10134040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → Agromyces atrinae | 1134 | Open in IMG/M |
| 3300032156|Ga0315295_12258754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300032160|Ga0311301_11582238 | Not Available | 800 | Open in IMG/M |
| 3300032516|Ga0315273_10876162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1161 | Open in IMG/M |
| 3300032892|Ga0335081_11447147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300033811|Ga0364924_145462 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300033812|Ga0364926_112820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300033887|Ga0334790_157618 | Not Available | 678 | Open in IMG/M |
| 3300033982|Ga0371487_0015413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5601 | Open in IMG/M |
| 3300034149|Ga0364929_0280841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300034155|Ga0370498_000867 | All Organisms → cellular organisms → Bacteria | 8755 | Open in IMG/M |
| 3300034195|Ga0370501_0003338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4025 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.26% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.35% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.35% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.35% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.35% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.90% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.90% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.45% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.45% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.45% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.45% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.45% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_02442710 | 2140918007 | Soil | DEVNPIASTAAFAHFQEGHADRREGGVDQQTAKLVGAYITTID |
| A_all_C_00524210 | 2140918007 | Soil | TAAFAHFQEDHADRREGGVDQQTAELVGAYITTID |
| JGI10214J12806_116576122 | 3300000891 | Soil | DHGDDEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTIE* |
| JGI10216J12902_1111669264 | 3300000956 | Soil | DDEVNPIASTPAFAHFQDDHADRRAGGVDQQTARLVGAYIRAID* |
| A10PFW1_118732211 | 3300001538 | Permafrost | VHVSFHDHGDDEVNPITSTAAFAHFQAGHADRRAGAVDQQKAT |
| JGI12635J15846_103269132 | 3300001593 | Forest Soil | TAAFAHFQDGHETRRDGGVNQQKATLVGSYITKIE* |
| JGI24742J22300_100265923 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | PIASTAAFAHFQDGHVERRDGAVDQQSATLVGSYITTIA* |
| JGI24751J29686_100497181 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | HNHRDDEVNPIASMPAFAHFQDGHADRREGSVDQQTAELVGAYVTTID* |
| Ga0055432_101203632 | 3300004022 | Natural And Restored Wetlands | VSFHNHGDDEVNPIASTAAFAHFQEDHADRREGGVDQQTAELVGAYVTTIA* |
| Ga0062593_1020341392 | 3300004114 | Soil | VHVSFHDHGEDEVNPIASTPAFAHFQDGHAERRTGGVDQQTATLVSAYITTIA* |
| Ga0062590_1001650133 | 3300004157 | Soil | VHVSFHDHGEDEVNPIASTPAFAHFQDGHAERRAGGVDQQTATLVSAYITTIA* |
| Ga0063356_1032528652 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTID* |
| Ga0062594_1022816361 | 3300005093 | Soil | EVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID* |
