NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020750

Metagenome / Metatranscriptome Family F020750

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020750
Family Type Metagenome / Metatranscriptome
Number of Sequences 222
Average Sequence Length 46 residues
Representative Sequence DDEVNPIASTAAFAHFQDGHADRREGGVDQQTATLVGAYITTID
Number of Associated Samples 199
Number of Associated Scaffolds 222

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.59 %
% of genes near scaffold ends (potentially truncated) 84.23 %
% of genes from short scaffolds (< 2000 bps) 88.74 %
Associated GOLD sequencing projects 189
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.090 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.117 % of family members)
Environment Ontology (ENVO) Unclassified
(31.532 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.541 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.67%    β-sheet: 0.00%    Coil/Unstructured: 83.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 222 Family Scaffolds
PF00903Glyoxalase 5.41
PF12681Glyoxalase_2 4.95
PF00106adh_short 4.05
PF07883Cupin_2 2.25
PF00296Bac_luciferase 2.25
PF02567PhzC-PhzF 1.80
PF00583Acetyltransf_1 1.80
PF04134DCC1-like 1.80
PF07081DUF1349 1.80
PF14572Pribosyl_synth 1.35
PF06723MreB_Mbl 1.35
PF04075F420H2_quin_red 1.35
PF07676PD40 0.90
PF00581Rhodanese 0.90
PF01022HTH_5 0.90
PF03992ABM 0.90
PF07992Pyr_redox_2 0.90
PF00440TetR_N 0.90
PF04657DMT_YdcZ 0.90
PF00027cNMP_binding 0.90
PF00561Abhydrolase_1 0.90
PF07040DUF1326 0.90
PF13673Acetyltransf_10 0.90
PF02371Transposase_20 0.90
PF01636APH 0.90
PF12730ABC2_membrane_4 0.90
PF06224HTH_42 0.90
PF030614HBT 0.45
PF05065Phage_capsid 0.45
PF07690MFS_1 0.45
PF00931NB-ARC 0.45
PF13424TPR_12 0.45
PF01208URO-D 0.45
PF13181TPR_8 0.45
PF00239Resolvase 0.45
PF02683DsbD 0.45
PF13400Tad 0.45
PF00355Rieske 0.45
PF03069FmdA_AmdA 0.45
PF04069OpuAC 0.45
PF05532CsbD 0.45
PF13527Acetyltransf_9 0.45
PF01243Putative_PNPOx 0.45
PF04261Dyp_perox 0.45
PF02720DUF222 0.45
PF08818DUF1801 0.45
PF08448PAS_4 0.45
PF13560HTH_31 0.45
PF00482T2SSF 0.45
PF04250DUF429 0.45
PF02738MoCoBD_1 0.45
PF13539Peptidase_M15_4 0.45
PF10604Polyketide_cyc2 0.45
PF11746DUF3303 0.45
PF03795YCII 0.45
PF13298LigD_N 0.45
PF08327AHSA1 0.45
PF05988DUF899 0.45
PF06745ATPase 0.45
PF03704BTAD 0.45
PF01872RibD_C 0.45
PF02518HATPase_c 0.45
PF13417GST_N_3 0.45
PF08241Methyltransf_11 0.45
PF01544CorA 0.45
PF01844HNH 0.45
PF13847Methyltransf_31 0.45
PF12867DinB_2 0.45
PF14016DUF4232 0.45
PF13336AcetylCoA_hyd_C 0.45
PF13183Fer4_8 0.45
PF16916ZT_dimer 0.45
PF13460NAD_binding_10 0.45
PF04828GFA 0.45
PF12840HTH_20 0.45
PF02082Rrf2 0.45
PF05231MASE1 0.45
PF12697Abhydrolase_6 0.45
PF08734GYD 0.45
PF02899Phage_int_SAM_1 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 222 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.25
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 1.80
COG3011Predicted thiol-disulfide oxidoreductase YuxK, DCC familyGeneral function prediction only [R] 1.80
COG3506Regulation of enolase protein 1 (function unknown), concanavalin A-like superfamilyFunction unknown [S] 1.80
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 1.35
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.90
COG3238Uncharacterized membrane protein YdcZ, DUF606 familyFunction unknown [S] 0.90
COG3547TransposaseMobilome: prophages, transposons [X] 0.90
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.90
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.45
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.45
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.45
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 0.45
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.45
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.45
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.45
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.45
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.45
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.45
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.45
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.45
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.45
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.45
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.45
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.45
COG0407Uroporphyrinogen-III decarboxylase HemECoenzyme transport and metabolism [H] 0.45
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.45
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.45
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.45
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.45
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.45
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.45
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.45
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 0.45
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.45
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.45
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.45
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.45
COG2410Predicted nuclease (RNAse H fold)General function prediction only [R] 0.45
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 0.45
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.45
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.09 %
UnclassifiedrootN/A9.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig190720All Organisms → cellular organisms → Bacteria769Open in IMG/M
2140918007|ConsensusfromContig48233All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300000891|JGI10214J12806_11657612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300000956|JGI10216J12902_111166926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1283Open in IMG/M
3300001538|A10PFW1_11873221All Organisms → cellular organisms → Bacteria → Terrabacteria group719Open in IMG/M
