| Basic Information | |
|---|---|
| Family ID | F020738 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 222 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 222 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.60 % |
| % of genes from short scaffolds (< 2000 bps) | 1.35 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.396 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.225 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.946 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 222 Family Scaffolds |
|---|---|---|
| PF00557 | Peptidase_M24 | 8.11 |
| PF01381 | HTH_3 | 7.21 |
| PF00484 | Pro_CA | 2.25 |
| PF13561 | adh_short_C2 | 1.80 |
| PF00196 | GerE | 1.35 |
| PF00589 | Phage_integrase | 1.35 |
| PF08241 | Methyltransf_11 | 1.35 |
| PF13378 | MR_MLE_C | 1.35 |
| PF00069 | Pkinase | 0.90 |
| PF13365 | Trypsin_2 | 0.90 |
| PF02899 | Phage_int_SAM_1 | 0.90 |
| PF12844 | HTH_19 | 0.90 |
| PF03422 | CBM_6 | 0.90 |
| PF13650 | Asp_protease_2 | 0.90 |
| PF13533 | Biotin_lipoyl_2 | 0.90 |
| PF02223 | Thymidylate_kin | 0.90 |
| PF06500 | FrsA-like | 0.90 |
| PF05275 | CopB | 0.90 |
| PF01081 | Aldolase | 0.90 |
| PF10282 | Lactonase | 0.45 |
| PF03100 | CcmE | 0.45 |
| PF02594 | DUF167 | 0.45 |
| PF14748 | P5CR_dimer | 0.45 |
| PF13176 | TPR_7 | 0.45 |
| PF00871 | Acetate_kinase | 0.45 |
| PF05988 | DUF899 | 0.45 |
| PF09123 | DUF1931 | 0.45 |
| PF00150 | Cellulase | 0.45 |
| PF13377 | Peripla_BP_3 | 0.45 |
| PF08808 | RES | 0.45 |
| PF07080 | DUF1348 | 0.45 |
| PF14341 | PilX_N | 0.45 |
| PF08240 | ADH_N | 0.45 |
| PF04116 | FA_hydroxylase | 0.45 |
| PF14361 | RsbRD_N | 0.45 |
| PF13366 | PDDEXK_3 | 0.45 |
| PF00361 | Proton_antipo_M | 0.45 |
| PF12867 | DinB_2 | 0.45 |
| PF06283 | ThuA | 0.45 |
| PF13407 | Peripla_BP_4 | 0.45 |
| PF09832 | DUF2059 | 0.45 |
| PF00702 | Hydrolase | 0.45 |
| PF04542 | Sigma70_r2 | 0.45 |
| PF00106 | adh_short | 0.45 |
| PF02604 | PhdYeFM_antitox | 0.45 |
| PF05402 | PqqD | 0.45 |
| PF01436 | NHL | 0.45 |
| PF14833 | NAD_binding_11 | 0.45 |
| PF03551 | PadR | 0.45 |
| PF00034 | Cytochrom_C | 0.45 |
| PF00953 | Glycos_transf_4 | 0.45 |
| PF00175 | NAD_binding_1 | 0.45 |
| PF02837 | Glyco_hydro_2_N | 0.45 |
| PF07228 | SpoIIE | 0.45 |
| PF07724 | AAA_2 | 0.45 |
| PF16576 | HlyD_D23 | 0.45 |
| PF14659 | Phage_int_SAM_3 | 0.45 |
| PF05015 | HigB-like_toxin | 0.45 |
| PF02633 | Creatininase | 0.45 |
| PF13620 | CarboxypepD_reg | 0.45 |
| PF03544 | TonB_C | 0.45 |
| PF07238 | PilZ | 0.45 |
| PF00463 | ICL | 0.45 |
| PF13360 | PQQ_2 | 0.45 |
| PF02836 | Glyco_hydro_2_C | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.60 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 2.25 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.90 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.90 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.90 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.90 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.90 |