| Ga0066683_103483113 | 3300005172 | Soil | VNPIASTAAFAHFQQGHADRREGSVDQQTATLVGAYITTID* |
| Ga0066679_106242821 | 3300005176 | Soil | DEVNPIASTAAFAHFQDGHPDRREGSVDQQTATLVGAYITTID* |
| Ga0066688_105757642 | 3300005178 | Soil | FVHVSFHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID* |
| Ga0070683_1003485762 | 3300005329 | Corn Rhizosphere | VRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE* |
| Ga0070670_1005413611 | 3300005331 | Switchgrass Rhizosphere | NPIASMPAFAHFQDGHADRREGSVDQQTAELVGAYVTTID* |
| Ga0070673_1010457192 | 3300005364 | Switchgrass Rhizosphere | PIASTAAFAHFQDGHTDRRQGAVDQQRATLVGAYVTLIA* |
| Ga0070714_1011234272 | 3300005435 | Agricultural Soil | NPIASTPAFAHFQQDHADRREGGVDQQTASLVGAYITTID* |
| Ga0070708_1004257041 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DEPNPIASTPAFAHFQEDHADRREGGVDQQTATLVGAYITTID* |
| Ga0070706_1011590072 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HVSFHNHRDDEPNPIASTPAFAHFQQDHADRRDGGVDQQTATLVGAYITTID* |
| Ga0070698_1010730592 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HVSFHDHGDDEPNPIASTAAFAHFQENHAERREGGVDQQTATLVGSYITTID* |
| Ga0070699_1018394051 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VHVSFHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTAQLVGSYITTID* |
| Ga0070684_1010337922 | 3300005535 | Corn Rhizosphere | HDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE* |
| Ga0070697_1015948551 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FVHVSFHNHGDDEVNPIASTTAFAHFQDGHADRREGGVDQQTATLVGAYITTID* |
| Ga0070697_1017947181 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EVNPIASTAAFAHFQQDHAGRREGDVDQQTASLVGAYITTID* |
| Ga0070730_110589591 | 3300005537 | Surface Soil | FHDHGDDEVNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITVID* |
| Ga0066699_110776372 | 3300005561 | Soil | FHNHGDDEVNPIASTPAFAHFQEGHANRREGGVSQQTATLVGAYITTIA* |
| Ga0066703_105607521 | 3300005568 | Soil | HVSFHNHGDDEPNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYITTID* |
| Ga0066702_103859592 | 3300005575 | Soil | DEPNPIASTAAFAHFQEDHADRREGGVDQQTATLVGSYITTID* |
| Ga0066691_100124991 | 3300005586 | Soil | SFHDHADNEVNPITSTPAFAHFQQDHAARRQGAVDQQTAKLVGAYITKIE* |
| Ga0066691_102580972 | 3300005586 | Soil | HNHGDDEVNPIASTAAFAHFQDGHPDRREGSVDQQTATLVGAYITTID* |
| Ga0068852_1004448062 | 3300005616 | Corn Rhizosphere | VRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARRLVAHLTVIE* |
| Ga0068864_1019759251 | 3300005618 | Switchgrass Rhizosphere | HDHREDETNPIASTAAFAHFQDGHVERRDGAVDQQTATLVGSYITTIA* |
| Ga0097691_10072411 | 3300006055 | Arctic Peat Soil | VHLSFHNHGDDEVNPIASFPAFAHFQEGHADRRAGEVDQQKATLVGAYITTID* |
| Ga0075017_1001777951 | 3300006059 | Watersheds | FVHVSFHDHGDDEPNPIASTAAFAHFQDGHAERRSGGVDQQTAVLVGSYVTTIA* |
| Ga0075014_1006870351 | 3300006174 | Watersheds | HVSFHDHGDDEVNPIASTAAFAHFQDGHADRRAGGVDQQTAQLVGAYVTVID* |
| Ga0075021_101827833 | 3300006354 | Watersheds | HVSFHDHGDDEVNPIASTAAFAHFQDGHADRRDGGVDQQKAELVGAYITVIA* |
| Ga0075021_111855522 | 3300006354 | Watersheds | DEVNPISSTAAFARFQDGHGERRDGGVNQQTATLVGSYITTIA* |
| Ga0074056_105905533 | 3300006574 | Soil | VNPIASTASFAHFQDGHAERRDGAVDQQTAELVGAYITKID* |