3300001593|JGI12635J15846_10326913All Organisms → cellular organisms → Bacteria → Terrabacteria group949Open in IMG/M
3300002244|JGI24742J22300_10026592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1001Open in IMG/M
3300002459|JGI24751J29686_10049718All Organisms → cellular organisms → Bacteria → Terrabacteria group864Open in IMG/M
3300004022|Ga0055432_10120363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300004114|Ga0062593_102034139All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300004157|Ga0062590_100165013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1543Open in IMG/M
3300004463|Ga0063356_103252865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300005093|Ga0062594_102281636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300005172|Ga0066683_10348311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales919Open in IMG/M
3300005176|Ga0066679_10624282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia703Open in IMG/M
3300005178|Ga0066688_10575764All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005329|Ga0070683_100348576All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300005331|Ga0070670_100541361Not Available1038Open in IMG/M
3300005364|Ga0070673_101045719Not Available761Open in IMG/M
3300005435|Ga0070714_101123427All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005445|Ga0070708_100425704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1252Open in IMG/M
3300005467|Ga0070706_101159007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia711Open in IMG/M
3300005471|Ga0070698_101073059All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300005518|Ga0070699_101839405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300005535|Ga0070684_101033792All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300005536|Ga0070697_101594855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300005536|Ga0070697_101794718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300005537|Ga0070730_11058959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes504Open in IMG/M
3300005561|Ga0066699_11077637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300005568|Ga0066703_10560752All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005575|Ga0066702_10385959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300005586|Ga0066691_10012499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4005Open in IMG/M
3300005586|Ga0066691_10258097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1024Open in IMG/M
3300005616|Ga0068852_100444806All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300005618|Ga0068864_101975925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300006055|Ga0097691_1007241All Organisms → cellular organisms → Bacteria5934Open in IMG/M
3300006174|Ga0075014_100687035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales594Open in IMG/M
3300006354|Ga0075021_10182783All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300006354|Ga0075021_11185552All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300006574|Ga0074056_10590553All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300006580|Ga0074049_13197395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300006604|Ga0074060_12050794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300006642|Ga0075521_10670636Not Available511Open in IMG/M
3300006854|Ga0075425_102432601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300006881|Ga0068865_101277954All Organisms → cellular organisms → Bacteria → Terrabacteria group652Open in IMG/M
3300006893|Ga0073928_11230698All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300006903|Ga0075426_10053600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli2881Open in IMG/M
3300006953|Ga0074063_13266091All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300007982|Ga0102924_1114098All Organisms → cellular organisms → Bacteria → Terrabacteria group1327Open in IMG/M
3300009012|Ga0066710_101023224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1275Open in IMG/M
3300009012|Ga0066710_101586926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1004Open in IMG/M
3300009029|Ga0066793_10881826All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300009090|Ga0099827_11861527All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium524Open in IMG/M
3300009137|Ga0066709_100369031All Organisms → cellular organisms → Bacteria → Terrabacteria group1979Open in IMG/M
3300009137|Ga0066709_100816970Not Available1352Open in IMG/M
3300009137|Ga0066709_100976309All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300009137|Ga0066709_102091595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales783Open in IMG/M
3300009176|Ga0105242_11393433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300009177|Ga0105248_13006519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300009545|Ga0105237_11943539All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300009551|Ga0105238_12418318All Organisms → cellular organisms → Bacteria → Terrabacteria group561Open in IMG/M
3300009801|Ga0105056_1032573All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300010335|Ga0134063_10606651All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300010371|Ga0134125_11690907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300010375|Ga0105239_10626876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1227Open in IMG/M
3300010400|Ga0134122_13189886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300010880|Ga0126350_11780879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300011999|Ga0120148_1072718All Organisms → cellular organisms → Bacteria → Terrabacteria group677Open in IMG/M
3300011999|Ga0120148_1076975All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300012001|Ga0120167_1112596All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300012004|Ga0120134_1060842All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300012010|Ga0120118_1123447All Organisms → cellular organisms → Bacteria → Terrabacteria group624Open in IMG/M