| COG3667 | Uncharacterized conserved protein involved in copper resistance | Inorganic ion transport and metabolism [P] | 0.90 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.45 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.45 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.45 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.45 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.45 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.45 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.45 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.45 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.45 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.45 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.45 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.45 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.45 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.45 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.45 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.45 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.45 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.45 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.45 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.45 |
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.40 % |
| All Organisms | root | All Organisms | 3.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009088|Ga0099830_10084669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2334 | Open in IMG/M |
| 3300010376|Ga0126381_100074636 | All Organisms → cellular organisms → Bacteria | 4243 | Open in IMG/M |
| 3300014151|Ga0181539_1008894 | All Organisms → cellular organisms → Bacteria | 7058 | Open in IMG/M |
| 3300020199|Ga0179592_10129846 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300026551|Ga0209648_10025536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5164 | Open in IMG/M |
| 3300027109|Ga0208603_1037534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300027875|Ga0209283_10072607 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300032091|Ga0318577_10540358 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.90% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.45% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.45% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.45% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.45% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100108371 | 3300001593 | Forest Soil | SVXFGFLSRRGAYQRARYILWSFILFLVIGVGIGWAMYPFSH* |
| JGI12635J15846_104793471 | 3300001593 | Forest Soil | RRRTSERVKYIIWSLFLFLLIGVGIGWAMYPFSR* |
| JGIcombinedJ26739_1000953695 | 3300002245 | Forest Soil | MVIFALLVSVAFGFLSRRGSYQRARYILWSFILFLLIGVGIGWAMYPFSH* |
| JGIcombinedJ26739_1004505421 | 3300002245 | Forest Soil | MLLFALMISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSH* |
| JGIcombinedJ26739_1009337982 | 3300002245 | Forest Soil | MLLFALMISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSR* |
| JGI25382J43887_102592282 | 3300002908 | Grasslands Soil | FALVISIAFGFLSRRQPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| JGI25617J43924_100064845 | 3300002914 | Grasslands Soil | MLLFALLISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSR* |
| JGI25617J43924_100517861 | 3300002914 | Grasslands Soil | SMLLFALVISIAFGFLSRRRPIDRVKYIVWSLILFILIGVGIGWAMYPFSH* |
| JGI25617J43924_100902993 | 3300002914 | Grasslands Soil | MLLFALLISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSH* |
| Ga0062387_1012162912 | 3300004091 | Bog Forest Soil | VISVAFGFLGRRKQPDQLKYALWSLFLFLLVGIGIGWAMFPFSK* |
| Ga0062595_1020088641 | 3300004479 | Soil | AFGFLSRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0066672_108617201 | 3300005167 | Soil | IFALVISVAFGFLGRRQPKERVKYILWTLLLFLLVGVGIGWAMYPFSR* |