| Ga0074049_131973951 | 3300006580 | Soil | PRPIASTAAFAHFQQDHAGRRDGGVDQQTAQLVGAYITTIE* |
| Ga0074060_120507942 | 3300006604 | Soil | HGDDEVNPIASTDAFAHFQDGHADRREGGVDQQTASLVGAYITVID* |
| Ga0075521_106706361 | 3300006642 | Arctic Peat Soil | ASTAAFAHFQEGHADRRAGAIDQQKATLVGAYITTID* |
| Ga0075425_1024326011 | 3300006854 | Populus Rhizosphere | VHVSFHNHRDDEPNPIASTAAFAHFQDAHAERRDGGVNQQTAELVGAYITTIA* |
| Ga0068865_1012779542 | 3300006881 | Miscanthus Rhizosphere | HGDDELNPITSTAAFAYFQEDHADRREGGVDQQTATLVGAYITAID* |
| Ga0073928_112306982 | 3300006893 | Iron-Sulfur Acid Spring | FHNHTDDEVNPISSTPAFAHFQQDHADRRDGGVNQQTATLVGAYITVIE* |
| Ga0075426_100536006 | 3300006903 | Populus Rhizosphere | HNHRDDEPNPIASTAAFAHFQDDHASRRDGGVDQQTAALVGAYITTIA* |
| Ga0074063_132660911 | 3300006953 | Soil | FHDHGDDEVNPIASTDAFAHFQEGHADRRDGGVDQQTASLVGAYVTVIE* |
| Ga0102924_11140981 | 3300007982 | Iron-Sulfur Acid Spring | NPITSMASFAHFQQDHAARRQGAADQQTAKLVGAYITKIA* |
| Ga0066710_1010232241 | 3300009012 | Grasslands Soil | HGDDEVNPIASTAAFAHFQQEHADRREGPVDQQTADLVGAYITNID |
| Ga0066710_1015869263 | 3300009012 | Grasslands Soil | SFHDHGDDEVNPIASLPAFAHFQQGHADRREGGVDQQTAELVGAYITVID |
| Ga0066793_108818262 | 3300009029 | Prmafrost Soil | VHLSFHNHGDDEVNPIASAGAFAHFQEGHADRRAGAIDQQKATLVGAYITTID* |
| Ga0099827_118615272 | 3300009090 | Vadose Zone Soil | EVNPIASTAAFAHFQQDHADRREGGVDQQTAELVGAYITTIA* |
| Ga0066709_1003690311 | 3300009137 | Grasslands Soil | EVNPIASTASFAHFQQDHAGRRAGDVDQQTAELVGAYITTIG* |
| Ga0066709_1008169701 | 3300009137 | Grasslands Soil | ASTAAFAHFQDGHADRRAGGVDQKTATLVGAYITTID* |
| Ga0066709_1009763093 | 3300009137 | Grasslands Soil | DDEVNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYITTID* |
| Ga0066709_1020915951 | 3300009137 | Grasslands Soil | FHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID* |
| Ga0105242_113934332 | 3300009176 | Miscanthus Rhizosphere | DHGDDEVNPIASTAAFAHFQDGHGDRRQGGVEQQTAELVGSYITTID* |
| Ga0105248_130065191 | 3300009177 | Switchgrass Rhizosphere | IASTAAFAHFQDGHADRREGGVDQQTATLVGAYITTID* |
| Ga0105237_119435391 | 3300009545 | Corn Rhizosphere | VHVSFHDHGDDEVNPIASTPAFVHFQKDHADRREGGVDQQTAELVGAYITTID* |
| Ga0105238_124183182 | 3300009551 | Corn Rhizosphere | SHGRVRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE* |
| Ga0105056_10325732 | 3300009801 | Groundwater Sand | FLHVSFHNHRDDEVNPIASTAAFAHFQQDHADRREGTVDQQTAELVGVYVTTID* |
| Ga0134063_106066512 | 3300010335 | Grasslands Soil | VHVSFHDHGDDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGSYITTID* |
| Ga0134125_116909071 | 3300010371 | Terrestrial Soil | DDEVNPIASTAAFAHFQDGHETRREGGVDQQTASLVGAYVTVIE* |
| Ga0105239_106268763 | 3300010375 | Corn Rhizosphere | DDEVNPIASTTAFAHFQDGHADRREGDVAQQRAELVGAYLTVVE* |
| Ga0134122_131898862 | 3300010400 | Terrestrial Soil | VHVSFHDHGEADVNPIASTAAFAHFQDGHADRREGGVDQQTAELVGAYITTID* |
| Ga0126350_117808791 | 3300010880 | Boreal Forest Soil | APGETNPIGSAAAFARFIDGHADRREGEVDQQQASLVGAYITHIG* |
| Ga0120148_10727183 | 3300011999 | Permafrost | STAAFAHFQQDHADRREGGVDQQTARLVGSYITTID* |
| Ga0120148_10769752 | 3300011999 | Permafrost | VNPISSTAAFSHFQLDHSDRREGGVDQQTATLVGAYITSID* |