3300012096|Ga0137389_10143720All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300012189|Ga0137388_11850050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300012198|Ga0137364_10891921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300012201|Ga0137365_10486312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium908Open in IMG/M
3300012201|Ga0137365_10925110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300012204|Ga0137374_10412944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1070Open in IMG/M
3300012206|Ga0137380_11600958All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300012207|Ga0137381_10863352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300012208|Ga0137376_10860520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300012209|Ga0137379_10458100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1184Open in IMG/M
3300012353|Ga0137367_10586807All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300012355|Ga0137369_10334122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1112Open in IMG/M
3300012356|Ga0137371_10364114All Organisms → cellular organisms → Bacteria → Terrabacteria group1123Open in IMG/M
3300012358|Ga0137368_10035850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4413Open in IMG/M
3300012358|Ga0137368_10044752All Organisms → cellular organisms → Bacteria3823Open in IMG/M
3300012362|Ga0137361_11891118Not Available514Open in IMG/M
3300012363|Ga0137390_11614040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300012683|Ga0137398_10747985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300012897|Ga0157285_10220442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300012908|Ga0157286_10350146All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300012915|Ga0157302_10422888All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300012925|Ga0137419_11566043All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300012941|Ga0162652_100090759All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300012951|Ga0164300_10865920All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300012961|Ga0164302_10249018All Organisms → cellular organisms → Bacteria → Terrabacteria group1127Open in IMG/M
3300012961|Ga0164302_11458144All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012972|Ga0134077_10334000Not Available643Open in IMG/M
3300012984|Ga0164309_11077146All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300012988|Ga0164306_11035193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300012989|Ga0164305_10300301All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300013100|Ga0157373_10094400All Organisms → cellular organisms → Bacteria2106Open in IMG/M
3300013102|Ga0157371_10222390All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300013105|Ga0157369_10138450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2576Open in IMG/M
3300013105|Ga0157369_10935543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria888Open in IMG/M
3300013297|Ga0157378_13061070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium519Open in IMG/M
3300013763|Ga0120179_1125214Not Available564Open in IMG/M
3300013763|Ga0120179_1131401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300013772|Ga0120158_10032597All Organisms → cellular organisms → Bacteria3940Open in IMG/M
3300013772|Ga0120158_10126709All Organisms → cellular organisms → Bacteria → Proteobacteria1465Open in IMG/M
3300013772|Ga0120158_10286885All Organisms → cellular organisms → Bacteria → Terrabacteria group803Open in IMG/M
3300014052|Ga0120109_1093834All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300014058|Ga0120149_1207736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300014156|Ga0181518_10479102All Organisms → cellular organisms → Bacteria → Terrabacteria group591Open in IMG/M
3300014160|Ga0181517_10028201All Organisms → cellular organisms → Bacteria → Terrabacteria group3712Open in IMG/M
3300014325|Ga0163163_11697076All Organisms → cellular organisms → Bacteria → Terrabacteria group692Open in IMG/M
3300014326|Ga0157380_10182664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1844Open in IMG/M
3300014501|Ga0182024_10091724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4468Open in IMG/M
3300014501|Ga0182024_11548525Not Available754Open in IMG/M
3300015052|Ga0137411_1274467All Organisms → cellular organisms → Bacteria5994Open in IMG/M
3300015241|Ga0137418_10891611All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300015264|Ga0137403_10369742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1318Open in IMG/M
3300015372|Ga0132256_102505660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300015374|Ga0132255_101189709All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300017988|Ga0181520_10023416All Organisms → cellular organisms → Bacteria → Terrabacteria group6881Open in IMG/M
3300018031|Ga0184634_10280449All Organisms → cellular organisms → Bacteria → Terrabacteria group765Open in IMG/M
3300018071|Ga0184618_10106345All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300018469|Ga0190270_13476574All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300018920|Ga0190273_12212048All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300019269|Ga0184644_1370851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia682Open in IMG/M
3300019873|Ga0193700_1044726All Organisms → cellular organisms → Bacteria → Terrabacteria group708Open in IMG/M
3300019875|Ga0193701_1034774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300019875|Ga0193701_1045306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300020016|Ga0193696_1092602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300020059|Ga0193745_1022541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1375Open in IMG/M
3300020581|Ga0210399_10763134Not Available792Open in IMG/M