| Ga0066680_109222431 | 3300005174 | Soil | LFALLISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0066678_100999141 | 3300005181 | Soil | LISIAFGFLSRRQPIERVKYIVWSLLLFLLIGVGIGWAMYPFSR* |
| Ga0066678_109757571 | 3300005181 | Soil | AFGFLSRRPSMERLKYILWSLGLFLLIGIGIGWVMYPFSR* |
| Ga0066682_100524773 | 3300005450 | Soil | AFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0070699_1020921251 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLFALLISIAFGFLSRRGTTERVKYILWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0070731_104190311 | 3300005538 | Surface Soil | FGFLSRRPLRERAKYIGWSFLLFVLIGIGIGWMMYPFSR* |
| Ga0070732_107012952 | 3300005542 | Surface Soil | ALAISAAFGVLSRRRPLDRLKYMLWSLFLFLLVGIGIGWAMYPFSR* |
| Ga0066707_106919761 | 3300005556 | Soil | GTLGRRRPADRIRYAAWSFLLFMLVAIVIGWAMYPFSK* |
| Ga0066670_100934171 | 3300005560 | Soil | VLFALVISVAFGFLGRRRPMERLKYILWTLLLFLLIGVGIGWAMYPFSH* |
| Ga0066702_102084862 | 3300005575 | Soil | MVLFALVISVAFGFLSRRRPLDRVKYILWSLLLFLFIGIGIGWAMYPFSR* |
| Ga0066691_104187523 | 3300005586 | Soil | FGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0066654_106280882 | 3300005587 | Soil | LGRRRPIDRVKYILWTLLLFLLIGVGIGCAMYPFSH* |
| Ga0066903_1034503941 | 3300005764 | Tropical Forest Soil | GFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR* |
| Ga0075024_1002254721 | 3300006047 | Watersheds | IISVAFGFLGRRRPLDRVRYIAWSLFLFLLVGVAIGWAMYPFTR* |
| Ga0075028_1002596292 | 3300006050 | Watersheds | LISIAFGFLSRRNPIERVKYIAWSLFLFLLIGVGIAWAMYPFSR* |
| Ga0075029_1004836291 | 3300006052 | Watersheds | MVLFALLISLAFGFLSRRRTNERVKYILWSLILFLLIGVGIGWAMYPFS |
| Ga0075019_103181711 | 3300006086 | Watersheds | AFGFLSRRRPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0075015_1002218221 | 3300006102 | Watersheds | MGFQLSHFQAMALFALIISVAFGFLSRRRPIDRVKYIVWSVFFFIVVGVAIGWAMYPFTR |
| Ga0070765_1012746322 | 3300006176 | Soil | MVLFALMVSIAFGFLSRRPMRERAKYIGWSFLLFVVIGIGIGWMMYPFSR* |
| Ga0066653_101791653 | 3300006791 | Soil | LLISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0079221_105436901 | 3300006804 | Agricultural Soil | LFALLISVAFGFLSRRRTSERVKYILWSFFLFLLIGVGIGWAMYPFSK* |
| Ga0079219_104063311 | 3300006954 | Agricultural Soil | LVISVAFGFLGRRQPKERIKYILWTLLLFLLVGVGIGWAMYPFSR* |
| Ga0099794_100502584 | 3300007265 | Vadose Zone Soil | AFGFLSRRQPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0099795_106218472 | 3300007788 | Vadose Zone Soil | MLLFALLISIAFGFLSRRRPLERVKYIAWSLLLFLLFGIGIGWAMYPFSH* |
| Ga0099829_106863151 | 3300009038 | Vadose Zone Soil | VSIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0099830_100846691 | 3300009088 | Vadose Zone Soil | IAFGFLSRRRPVDRVKYIVWSLFLFLLIGVGIGWAMYPFSH* |
| Ga0099830_101284132 | 3300009088 | Vadose Zone Soil | MVLFAMIISVAFGFLSRRRPIDRVKYIVWSLFLFLLVSVAIGWAMYPFTR* |
| Ga0099830_101370733 | 3300009088 | Vadose Zone Soil | LFALMISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWGMYPFSR* |
| Ga0099830_104948172 | 3300009088 | Vadose Zone Soil | SRRRPIDRVKYIVWSLFLFLLVGVGIGWAMYPFSR* |
| Ga0099828_101357756 | 3300009089 | Vadose Zone Soil | FGFLARRRPVDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0099828_107133663 | 3300009089 | Vadose Zone Soil | ISIAFGFLSRRKPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0099827_102094581 | 3300009090 | Vadose Zone Soil | LLFALVISVAFGFLSRRRPVDRVKYIVWSLFLFLLVGVGIGWAMYPFSR* |