| Ga0120167_11125963 | 3300012001 | Permafrost | VSFHDHGEDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGAYITTIA* |
| Ga0120134_10608422 | 3300012004 | Permafrost | DHGDDEVNPIASTPAFAHFQEDHAARREGGVDQQTAKLVGAYITTID* |
| Ga0120118_11234471 | 3300012010 | Permafrost | VSFPDHGDDEVNPIASSTAFAHFQQDHADRREGPVDQQTATLVGAYVTTID* |
| Ga0137389_101437205 | 3300012096 | Vadose Zone Soil | FHDHGDDEVNPIASTPAFAHFQEDHAARREGGVDQQTAKLVGAYITTID* |
| Ga0137388_118500502 | 3300012189 | Vadose Zone Soil | VHVSFHDHGDDEVNPIASTAAFAHFQQDHANRRDGGVDQQTATLVGAYITTID* |
| Ga0137364_108919211 | 3300012198 | Vadose Zone Soil | DEVNPIASTAAFAHFQQEHADRREGPVDQQTADLVGAYITTID* |
| Ga0137365_104863122 | 3300012201 | Vadose Zone Soil | FHNHGDDELNPIASTPAFAHFQQDHADRREGGVDQQTATLVGAYITTID* |
| Ga0137365_109251102 | 3300012201 | Vadose Zone Soil | FVHISFHDHADDEVNPIASSEAFAYFQQDHADRRQGGVDQQTATLVGAYITTID* |
| Ga0137374_104129443 | 3300012204 | Vadose Zone Soil | VHVSFHDHGENEVNPIASTPAFAHFQEDHADRREGGVDQQTATLVGAYITTID* |
| Ga0137380_116009582 | 3300012206 | Vadose Zone Soil | GDDEVNPIASTPAFAHFQESHADRREGGVDQQTAELVGAYITVID* |
| Ga0137381_108633523 | 3300012207 | Vadose Zone Soil | PAFAHFQQDHAERREGGVDQQTATLVGAYITTID* |
| Ga0137376_108605201 | 3300012208 | Vadose Zone Soil | VSFHNHGDDEVNPIASTRAFAHFQEDHADRREGGVDQQTATLVGAYITTID* |
| Ga0137379_104581001 | 3300012209 | Vadose Zone Soil | IASTPAFAHFQESHADRREGGVDQQTAELVGAYITVID* |
| Ga0137367_105868072 | 3300012353 | Vadose Zone Soil | LCTCRFHDHGDDEVNPIASTDAFGHFQQHHSDRREGGVDQQTAELVGAYITTID* |
| Ga0137369_103341222 | 3300012355 | Vadose Zone Soil | LCTCRFHDHGDDEVNPIASTDAFGHFQQHHSDRREGGVDQQTAELVGAYIPTID* |
| Ga0137371_103641141 | 3300012356 | Vadose Zone Soil | DVNPIASTAAFAHFQQGHADRREGAVDQQTATLLGAYITTID* |
| Ga0137368_100358502 | 3300012358 | Vadose Zone Soil | VNPIASTDAFGHFQQHHSDRREGGVDQQTAELVGAYITTID* |
| Ga0137368_100447526 | 3300012358 | Vadose Zone Soil | LGVVRRLGHGDDEVNPIASTAAFAHFQHDHTDRRAGGVDQQTASLVGAYITTID* |
| Ga0137361_118911181 | 3300012362 | Vadose Zone Soil | ERNPIASTAAFAHFQDGHADRREGAVDQQRAELVGAYVTVIA* |
| Ga0137390_116140401 | 3300012363 | Vadose Zone Soil | NHGDDEVNPIASTAAFAHFQQGHADRREGGADQQTATLVGAYVTTID* |
| Ga0137398_107479851 | 3300012683 | Vadose Zone Soil | HLSFHDHGDNEVNPITSTASFAHFQQDHAARRQGAVDQQTATLVGAYITKIE* |
| Ga0157285_102204421 | 3300012897 | Soil | DEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTID* |
| Ga0157286_103501462 | 3300012908 | Soil | STAAFAHFQQDHADRRDGDVDQQTATLVGAYITTID* |
| Ga0157302_104228881 | 3300012915 | Soil | HDHGDDEVNPIASTASFAHFQDGHEERRAGGVDQQTATLVGAYITTIA* |
| Ga0137419_115660431 | 3300012925 | Vadose Zone Soil | VNPIASTAAFAHFQQDHSDRREGSVDQQTAKLVGAYITTID* |
| Ga0162652_1000907592 | 3300012941 | Soil | VSFHNHGDDEVNPIASTAAFALFQQDHADRRAGGVDQQTAELVGAYITTID* |
| Ga0164300_108659201 | 3300012951 | Soil | DEVNPIASTAAFALFQEDHADRREGVVDQQTAELVGAYITTVD* |
| Ga0164302_102490182 | 3300012961 | Soil | EVNPISSTAAFARFQDGHGDRREGAVDQQTATLIGAYVTTID* |
| Ga0164302_114581442 | 3300012961 | Soil | HGEDDVNPIASTAAFAHFQEDHAERRDGGVDQQTASLVGAYITTID* |
| Ga0134077_103340002 | 3300012972 | Grasslands Soil | EVNPIASTAAFAHFQDGHADRREGSVDQQTAALVGAYITTID* |
| Ga0164309_110771461 | 3300012984 | Soil | DVNPIASTAAFAHFQEDHAERRDGGVDQQTASLVGAYITTID* |