3300021078|Ga0210381_10299352All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300021081|Ga0210379_10543842All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300021441|Ga0213871_10279590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300021559|Ga0210409_11645057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300022557|Ga0212123_10389111All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300022756|Ga0222622_10202639All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300025319|Ga0209520_10119128All Organisms → cellular organisms → Bacteria → Terrabacteria group1682Open in IMG/M
3300025495|Ga0207932_1003262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5448Open in IMG/M
3300025633|Ga0208480_1003728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5230Open in IMG/M
3300025899|Ga0207642_10033586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2172Open in IMG/M
3300025909|Ga0207705_10820852Not Available721Open in IMG/M
3300025912|Ga0207707_10379338All Organisms → cellular organisms → Bacteria → Terrabacteria group1215Open in IMG/M
3300025914|Ga0207671_10247952All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300025916|Ga0207663_11243524Not Available600Open in IMG/M
3300025925|Ga0207650_10453391Not Available1068Open in IMG/M
3300025933|Ga0207706_11092352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300025934|Ga0207686_10580247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium880Open in IMG/M
3300025960|Ga0207651_11033419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium735Open in IMG/M
3300026041|Ga0207639_10019906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4795Open in IMG/M
3300026067|Ga0207678_10534481All Organisms → cellular organisms → Bacteria → Terrabacteria group1024Open in IMG/M
3300026089|Ga0207648_10274048All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1508Open in IMG/M
3300026116|Ga0207674_10960324All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300026142|Ga0207698_12193768All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300026343|Ga0209159_1166909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium815Open in IMG/M
3300027546|Ga0208984_1110004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300027562|Ga0209735_1098319All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300027857|Ga0209166_10471190All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300027862|Ga0209701_10411766All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300027882|Ga0209590_10715969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300028713|Ga0307303_10053419All Organisms → cellular organisms → Bacteria → Terrabacteria group861Open in IMG/M
3300028720|Ga0307317_10004213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4310Open in IMG/M
3300028720|Ga0307317_10196488All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300028721|Ga0307315_10078879All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300028768|Ga0307280_10263877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium622Open in IMG/M
3300028773|Ga0302234_10192549All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300028778|Ga0307288_10033693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1705Open in IMG/M
3300028802|Ga0307503_10177066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium991Open in IMG/M
3300028807|Ga0307305_10182080All Organisms → cellular organisms → Bacteria → Terrabacteria group968Open in IMG/M
3300028814|Ga0307302_10512162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300028819|Ga0307296_10377883Not Available774Open in IMG/M
3300028819|Ga0307296_10584383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300028819|Ga0307296_10648630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300028828|Ga0307312_10013498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4553Open in IMG/M
3300028828|Ga0307312_10610327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300028875|Ga0307289_10321363All Organisms → cellular organisms → Bacteria → Terrabacteria group637Open in IMG/M
3300028882|Ga0302154_10424066Not Available639Open in IMG/M
3300028884|Ga0307308_10471311All Organisms → cellular organisms → Bacteria → Terrabacteria group602Open in IMG/M
3300028885|Ga0307304_10038280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1723Open in IMG/M
3300029913|Ga0311362_10592846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia989Open in IMG/M
3300030507|Ga0302192_10016380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4320Open in IMG/M
3300030688|Ga0311345_10340319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1387Open in IMG/M
3300030743|Ga0265461_11992204Not Available662Open in IMG/M
3300031093|Ga0308197_10293252Not Available596Open in IMG/M
3300031099|Ga0308181_1110537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300031226|Ga0307497_10415181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium646Open in IMG/M
3300031226|Ga0307497_10740783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales511Open in IMG/M
3300031232|Ga0302323_103303366Not Available514Open in IMG/M
3300031235|Ga0265330_10076828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1441Open in IMG/M
3300031251|Ga0265327_10530036All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300031546|Ga0318538_10701450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia alpina549Open in IMG/M
3300031547|Ga0310887_10920544All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300031573|Ga0310915_11200817All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300031680|Ga0318574_10849183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia alpina535Open in IMG/M
3300031713|Ga0318496_10433392All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300031736|Ga0318501_10194738All Organisms → cellular organisms → Bacteria → Terrabacteria group1059Open in IMG/M
3300031768|Ga0318509_10344731All Organisms → cellular organisms → Bacteria → Terrabacteria group834Open in IMG/M