| Ga0099827_105212222 | 3300009090 | Vadose Zone Soil | AFGFLSKRKLPDRVKYAVWAFFMFILIGVAIGWAMYPFSR* |
| Ga0066709_1038208323 | 3300009137 | Grasslands Soil | AVVISVAFGFLSRRPSMERLKYILWSLGLFLLIGIGIGWVMYPFSR* |
| Ga0099792_106014853 | 3300009143 | Vadose Zone Soil | FGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSR* |
| Ga0099792_112394742 | 3300009143 | Vadose Zone Soil | MLLFALLISIAFGFLSRRRPLERVKYIAWSLLLFLLFGIGIGWAMYPFSR* |
| Ga0116137_10262744 | 3300009549 | Peatland | FLGRRRPKDRIKYILWSFFLFLAVGIGIAWAMYPFSR* |
| Ga0116123_11166351 | 3300009617 | Peatland | GRRRPKDRIKYILWSFFLFLAVGIGIAWAMYPFSR* |
| Ga0116120_11526071 | 3300009641 | Peatland | VAFGFLGRRRPKDRIKYILWSFFLFLAVGIGIAWAMYPFSR* |
| Ga0116215_11276263 | 3300009672 | Peatlands Soil | FLGRRRPKDRIKYILWSLFLFLAVGIGIAWAMYPFSR* |
| Ga0126373_110774542 | 3300010048 | Tropical Forest Soil | AVISVAFGFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR* |
| Ga0134109_100332864 | 3300010320 | Grasslands Soil | GRRRPIDRVKYILWTLLLFLLIGVGIGWAMYPFSH* |
| Ga0134063_104278441 | 3300010335 | Grasslands Soil | LSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0074045_103976272 | 3300010341 | Bog Forest Soil | GFLSRRRTNERVKYIIWSLLLFLLIGVGIGWAMYPFSR* |
| Ga0126370_104466742 | 3300010358 | Tropical Forest Soil | AFGFLGRRRPVDRVKYILWTLLLFLLVGVGIGWAMYPFSH* |
| Ga0126370_117905951 | 3300010358 | Tropical Forest Soil | VNLHLNHFQSMLLFALLISLAFGFLSRRRPLDRLKYVLWSLLLFLLIGIGIGWAMYPLSR |
| Ga0126376_130282792 | 3300010359 | Tropical Forest Soil | MIFKLSHFQAMILFALMVSIAFGFLSRRPMRERAKYIGWSFLLFVLIGVGIGWMMYPVSR |
| Ga0126378_109495561 | 3300010361 | Tropical Forest Soil | IAFGFLGRRRPKDRVKYIVWSLLLFLLVGIGIGWAMFPFSR* |
| Ga0126378_110542831 | 3300010361 | Tropical Forest Soil | FGFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR* |
| Ga0134125_103292611 | 3300010371 | Terrestrial Soil | GFLSRRPMRERAKYIGWSFLLFVLIGVGIGWMMYPFSR* |
| Ga0126381_1000746365 | 3300010376 | Tropical Forest Soil | FQALVVFALVISIAFGFLGRRRPIDRVKYILWTLLLFVLIGIGIGWAMYPFSR* |
| Ga0126381_1003753634 | 3300010376 | Tropical Forest Soil | GFLGRRHPKERVKYILWTLLLFLLVGVGIGWAMYPFSR* |
| Ga0126381_1005001302 | 3300010376 | Tropical Forest Soil | MILFAAVISVAFGFLSRRRPVDRLKNMLWSLLLFLLVGIGIAWFMYPFSR* |
| Ga0126381_1017800042 | 3300010376 | Tropical Forest Soil | VAFGFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR* |
| Ga0126344_10967181 | 3300010866 | Boreal Forest Soil | RRPMRERAKYIGWSFLLFVLVGIGIGWMMYPFSR* |
| Ga0150983_124848871 | 3300011120 | Forest Soil | LLFALAVSIAFGFLSRRPALERLKYIGWSLLMFLLIGIGIGWVMYPFSR* |
| Ga0137392_104833813 | 3300011269 | Vadose Zone Soil | LLFALLISIAFGFLSRRRPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137392_113989862 | 3300011269 | Vadose Zone Soil | FALLISIAFGFLSRRRPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137389_104941213 | 3300012096 | Vadose Zone Soil | SIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSR* |
| Ga0137388_102448403 | 3300012189 | Vadose Zone Soil | GFLSRRQPVERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137388_108069552 | 3300012189 | Vadose Zone Soil | AFGFLSRRQPVERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137388_109106052 | 3300012189 | Vadose Zone Soil | LFAVLISIAFGFLSRRRPMDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137364_107865562 | 3300012198 | Vadose Zone Soil | LLFALLISIAFGFLSRRQPIERVKYIVWSLLLFLLIGVGIGWAMYPFSR* |