| Ga0164306_110351931 | 3300012988 | Soil | ASTAAFAHFQDGHADRREGGVDQQTATLVGSYITTIA* |
| Ga0164305_103003011 | 3300012989 | Soil | ASAFAHFQDGHADRRDGAVDQQTAELVGAYITRIA* |
| Ga0157373_100944005 | 3300013100 | Corn Rhizosphere | NPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVE* |
| Ga0157371_102223903 | 3300013102 | Corn Rhizosphere | VRGDDFSRPDFHDHGDDEVNPIASTTAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE* |
| Ga0157369_101384501 | 3300013105 | Corn Rhizosphere | VNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVE* |
| Ga0157369_109355433 | 3300013105 | Corn Rhizosphere | DETNPIASTAAFAHFQDGHVERRDGAVDQQTATLVGSYITTIA* |
| Ga0157378_130610701 | 3300013297 | Miscanthus Rhizosphere | HGDDEVNPIASSAAFAHFQDGHSDRREGPVDQQQAELVGAYITTIA* |
| Ga0120179_11252143 | 3300013763 | Permafrost | DEVNQIASTAAFAHFQDGHDERREGGVDQQKATLVGAYITTID* |
| Ga0120179_11314012 | 3300013763 | Permafrost | VSFHDHGDDEVNPIASTPAFAHFQEDHAARREGGVDQQTAKLVGAYITTID* |
| Ga0120158_100325971 | 3300013772 | Permafrost | FHDHGDDEVNPIASTAAFAHFQDGHADRREGAVDQQTAELVGAYITTID* |
| Ga0120158_101267093 | 3300013772 | Permafrost | VNPIASTAAFAHFQEDHAARREGGVDQQTAQLVGAYITTIE* |
| Ga0120158_102868852 | 3300013772 | Permafrost | VSFHDHGDDEVNPIASTAAFAHFQDDHAGRRQGGVDQQTAELVGAYVTTID* |
| Ga0120109_10938341 | 3300014052 | Permafrost | FHDHGDDEVNPIASTAAFAHFQKDHADRREGGVDQQTARLVGAYVTTID* |
| Ga0120149_12077362 | 3300014058 | Permafrost | HGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQKATLVGAYITTID* |
| Ga0181518_104791022 | 3300014156 | Bog | VNPIASTSAFAQFQQDHPSRRAGAIDQQTATLVGAYITTID* |
| Ga0181517_100282013 | 3300014160 | Bog | LSFHNHGDDEVNPIASTSAFAQFQQDHPSRRAGAIDQQTATLVGAYITTID* |
| Ga0163163_116970761 | 3300014325 | Switchgrass Rhizosphere | VDELNPIASTAAFAHFQQDHADRRDGDVDQQTATLVGAYITTIG* |
| Ga0157380_101826641 | 3300014326 | Switchgrass Rhizosphere | PIASTAAFAHFQDGHVERRDGAVDQQTATLVGSYITTIA* |
| Ga0182024_100917247 | 3300014501 | Permafrost | GDDDVNPITSTAAFGYFQQVHADRRQGEVDQQTATLVGAYITSIG* |
| Ga0182024_115485252 | 3300014501 | Permafrost | PAFAHFQENHGDRREGDVNQQTAQLVGAYITEIA* |
| Ga0137411_127446712 | 3300015052 | Vadose Zone Soil | VNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYVTTID* |
| Ga0137418_108916112 | 3300015241 | Vadose Zone Soil | VSFHNHGDDEVNPIASTPAFAHFQEDHADRREGGVDQKTASLVGAYITTID* |
| Ga0137403_103697421 | 3300015264 | Vadose Zone Soil | GDDEVNPIASTPAFAHFQEGHGDRRDGGVDQQTATLVGAYITTIE* |
| Ga0132258_105734361 | 3300015371 | Arabidopsis Rhizosphere | FVHVSFHDHSDNDVNPIASTAAFARFQDGHGDRREGHVDQQTAELVGAYITTIA* |
| Ga0132256_1025056601 | 3300015372 | Arabidopsis Rhizosphere | HVSFHDHGEDEVNPIASTAAFAHFQDGHADRREGGVDQQTARLVGAYINTID* |
| Ga0132255_1011897092 | 3300015374 | Arabidopsis Rhizosphere | DDPNPIASLPAFQHFQDGHATRRSGGVDQQQATLVGSYIAAVG* |
| Ga0181520_100234164 | 3300017988 | Bog | LSFHNHGDDEVNPIASTSAFAQFQQDHPSRRAGAIDQQTATLVGAYITTID |
| Ga0184634_102804492 | 3300018031 | Groundwater Sediment | SFHNHRDDEVNPIASTAAFAHFQDGHADRREGGVDQQTAELVGAYVTVIE |
| Ga0184618_101063453 | 3300018071 | Groundwater Sediment | HVSFHDHGEDEVNPIASTAAFAHFQDGHAHRRAGGVDQKTATLVGAYITTID |