3300031777|Ga0318543_10115332All Organisms → cellular organisms → Bacteria → Terrabacteria group1163Open in IMG/M
3300031778|Ga0318498_10062113All Organisms → cellular organisms → Bacteria → Terrabacteria group1669Open in IMG/M
3300031858|Ga0310892_10411340All Organisms → cellular organisms → Bacteria → Terrabacteria group883Open in IMG/M
3300031962|Ga0307479_10507306All Organisms → cellular organisms → Bacteria → Terrabacteria group1190Open in IMG/M
3300032010|Ga0318569_10134040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → Agromyces atrinae1134Open in IMG/M
3300032156|Ga0315295_12258754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300032160|Ga0311301_11582238Not Available800Open in IMG/M
3300032516|Ga0315273_10876162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1161Open in IMG/M
3300032892|Ga0335081_11447147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300033811|Ga0364924_145462All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300033812|Ga0364926_112820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300033887|Ga0334790_157618Not Available678Open in IMG/M
3300033982|Ga0371487_0015413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5601Open in IMG/M
3300034149|Ga0364929_0280841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300034155|Ga0370498_000867All Organisms → cellular organisms → Bacteria8755Open in IMG/M
3300034195|Ga0370501_0003338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4025Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.12%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.26%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.25%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.80%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.80%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.80%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.35%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.35%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.35%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.35%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.35%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.35%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.35%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.90%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.90%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.90%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.90%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.90%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.45%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.45%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.45%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.45%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.45%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.45%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.45%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.45%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.45%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.45%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.45%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025495Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_024427102140918007SoilDEVNPIASTAAFAHFQEGHADRREGGVDQQTAKLVGAYITTID
A_all_C_005242102140918007SoilTAAFAHFQEDHADRREGGVDQQTAELVGAYITTID
JGI10214J12806_1165761223300000891SoilDHGDDEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTIE*
JGI10216J12902_11116692643300000956SoilDDEVNPIASTPAFAHFQDDHADRRAGGVDQQTARLVGAYIRAID*
A10PFW1_1187322113300001538PermafrostVHVSFHDHGDDEVNPITSTAAFAHFQAGHADRRAGAVDQQKAT
JGI12635J15846_1032691323300001593Forest SoilTAAFAHFQDGHETRRDGGVNQQKATLVGSYITKIE*
JGI24742J22300_1002659233300002244Corn, Switchgrass And Miscanthus RhizospherePIASTAAFAHFQDGHVERRDGAVDQQSATLVGSYITTIA*
JGI24751J29686_1004971813300002459Corn, Switchgrass And Miscanthus RhizosphereHNHRDDEVNPIASMPAFAHFQDGHADRREGSVDQQTAELVGAYVTTID*
Ga0055432_1012036323300004022Natural And Restored WetlandsVSFHNHGDDEVNPIASTAAFAHFQEDHADRREGGVDQQTAELVGAYVTTIA*
Ga0062593_10203413923300004114SoilVHVSFHDHGEDEVNPIASTPAFAHFQDGHAERRTGGVDQQTATLVSAYITTIA*
Ga0062590_10016501333300004157SoilVHVSFHDHGEDEVNPIASTPAFAHFQDGHAERRAGGVDQQTATLVSAYITTIA*
Ga0063356_10325286523300004463Arabidopsis Thaliana RhizosphereEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTID*
Ga0062594_10228163613300005093SoilEVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID*
Ga0066683_1034831133300005172SoilVNPIASTAAFAHFQQGHADRREGSVDQQTATLVGAYITTID*
Ga0066679_1062428213300005176SoilDEVNPIASTAAFAHFQDGHPDRREGSVDQQTATLVGAYITTID*
Ga0066688_1057576423300005178SoilFVHVSFHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID*
Ga0070683_10034857623300005329Corn RhizosphereVRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE*
Ga0070670_10054136113300005331Switchgrass RhizosphereNPIASMPAFAHFQDGHADRREGSVDQQTAELVGAYVTTID*
Ga0070673_10104571923300005364Switchgrass RhizospherePIASTAAFAHFQDGHTDRRQGAVDQQRATLVGAYVTLIA*
Ga0070714_10112342723300005435Agricultural SoilNPIASTPAFAHFQQDHADRREGGVDQQTASLVGAYITTID*
Ga0070708_10042570413300005445Corn, Switchgrass And Miscanthus RhizosphereDEPNPIASTPAFAHFQEDHADRREGGVDQQTATLVGAYITTID*
Ga0070706_10115900723300005467Corn, Switchgrass And Miscanthus RhizosphereHVSFHNHRDDEPNPIASTPAFAHFQQDHADRRDGGVDQQTATLVGAYITTID*
Ga0070698_10107305923300005471Corn, Switchgrass And Miscanthus RhizosphereHVSFHDHGDDEPNPIASTAAFAHFQENHAERREGGVDQQTATLVGSYITTID*
Ga0070699_10183940513300005518Corn, Switchgrass And Miscanthus RhizosphereVHVSFHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTAQLVGSYITTID*
Ga0070684_10103379223300005535Corn RhizosphereHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE*
Ga0070697_10159485513300005536Corn, Switchgrass And Miscanthus RhizosphereFVHVSFHNHGDDEVNPIASTTAFAHFQDGHADRREGGVDQQTATLVGAYITTID*
Ga0070697_10179471813300005536Corn, Switchgrass And Miscanthus RhizosphereEVNPIASTAAFAHFQQDHAGRREGDVDQQTASLVGAYITTID*
Ga0070730_1105895913300005537Surface SoilFHDHGDDEVNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITVID*
Ga0066699_1107763723300005561SoilFHNHGDDEVNPIASTPAFAHFQEGHANRREGGVSQQTATLVGAYITTIA*
Ga0066703_1056075213300005568SoilHVSFHNHGDDEPNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYITTID*
Ga0066702_1038595923300005575SoilDEPNPIASTAAFAHFQEDHADRREGGVDQQTATLVGSYITTID*
Ga0066691_1001249913300005586SoilSFHDHADNEVNPITSTPAFAHFQQDHAARRQGAVDQQTAKLVGAYITKIE*
Ga0066691_1025809723300005586SoilHNHGDDEVNPIASTAAFAHFQDGHPDRREGSVDQQTATLVGAYITTID*
Ga0068852_10044480623300005616Corn RhizosphereVRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARRLVAHLTVIE*
Ga0068864_10197592513300005618Switchgrass RhizosphereHDHREDETNPIASTAAFAHFQDGHVERRDGAVDQQTATLVGSYITTIA*
Ga0097691_100724113300006055Arctic Peat SoilVHLSFHNHGDDEVNPIASFPAFAHFQEGHADRRAGEVDQQKATLVGAYITTID*
Ga0075017_10017779513300006059WatershedsFVHVSFHDHGDDEPNPIASTAAFAHFQDGHAERRSGGVDQQTAVLVGSYVTTIA*
Ga0075014_10068703513300006174WatershedsHVSFHDHGDDEVNPIASTAAFAHFQDGHADRRAGGVDQQTAQLVGAYVTVID*
Ga0075021_1018278333300006354WatershedsHVSFHDHGDDEVNPIASTAAFAHFQDGHADRRDGGVDQQKAELVGAYITVIA*
Ga0075021_1118555223300006354WatershedsDEVNPISSTAAFARFQDGHGERRDGGVNQQTATLVGSYITTIA*
Ga0074056_1059055333300006574SoilVNPIASTASFAHFQDGHAERRDGAVDQQTAELVGAYITKID*
Ga0074049_1319739513300006580SoilPRPIASTAAFAHFQQDHAGRRDGGVDQQTAQLVGAYITTIE*
Ga0074060_1205079423300006604SoilHGDDEVNPIASTDAFAHFQDGHADRREGGVDQQTASLVGAYITVID*
Ga0075521_1067063613300006642Arctic Peat SoilASTAAFAHFQEGHADRRAGAIDQQKATLVGAYITTID*
Ga0075425_10243260113300006854Populus RhizosphereVHVSFHNHRDDEPNPIASTAAFAHFQDAHAERRDGGVNQQTAELVGAYITTIA*
Ga0068865_10127795423300006881Miscanthus RhizosphereHGDDELNPITSTAAFAYFQEDHADRREGGVDQQTATLVGAYITAID*
Ga0073928_1123069823300006893Iron-Sulfur Acid SpringFHNHTDDEVNPISSTPAFAHFQQDHADRRDGGVNQQTATLVGAYITVIE*
Ga0075426_1005360063300006903Populus RhizosphereHNHRDDEPNPIASTAAFAHFQDDHASRRDGGVDQQTAALVGAYITTIA*
Ga0074063_1326609113300006953SoilFHDHGDDEVNPIASTDAFAHFQEGHADRRDGGVDQQTASLVGAYVTVIE*
Ga0102924_111409813300007982Iron-Sulfur Acid SpringNPITSMASFAHFQQDHAARRQGAADQQTAKLVGAYITKIA*
Ga0066710_10102322413300009012Grasslands SoilHGDDEVNPIASTAAFAHFQQEHADRREGPVDQQTADLVGAYITNID
Ga0066710_10158692633300009012Grasslands SoilSFHDHGDDEVNPIASLPAFAHFQQGHADRREGGVDQQTAELVGAYITVID
Ga0066793_1088182623300009029Prmafrost SoilVHLSFHNHGDDEVNPIASAGAFAHFQEGHADRRAGAIDQQKATLVGAYITTID*
Ga0099827_1186152723300009090Vadose Zone SoilEVNPIASTAAFAHFQQDHADRREGGVDQQTAELVGAYITTIA*
Ga0066709_10036903113300009137Grasslands SoilEVNPIASTASFAHFQQDHAGRRAGDVDQQTAELVGAYITTIG*
Ga0066709_10081697013300009137Grasslands SoilASTAAFAHFQDGHADRRAGGVDQKTATLVGAYITTID*
Ga0066709_10097630933300009137Grasslands SoilDDEVNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYITTID*
Ga0066709_10209159513300009137Grasslands SoilFHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID*
Ga0105242_1139343323300009176Miscanthus RhizosphereDHGDDEVNPIASTAAFAHFQDGHGDRRQGGVEQQTAELVGSYITTID*
Ga0105248_1300651913300009177Switchgrass RhizosphereIASTAAFAHFQDGHADRREGGVDQQTATLVGAYITTID*
Ga0105237_1194353913300009545Corn RhizosphereVHVSFHDHGDDEVNPIASTPAFVHFQKDHADRREGGVDQQTAELVGAYITTID*
Ga0105238_1241831823300009551Corn RhizosphereSHGRVRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE*
Ga0105056_103257323300009801Groundwater SandFLHVSFHNHRDDEVNPIASTAAFAHFQQDHADRREGTVDQQTAELVGVYVTTID*
Ga0134063_1060665123300010335Grasslands SoilVHVSFHDHGDDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGSYITTID*
Ga0134125_1169090713300010371Terrestrial SoilDDEVNPIASTAAFAHFQDGHETRREGGVDQQTASLVGAYVTVIE*
Ga0105239_1062687633300010375Corn RhizosphereDDEVNPIASTTAFAHFQDGHADRREGDVAQQRAELVGAYLTVVE*
Ga0134122_1318988623300010400Terrestrial SoilVHVSFHDHGEADVNPIASTAAFAHFQDGHADRREGGVDQQTAELVGAYITTID*
Ga0126350_1178087913300010880Boreal Forest SoilAPGETNPIGSAAAFARFIDGHADRREGEVDQQQASLVGAYITHIG*
Ga0120148_107271833300011999PermafrostSTAAFAHFQQDHADRREGGVDQQTARLVGSYITTID*
Ga0120148_107697523300011999PermafrostVNPISSTAAFSHFQLDHSDRREGGVDQQTATLVGAYITSID*
Ga0120167_111259633300012001PermafrostVSFHDHGEDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGAYITTIA*
Ga0120134_106084223300012004PermafrostDHGDDEVNPIASTPAFAHFQEDHAARREGGVDQQTAKLVGAYITTID*
Ga0120118_112344713300012010PermafrostVSFPDHGDDEVNPIASSTAFAHFQQDHADRREGPVDQQTATLVGAYVTTID*
Ga0137389_1014372053300012096Vadose Zone SoilFHDHGDDEVNPIASTPAFAHFQEDHAARREGGVDQQTAKLVGAYITTID*
Ga0137388_1185005023300012189Vadose Zone SoilVHVSFHDHGDDEVNPIASTAAFAHFQQDHANRRDGGVDQQTATLVGAYITTID*
Ga0137364_1089192113300012198Vadose Zone SoilDEVNPIASTAAFAHFQQEHADRREGPVDQQTADLVGAYITTID*
Ga0137365_1048631223300012201Vadose Zone SoilFHNHGDDELNPIASTPAFAHFQQDHADRREGGVDQQTATLVGAYITTID*
Ga0137365_1092511023300012201Vadose Zone SoilFVHISFHDHADDEVNPIASSEAFAYFQQDHADRRQGGVDQQTATLVGAYITTID*
Ga0137374_1041294433300012204Vadose Zone SoilVHVSFHDHGENEVNPIASTPAFAHFQEDHADRREGGVDQQTATLVGAYITTID*
Ga0137380_1160095823300012206Vadose Zone SoilGDDEVNPIASTPAFAHFQESHADRREGGVDQQTAELVGAYITVID*
Ga0137381_1086335233300012207Vadose Zone SoilPAFAHFQQDHAERREGGVDQQTATLVGAYITTID*
Ga0137376_1086052013300012208Vadose Zone SoilVSFHNHGDDEVNPIASTRAFAHFQEDHADRREGGVDQQTATLVGAYITTID*
Ga0137379_1045810013300012209Vadose Zone SoilIASTPAFAHFQESHADRREGGVDQQTAELVGAYITVID*
Ga0137367_1058680723300012353Vadose Zone SoilLCTCRFHDHGDDEVNPIASTDAFGHFQQHHSDRREGGVDQQTAELVGAYITTID*
Ga0137369_1033412223300012355Vadose Zone SoilLCTCRFHDHGDDEVNPIASTDAFGHFQQHHSDRREGGVDQQTAELVGAYIPTID*
Ga0137371_1036411413300012356Vadose Zone SoilDVNPIASTAAFAHFQQGHADRREGAVDQQTATLLGAYITTID*
Ga0137368_1003585023300012358Vadose Zone SoilVNPIASTDAFGHFQQHHSDRREGGVDQQTAELVGAYITTID*
Ga0137368_1004475263300012358Vadose Zone SoilLGVVRRLGHGDDEVNPIASTAAFAHFQHDHTDRRAGGVDQQTASLVGAYITTID*
Ga0137361_1189111813300012362Vadose Zone SoilERNPIASTAAFAHFQDGHADRREGAVDQQRAELVGAYVTVIA*