| Ga0190270_134765742 | 3300018469 | Soil | MTQVNPIASTAAFAHFQQDHADRREGSVDQQTATLVGAYITTID |
| Ga0190273_122120481 | 3300018920 | Soil | SFHNHGDDEVNPIASTAAFAHFQQDHADRRQGGVDQQRAELVGAYITTID |
| Ga0184644_13708511 | 3300019269 | Groundwater Sediment | HNHGDDEVNPIASTPAFAHFQQDHADRRQGGVDQQTAELVGAYITTID |
| Ga0173479_103667802 | 3300019362 | Soil | FVHVSFHDHGDDDVNPIASTPAFAHFQQDHADRREGGVDQQTATLVGAYVTTIE |
| Ga0193700_10447262 | 3300019873 | Soil | VSFHNHTDDEVNPIASTAAFAHFQDGHGERREGGVDQKTATLVGAYITTIA |
| Ga0193701_10347742 | 3300019875 | Soil | NHGDDEVNPIASTAAFAHFQQDHADRREGGVDQQTAQLVGAYITTID |
| Ga0193701_10453063 | 3300019875 | Soil | DETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITAIA |
| Ga0193696_10926023 | 3300020016 | Soil | NPIASTAAFAHFQDGHADRREGGVDQQTATLVGSYITTIA |
| Ga0193745_10225411 | 3300020059 | Soil | FHDHRDDETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITTIA |
| Ga0210399_107631342 | 3300020581 | Soil | HNHGDDEANPIASTAAFAHFQDGHPERRAGAVDQQKAALVGAYITTIA |
| Ga0210381_102993522 | 3300021078 | Groundwater Sediment | NPIASTAAFAHFQQDHADRREGGVDQQTAELVGAYITTIV |
| Ga0210379_105438421 | 3300021081 | Groundwater Sediment | HDHGDDEVNPIASTPAFAHFQDGHADRREGSVDQQTATLVGAYITTID |
| Ga0213871_102795901 | 3300021441 | Rhizosphere | LEAFAHFQDGHETRRQGGVDQQEATLVGAYITNIA |
| Ga0210409_116450571 | 3300021559 | Soil | IASTAAFAHFQQDHADRRQGAVDQQPARLVGAYITVID |
| Ga0212123_103891111 | 3300022557 | Iron-Sulfur Acid Spring | EVNPIASTPAFAHFQQDHGDRREGGVDQQTATLVGAYITEIG |
| Ga0222622_102026391 | 3300022756 | Groundwater Sediment | DDEVNPIASTAAFAHFQDGHADRREGGVDQQTATLVGAYITTID |
| Ga0209520_101191282 | 3300025319 | Soil | NPIASTAAFARFQQDHDDRREGGVDQQTAELVGAYITTID |
| Ga0207932_10032629 | 3300025495 | Arctic Peat Soil | VHLSFHNHGDDEVNPIASFPAFAHFQEGHADRRAGEVDQQKATLVGAYITTID |
| Ga0208480_10037281 | 3300025633 | Arctic Peat Soil | SSAFAHFQDGRESRRDGAVDQQTATLVGARITEIA |
| Ga0207642_100335861 | 3300025899 | Miscanthus Rhizosphere | VSFHDHREEETNPIASTAAFAHFQDGHVERRDGAVDQQSATLVGSYITTIA |
| Ga0207705_108208522 | 3300025909 | Corn Rhizosphere | VRGDDFSRPDFHDHGDDEVNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVE |
| Ga0207707_103793382 | 3300025912 | Corn Rhizosphere | VRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE |
| Ga0207671_102479521 | 3300025914 | Corn Rhizosphere | EVNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVD |
| Ga0207663_112435241 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | STEAFARFQEGHADRREGGVDQQTATLVGAYLTVVD |
| Ga0207650_104533912 | 3300025925 | Switchgrass Rhizosphere | NPIASMPAFAHFQDGHADRREGSVDQQTAELVGAYVTTID |
| Ga0207706_110923521 | 3300025933 | Corn Rhizosphere | DHGDDEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTIE |
| Ga0207686_105802473 | 3300025934 | Miscanthus Rhizosphere | VSFHDHGDDEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTIE |
| Ga0207651_110334192 | 3300025960 | Switchgrass Rhizosphere | VHVSFHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID |
| Ga0207639_100199061 | 3300026041 | Corn Rhizosphere | ASTAAFARFQDGHVERRDGAVDQQTATLVGSYITTIA |
| Ga0207678_105344812 | 3300026067 | Corn Rhizosphere | VRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYL |
| Ga0207648_102740481 | 3300026089 | Miscanthus Rhizosphere | IASSAAFAHIQDGHSDRREGPVDQQQAELVGAYITTIA |
| Ga0207674_109603243 | 3300026116 | Corn Rhizosphere | VNPIASTEAFAHFQDGHAERREGPVDQQTATLVGAYVT |
| Ga0207698_121937682 | 3300026142 | Corn Rhizosphere | VNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVD |
| Ga0209159_11669092 | 3300026343 | Soil | EVNPITSTPAFGHFQQDHSARRQGAVDQQTATLVGAYITKIE |
| Ga0208984_11100041 | 3300027546 | Forest Soil | GDDEVNPIASTAAFAHFQEDHGSRRQGGVDQQTAKLVGAYITKIE |
| Ga0209735_10983191 | 3300027562 | Forest Soil | FHDHGDDEVNPIASTAAFAHFQDGHADRREGSVDQQTAELVGAYITTID |
| Ga0209166_104711902 | 3300027857 | Surface Soil | FHDHGDDEVNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITVID |
| Ga0209701_104117661 | 3300027862 | Vadose Zone Soil | FHDHGDDEVNPIASTAAFAHFQQDHADRREGGVDQQTARLVGAYITTID |
| Ga0209590_107159693 | 3300027882 | Vadose Zone Soil | VNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYVTTID |
| Ga0307303_100534191 | 3300028713 | Soil | VNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITTIA |
| Ga0307317_100042138 | 3300028720 | Soil | DDEVNPIASTAAFAHFQQDHADRRQGGVDQQTAELVGAYITTID |
| Ga0307317_101964881 | 3300028720 | Soil | TPDFAHFQDGHAERRAGGVDQQTATLVGAYITTIA |
| Ga0307315_100788793 | 3300028721 | Soil | EVNPIASTAAFEHFQDGHAERRAGGVDQQTATLVGAYITTIA |
| Ga0307280_102638772 | 3300028768 | Soil | RRLHVSFHDHGDDEVNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITTIA |
| Ga0302234_101925491 | 3300028773 | Palsa | GDDEVNPISSTPAFAHFQDGHGERREGGVDQHTATLVGAYINKIE |
| Ga0307288_100336933 | 3300028778 | Soil | RDDETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITTIA |
| Ga0307503_101770661 | 3300028802 | Soil | LHVSFHDHGDDEVNPIASTAAFAHFQDGHGDRREGGVDQQTAELVGAYITTID |
| Ga0307305_101820802 | 3300028807 | Soil | GDDEVNPIASTPAFAHFQEDHAGRRDGPVDQQTAELVGSYITTID |
| Ga0307302_105121622 | 3300028814 | Soil | NPIASTAAFAHFQDGHADRREGAVNQQTAELVGAYITTID |
| Ga0307296_103778831 | 3300028819 | Soil | STAAFAHFQDGHADRRQGAVDQQRATLVGAYVTVIT |
| Ga0307296_105843831 | 3300028819 | Soil | HVSFHDHRDDETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITTIA |
| Ga0307296_106486301 | 3300028819 | Soil | DDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGSYITTID |
| Ga0307312_100134981 | 3300028828 | Soil | IASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITAIA |
| Ga0307312_106103271 | 3300028828 | Soil | PGETNPIASTAAFAHFADGHGERRQGEIDQQQASLVGAYVTHIG |
| Ga0307289_103213631 | 3300028875 | Soil | HGDDEINPIASTAAFAHFQQDHADRREGGIDQQTATLVGAYITTID |
| Ga0302154_104240661 | 3300028882 | Bog | NHRDDEPNPISSSAAFAHFQDGHEGRRVGAVEQQTATLVGSYVTEIA |
| Ga0307308_104713113 | 3300028884 | Soil | HGDDEVNPIASTAAFAHFQEDHSDRREGAVDQQTAELVGAYITTIA |
| Ga0307304_100382801 | 3300028885 | Soil | GDHEVNPIASTAAFAHFQEAHSDRRDGAVDQQTAELVGAYITTIA |
| Ga0311362_105928461 | 3300029913 | Bog | FHNHGDDQPNPISSTAAFAHFQDGHENRRDGAVSQQSASLVGAYVTEIA |
| Ga0302192_100163805 | 3300030507 | Bog | VSFHNHRDDEPNPISSSAAFAHFQDGHEGRRVGAVEQQTATLVGSYVTEIA |
| Ga0311345_103403193 | 3300030688 | Bog | FHNHRDDEPNPISSTAAFAHFQDGHESRREGAVNQQTASLVGAYITEIA |