Ga0137390_1161404013300012363Vadose Zone SoilNHGDDEVNPIASTAAFAHFQQGHADRREGGADQQTATLVGAYVTTID*
Ga0137398_1074798513300012683Vadose Zone SoilHLSFHDHGDNEVNPITSTASFAHFQQDHAARRQGAVDQQTATLVGAYITKIE*
Ga0157285_1022044213300012897SoilDEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTID*
Ga0157286_1035014623300012908SoilSTAAFAHFQQDHADRRDGDVDQQTATLVGAYITTID*
Ga0157302_1042288813300012915SoilHDHGDDEVNPIASTASFAHFQDGHEERRAGGVDQQTATLVGAYITTIA*
Ga0137419_1156604313300012925Vadose Zone SoilVNPIASTAAFAHFQQDHSDRREGSVDQQTAKLVGAYITTID*
Ga0162652_10009075923300012941SoilVSFHNHGDDEVNPIASTAAFALFQQDHADRRAGGVDQQTAELVGAYITTID*
Ga0164300_1086592013300012951SoilDEVNPIASTAAFALFQEDHADRREGVVDQQTAELVGAYITTVD*
Ga0164302_1024901823300012961SoilEVNPISSTAAFARFQDGHGDRREGAVDQQTATLIGAYVTTID*
Ga0164302_1145814423300012961SoilHGEDDVNPIASTAAFAHFQEDHAERRDGGVDQQTASLVGAYITTID*
Ga0134077_1033400023300012972Grasslands SoilEVNPIASTAAFAHFQDGHADRREGSVDQQTAALVGAYITTID*
Ga0164309_1107714613300012984SoilDVNPIASTAAFAHFQEDHAERRDGGVDQQTASLVGAYITTID*
Ga0164306_1103519313300012988SoilASTAAFAHFQDGHADRREGGVDQQTATLVGSYITTIA*
Ga0164305_1030030113300012989SoilASAFAHFQDGHADRRDGAVDQQTAELVGAYITRIA*
Ga0157373_1009440053300013100Corn RhizosphereNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVE*
Ga0157371_1022239033300013102Corn RhizosphereVRGDDFSRPDFHDHGDDEVNPIASTTAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE*
Ga0157369_1013845013300013105Corn RhizosphereVNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVE*
Ga0157369_1093554333300013105Corn RhizosphereDETNPIASTAAFAHFQDGHVERRDGAVDQQTATLVGSYITTIA*
Ga0157378_1306107013300013297Miscanthus RhizosphereHGDDEVNPIASSAAFAHFQDGHSDRREGPVDQQQAELVGAYITTIA*
Ga0120179_112521433300013763PermafrostDEVNQIASTAAFAHFQDGHDERREGGVDQQKATLVGAYITTID*
Ga0120179_113140123300013763PermafrostVSFHDHGDDEVNPIASTPAFAHFQEDHAARREGGVDQQTAKLVGAYITTID*
Ga0120158_1003259713300013772PermafrostFHDHGDDEVNPIASTAAFAHFQDGHADRREGAVDQQTAELVGAYITTID*
Ga0120158_1012670933300013772PermafrostVNPIASTAAFAHFQEDHAARREGGVDQQTAQLVGAYITTIE*
Ga0120158_1028688523300013772PermafrostVSFHDHGDDEVNPIASTAAFAHFQDDHAGRRQGGVDQQTAELVGAYVTTID*
Ga0120109_109383413300014052PermafrostFHDHGDDEVNPIASTAAFAHFQKDHADRREGGVDQQTARLVGAYVTTID*
Ga0120149_120773623300014058PermafrostHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQKATLVGAYITTID*
Ga0181518_1047910223300014156BogVNPIASTSAFAQFQQDHPSRRAGAIDQQTATLVGAYITTID*
Ga0181517_1002820133300014160BogLSFHNHGDDEVNPIASTSAFAQFQQDHPSRRAGAIDQQTATLVGAYITTID*
Ga0163163_1169707613300014325Switchgrass RhizosphereVDELNPIASTAAFAHFQQDHADRRDGDVDQQTATLVGAYITTIG*
Ga0157380_1018266413300014326Switchgrass RhizospherePIASTAAFAHFQDGHVERRDGAVDQQTATLVGSYITTIA*
Ga0182024_1009172473300014501PermafrostGDDDVNPITSTAAFGYFQQVHADRRQGEVDQQTATLVGAYITSIG*
Ga0182024_1154852523300014501PermafrostPAFAHFQENHGDRREGDVNQQTAQLVGAYITEIA*
Ga0137411_1274467123300015052Vadose Zone SoilVNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYVTTID*
Ga0137418_1089161123300015241Vadose Zone SoilVSFHNHGDDEVNPIASTPAFAHFQEDHADRREGGVDQKTASLVGAYITTID*
Ga0137403_1036974213300015264Vadose Zone SoilGDDEVNPIASTPAFAHFQEGHGDRRDGGVDQQTATLVGAYITTIE*
Ga0132258_1057343613300015371Arabidopsis RhizosphereFVHVSFHDHSDNDVNPIASTAAFARFQDGHGDRREGHVDQQTAELVGAYITTIA*
Ga0132256_10250566013300015372Arabidopsis RhizosphereHVSFHDHGEDEVNPIASTAAFAHFQDGHADRREGGVDQQTARLVGAYINTID*
Ga0132255_10118970923300015374Arabidopsis RhizosphereDDPNPIASLPAFQHFQDGHATRRSGGVDQQQATLVGSYIAAVG*
Ga0181520_1002341643300017988BogLSFHNHGDDEVNPIASTSAFAQFQQDHPSRRAGAIDQQTATLVGAYITTID
Ga0184634_1028044923300018031Groundwater SedimentSFHNHRDDEVNPIASTAAFAHFQDGHADRREGGVDQQTAELVGAYVTVIE
Ga0184618_1010634533300018071Groundwater SedimentHVSFHDHGEDEVNPIASTAAFAHFQDGHAHRRAGGVDQKTATLVGAYITTID
Ga0190270_1347657423300018469SoilMTQVNPIASTAAFAHFQQDHADRREGSVDQQTATLVGAYITTID
Ga0190273_1221204813300018920SoilSFHNHGDDEVNPIASTAAFAHFQQDHADRRQGGVDQQRAELVGAYITTID
Ga0184644_137085113300019269Groundwater SedimentHNHGDDEVNPIASTPAFAHFQQDHADRRQGGVDQQTAELVGAYITTID
Ga0173479_1036678023300019362SoilFVHVSFHDHGDDDVNPIASTPAFAHFQQDHADRREGGVDQQTATLVGAYVTTIE
Ga0193700_104472623300019873SoilVSFHNHTDDEVNPIASTAAFAHFQDGHGERREGGVDQKTATLVGAYITTIA
Ga0193701_103477423300019875SoilNHGDDEVNPIASTAAFAHFQQDHADRREGGVDQQTAQLVGAYITTID
Ga0193701_104530633300019875SoilDETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITAIA
Ga0193696_109260233300020016SoilNPIASTAAFAHFQDGHADRREGGVDQQTATLVGSYITTIA
Ga0193745_102254113300020059SoilFHDHRDDETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITTIA
Ga0210399_1076313423300020581SoilHNHGDDEANPIASTAAFAHFQDGHPERRAGAVDQQKAALVGAYITTIA
Ga0210381_1029935223300021078Groundwater SedimentNPIASTAAFAHFQQDHADRREGGVDQQTAELVGAYITTIV
Ga0210379_1054384213300021081Groundwater SedimentHDHGDDEVNPIASTPAFAHFQDGHADRREGSVDQQTATLVGAYITTID
Ga0213871_1027959013300021441RhizosphereLEAFAHFQDGHETRRQGGVDQQEATLVGAYITNIA
Ga0210409_1164505713300021559SoilIASTAAFAHFQQDHADRRQGAVDQQPARLVGAYITVID
Ga0212123_1038911113300022557Iron-Sulfur Acid SpringEVNPIASTPAFAHFQQDHGDRREGGVDQQTATLVGAYITEIG
Ga0222622_1020263913300022756Groundwater SedimentDDEVNPIASTAAFAHFQDGHADRREGGVDQQTATLVGAYITTID
Ga0209520_1011912823300025319SoilNPIASTAAFARFQQDHDDRREGGVDQQTAELVGAYITTID
Ga0207932_100326293300025495Arctic Peat SoilVHLSFHNHGDDEVNPIASFPAFAHFQEGHADRRAGEVDQQKATLVGAYITTID
Ga0208480_100372813300025633Arctic Peat SoilSSAFAHFQDGRESRRDGAVDQQTATLVGARITEIA
Ga0207642_1003358613300025899Miscanthus RhizosphereVSFHDHREEETNPIASTAAFAHFQDGHVERRDGAVDQQSATLVGSYITTIA
Ga0207705_1082085223300025909Corn RhizosphereVRGDDFSRPDFHDHGDDEVNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVE
Ga0207707_1037933823300025912Corn RhizosphereVRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYLTVIE
Ga0207671_1024795213300025914Corn RhizosphereEVNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVD
Ga0207663_1124352413300025916Corn, Switchgrass And Miscanthus RhizosphereSTEAFARFQEGHADRREGGVDQQTATLVGAYLTVVD