| Ga0265461_119922041 | 3300030743 | Soil | DEVNPISSTAAFAHFQDGHEERREGGVNQQKATLVGSYITKIE |
| Ga0308197_102932521 | 3300031093 | Soil | IASTAAFAHFQDGHADRREGSVDQQTATLVGAYITTID |
| Ga0308181_11105372 | 3300031099 | Soil | ASTAAFAHFQQDHADRRAGGVDQQTAELVGAYITTIA |
| Ga0307497_104151811 | 3300031226 | Soil | PIASTAAFAHFQEDHADRREGGVDQQTATLVGAYITAID |
| Ga0307497_107407832 | 3300031226 | Soil | DEANPIASTAAFAHFQQDHADRREGGVDQQTAQLVGAYITTIA |
| Ga0302323_1033033662 | 3300031232 | Fen | NPITSLASFDHFQDGHAERRDGAVDQQKAKLVGAYIKRIA |
| Ga0265330_100768281 | 3300031235 | Rhizosphere | LHVSFHDHSDDEVNPIASTAAFAHFQDGHADRREGAVDQQTASLVGAYVTTIA |
| Ga0265327_105300363 | 3300031251 | Rhizosphere | EVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGAYVTTIA |
| Ga0318538_107014501 | 3300031546 | Soil | DDEPNPISSTDAFAHFQDGHQTRRRGDVDQHTASLVGVYITEIA |
| Ga0310887_109205442 | 3300031547 | Soil | EVNPIASTAAFAHFQENHADRRDGVVDQQTAELVGAYITSID |
| Ga0310915_112008171 | 3300031573 | Soil | TAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA |
| Ga0318574_108491832 | 3300031680 | Soil | SSTAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA |
| Ga0318496_104333922 | 3300031713 | Soil | FVHVSFHDHGDDEPNPISSTAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA |
| Ga0318501_101947381 | 3300031736 | Soil | DEPNPISSTAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA |
| Ga0318509_103447311 | 3300031768 | Soil | DDEPNPISSTAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA |
| Ga0318543_101153321 | 3300031777 | Soil | PISSTAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA |
| Ga0318498_100621133 | 3300031778 | Soil | VSFHDHGDDEPNPISSTAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA |
| Ga0310892_104113401 | 3300031858 | Soil | HNHADDEVNPIASTAAFAHFQENHADRRDGVVDQQTAELVGAYITSID |
| Ga0307479_105073062 | 3300031962 | Hardwood Forest Soil | NPIASTPEFARFQDGHDSRRNGPVDQQTAQLIGAYITTIG |
| Ga0318569_101340401 | 3300032010 | Soil | STAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA |
| Ga0315295_122587541 | 3300032156 | Sediment | STAAFAHFQQDHADRREGGADQQTAELVGAYITTID |
| Ga0311301_115822382 | 3300032160 | Peatlands Soil | EVNPISSTAAFAHFQDGHADRRSGGVDQQKATLVGSYITTIG |
| Ga0315273_108761621 | 3300032516 | Sediment | STAAFAHFQQDHADRREGGVDQQTAELVGAYITTID |
| Ga0335081_114471472 | 3300032892 | Soil | VHVSFHDHGDDEVNPITSTAAFAHFQEDHADRRDGGVDQQTATLVGSYVTVIG |
| Ga0364924_145462_5_160 | 3300033811 | Sediment | VSFHNHGDDEVNPIASTAAFAHFQQDHADRREGGVDQQTAELVGAYITTID |
| Ga0364926_112820_1_162 | 3300033812 | Sediment | VHVSFHNHGDDEVNPIASTAAFAHFQEDHADRREGGVDQQIARLVGAYVTTID |
| Ga0334790_157618_28_183 | 3300033887 | Soil | VSFHNHRDDETNPISSTAAFAHFQDGHESRREGAVNQQTATLVGSYISEIG |
| Ga0371487_0015413_5458_5601 | 3300033982 | Peat Soil | DHGDDEVNPITSTAAFAEFQRDHERRRAGAVDQQTATLVGAYITRVG |
| Ga0364929_0280841_3_152 | 3300034149 | Sediment | FHDHGDDEVNPIASTAAFAHFQQDHADRREGGIDQQTAELVGAYVTTID |
| Ga0370498_000867_7079_7219 | 3300034155 | Untreated Peat Soil | VDPGEVSPIASTAAFAHCQQDHEERREGGVDQQTATLVGAYITVIE |
| Ga0370501_0003338_2583_2744 | 3300034195 | Untreated Peat Soil | VHISFHDHGDDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGAYVTTIA |
| ⦗Top⦘ |