Ga0207650_1045339123300025925Switchgrass RhizosphereNPIASMPAFAHFQDGHADRREGSVDQQTAELVGAYVTTID
Ga0207706_1109235213300025933Corn RhizosphereDHGDDEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTIE
Ga0207686_1058024733300025934Miscanthus RhizosphereVSFHDHGDDEVNPIASTAAFAHFQDGHAERREGGVDQQTATLVGAYITTIE
Ga0207651_1103341923300025960Switchgrass RhizosphereVHVSFHDHGDDEVNPIASTAAFAHFQQDHADRRDGGVDQQTATLVGAYITTID
Ga0207639_1001990613300026041Corn RhizosphereASTAAFARFQDGHVERRDGAVDQQTATLVGSYITTIA
Ga0207678_1053448123300026067Corn RhizosphereVRGDDFSRPDFHDHGDDEVNPIASTAAFAHFQDGHADRREGDVVQQQARLVGAYL
Ga0207648_1027404813300026089Miscanthus RhizosphereIASSAAFAHIQDGHSDRREGPVDQQQAELVGAYITTIA
Ga0207674_1096032433300026116Corn RhizosphereVNPIASTEAFAHFQDGHAERREGPVDQQTATLVGAYVT
Ga0207698_1219376823300026142Corn RhizosphereVNPIASSAAFAHFQDGHADRRDGGVDQQQAQLVGAYLTVVD
Ga0209159_116690923300026343SoilEVNPITSTPAFGHFQQDHSARRQGAVDQQTATLVGAYITKIE
Ga0208984_111000413300027546Forest SoilGDDEVNPIASTAAFAHFQEDHGSRRQGGVDQQTAKLVGAYITKIE
Ga0209735_109831913300027562Forest SoilFHDHGDDEVNPIASTAAFAHFQDGHADRREGSVDQQTAELVGAYITTID
Ga0209166_1047119023300027857Surface SoilFHDHGDDEVNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITVID
Ga0209701_1041176613300027862Vadose Zone SoilFHDHGDDEVNPIASTAAFAHFQQDHADRREGGVDQQTARLVGAYITTID
Ga0209590_1071596933300027882Vadose Zone SoilVNPIASTAAFAHFQQDHADRREGGVDQQTATLVGAYVTTID
Ga0307303_1005341913300028713SoilVNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITTIA
Ga0307317_1000421383300028720SoilDDEVNPIASTAAFAHFQQDHADRRQGGVDQQTAELVGAYITTID
Ga0307317_1019648813300028720SoilTPDFAHFQDGHAERRAGGVDQQTATLVGAYITTIA
Ga0307315_1007887933300028721SoilEVNPIASTAAFEHFQDGHAERRAGGVDQQTATLVGAYITTIA
Ga0307280_1026387723300028768SoilRRLHVSFHDHGDDEVNPIASTAAFAHFQDGHAERRAGGVDQQTATLVGAYITTIA
Ga0302234_1019254913300028773PalsaGDDEVNPISSTPAFAHFQDGHGERREGGVDQHTATLVGAYINKIE
Ga0307288_1003369333300028778SoilRDDETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITTIA
Ga0307503_1017706613300028802SoilLHVSFHDHGDDEVNPIASTAAFAHFQDGHGDRREGGVDQQTAELVGAYITTID
Ga0307305_1018208023300028807SoilGDDEVNPIASTPAFAHFQEDHAGRRDGPVDQQTAELVGSYITTID
Ga0307302_1051216223300028814SoilNPIASTAAFAHFQDGHADRREGAVNQQTAELVGAYITTID
Ga0307296_1037788313300028819SoilSTAAFAHFQDGHADRRQGAVDQQRATLVGAYVTVIT
Ga0307296_1058438313300028819SoilHVSFHDHRDDETNPIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITTIA
Ga0307296_1064863013300028819SoilDDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGSYITTID
Ga0307312_1001349813300028828SoilIASTAAFAHFQDGHVDRREGGVDQQTATLVGSYITAIA
Ga0307312_1061032713300028828SoilPGETNPIASTAAFAHFADGHGERRQGEIDQQQASLVGAYVTHIG
Ga0307289_1032136313300028875SoilHGDDEINPIASTAAFAHFQQDHADRREGGIDQQTATLVGAYITTID
Ga0302154_1042406613300028882BogNHRDDEPNPISSSAAFAHFQDGHEGRRVGAVEQQTATLVGSYVTEIA
Ga0307308_1047131133300028884SoilHGDDEVNPIASTAAFAHFQEDHSDRREGAVDQQTAELVGAYITTIA
Ga0307304_1003828013300028885SoilGDHEVNPIASTAAFAHFQEAHSDRRDGAVDQQTAELVGAYITTIA
Ga0311362_1059284613300029913BogFHNHGDDQPNPISSTAAFAHFQDGHENRRDGAVSQQSASLVGAYVTEIA
Ga0302192_1001638053300030507BogVSFHNHRDDEPNPISSSAAFAHFQDGHEGRRVGAVEQQTATLVGSYVTEIA
Ga0311345_1034031933300030688BogFHNHRDDEPNPISSTAAFAHFQDGHESRREGAVNQQTASLVGAYITEIA
Ga0265461_1199220413300030743SoilDEVNPISSTAAFAHFQDGHEERREGGVNQQKATLVGSYITKIE
Ga0308197_1029325213300031093SoilIASTAAFAHFQDGHADRREGSVDQQTATLVGAYITTID
Ga0308181_111053723300031099SoilASTAAFAHFQQDHADRRAGGVDQQTAELVGAYITTIA
Ga0307497_1041518113300031226SoilPIASTAAFAHFQEDHADRREGGVDQQTATLVGAYITAID
Ga0307497_1074078323300031226SoilDEANPIASTAAFAHFQQDHADRREGGVDQQTAQLVGAYITTIA
Ga0302323_10330336623300031232FenNPITSLASFDHFQDGHAERRDGAVDQQKAKLVGAYIKRIA
Ga0265330_1007682813300031235RhizosphereLHVSFHDHSDDEVNPIASTAAFAHFQDGHADRREGAVDQQTASLVGAYVTTIA
Ga0265327_1053003633300031251RhizosphereEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGAYVTTIA
Ga0318538_1070145013300031546SoilDDEPNPISSTDAFAHFQDGHQTRRRGDVDQHTASLVGVYITEIA
Ga0310887_1092054423300031547SoilEVNPIASTAAFAHFQENHADRRDGVVDQQTAELVGAYITSID
Ga0310915_1120081713300031573SoilTAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA
Ga0318574_1084918323300031680SoilSSTAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA
Ga0318496_1043339223300031713SoilFVHVSFHDHGDDEPNPISSTAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA
Ga0318501_1019473813300031736SoilDEPNPISSTAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA
Ga0318509_1034473113300031768SoilDDEPNPISSTAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA
Ga0318543_1011533213300031777SoilPISSTAAFAHFQDGHETRRQGGVDQQTATLVGAYITEIA
Ga0318498_1006211333300031778SoilVSFHDHGDDEPNPISSTAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA
Ga0310892_1041134013300031858SoilHNHADDEVNPIASTAAFAHFQENHADRRDGVVDQQTAELVGAYITSID
Ga0307479_1050730623300031962Hardwood Forest SoilNPIASTPEFARFQDGHDSRRNGPVDQQTAQLIGAYITTIG
Ga0318569_1013404013300032010SoilSTAAFAHFQDGHETRRQGAVDQQTATLVGAYITEIA
Ga0315295_1225875413300032156SedimentSTAAFAHFQQDHADRREGGADQQTAELVGAYITTID
Ga0311301_1158223823300032160Peatlands SoilEVNPISSTAAFAHFQDGHADRRSGGVDQQKATLVGSYITTIG
Ga0315273_1087616213300032516SedimentSTAAFAHFQQDHADRREGGVDQQTAELVGAYITTID
Ga0335081_1144714723300032892SoilVHVSFHDHGDDEVNPITSTAAFAHFQEDHADRRDGGVDQQTATLVGSYVTVIG
Ga0364924_145462_5_1603300033811SedimentVSFHNHGDDEVNPIASTAAFAHFQQDHADRREGGVDQQTAELVGAYITTID
Ga0364926_112820_1_1623300033812SedimentVHVSFHNHGDDEVNPIASTAAFAHFQEDHADRREGGVDQQIARLVGAYVTTID
Ga0334790_157618_28_1833300033887SoilVSFHNHRDDETNPISSTAAFAHFQDGHESRREGAVNQQTATLVGSYISEIG
Ga0371487_0015413_5458_56013300033982Peat SoilDHGDDEVNPITSTAAFAEFQRDHERRRAGAVDQQTATLVGAYITRVG
Ga0364929_0280841_3_1523300034149SedimentFHDHGDDEVNPIASTAAFAHFQQDHADRREGGIDQQTAELVGAYVTTID
Ga0370498_000867_7079_72193300034155Untreated Peat SoilVDPGEVSPIASTAAFAHCQQDHEERREGGVDQQTATLVGAYITVIE
Ga0370501_0003338_2583_27443300034195Untreated Peat SoilVHISFHDHGDDEVNPIASTAAFAHFQDGHADRRAGGVDQQTATLVGAYVTTIA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.