| Ga0137363_100960574 | 3300012202 | Vadose Zone Soil | SIAFGFLSRRRPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137363_102457551 | 3300012202 | Vadose Zone Soil | FGFLSRRRPIDRVKYIVWSLFMFLLVGVAIGWAMYPFTR* |
| Ga0137363_117247252 | 3300012202 | Vadose Zone Soil | RRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSH* |
| Ga0137399_108957343 | 3300012203 | Vadose Zone Soil | SIAFGFLSRRKPVERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137362_105116984 | 3300012205 | Vadose Zone Soil | FALMISIAFGFLSRRRPLERVKYIVWSLFLFLLFGIGIGWAMYPFSR* |
| Ga0137380_104627622 | 3300012206 | Vadose Zone Soil | SRWQPVARLKYIAWSLLLFLLIGIAVGWAMYPFSR* |
| Ga0137379_116321562 | 3300012209 | Vadose Zone Soil | IAFGFLGRHRPMDRVKYILWTLLLFLLIGVGIGWAMYPFSR* |
| Ga0137378_101147621 | 3300012210 | Vadose Zone Soil | ALLISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137360_101301293 | 3300012361 | Vadose Zone Soil | MVLFALIISVAFGFLSRRRPIDRVKYIVWSLFMILLVGVAIGWAMYPFTR* |
| Ga0137360_109799442 | 3300012361 | Vadose Zone Soil | MTLHFSHFQSMLLFALAISVAFGFLSRRPALERLKYVGWSLLMFLLIGVGIGWVMYPFSR |
| Ga0137361_109498871 | 3300012362 | Vadose Zone Soil | RRKPVDRVKYIVWSLFLFLLVGVSIGWEMYPFSR* |
| Ga0134041_11210721 | 3300012405 | Grasslands Soil | ISIAFGFLSRRQPIERAKYIVWSLLLFLLIGVGIGWAMYPFSR* |
| Ga0137358_100294443 | 3300012582 | Vadose Zone Soil | MFLFALGISIAFGFLSRRPPLERLKYVGWSLLLFLLIGIGIGWVMYPFSR* |
| Ga0137358_100753291 | 3300012582 | Vadose Zone Soil | RRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137358_105083873 | 3300012582 | Vadose Zone Soil | GFLSRRQPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137358_105343863 | 3300012582 | Vadose Zone Soil | IISVAFGFLSRRRPIDRVKYIVWSLFMFLLVGVAIGWAMYPFTR* |
| Ga0137395_100069201 | 3300012917 | Vadose Zone Soil | VLISIAFGFLSRRRPIDRLKYIVGSLFLFLLSGVGIGWAMYPFSR* |
| Ga0137395_100419641 | 3300012917 | Vadose Zone Soil | MLLFALLISIAFGFLSRRRPLERVKYIAWSLLLFLLFGIGIGWAMYPFS |
| Ga0137394_107632601 | 3300012922 | Vadose Zone Soil | FGFLSRRKPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0137359_103294193 | 3300012923 | Vadose Zone Soil | ALVISVAFGFLSRRRPLDRVKYIAWSLLLFLLIGIGIGWAMYPFSR* |
| Ga0137416_104640241 | 3300012927 | Vadose Zone Soil | LFALAISMAFGFLSRRKPVDRVKYILWSLFLFLLVGVGIG* |
| Ga0137404_101691812 | 3300012929 | Vadose Zone Soil | RRRPADRIRYAAWSFLLFMLVGIAIGWAMYPFSK* |
| Ga0164302_117990791 | 3300012961 | Soil | ISIAFGFLSRRQPLERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0181539_10088941 | 3300014151 | Bog | AAVISIAFGFLGRRRPKDRIKYILWSFFLFLVVGVGIAWAMYPFSR* |
| Ga0181539_12922823 | 3300014151 | Bog | FLGRRRPKDRIKYILWSFFLFLVVGIGIAWAMYPFSR* |
| Ga0134075_102824043 | 3300014154 | Grasslands Soil | ALAISIAFGFLSRRKPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR* |
| Ga0182036_107051181 | 3300016270 | Soil | GFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR |
| Ga0182032_106915382 | 3300016357 | Soil | AVISVAFGFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR |
| Ga0182040_105849902 | 3300016387 | Soil | FLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR |
| Ga0187802_102238832 | 3300017822 | Freshwater Sediment | GFLGRRQPKDRIKYILWSFFLFLLVGIGIGWAMYPFSH |
| Ga0187849_11030921 | 3300017929 | Peatland | AFGFLGRRRPKDRIKYILWSFFLFLAVGIGIAWAMYPFSR |
| Ga0187825_104207501 | 3300017930 | Freshwater Sediment | MTLFALLISIAFGFLSRRRMSERVKYILWSLFLFLLIGVGIGWAMYPFSK |
| Ga0187803_100778993 | 3300017934 | Freshwater Sediment | SVAFGFLGRRQPKDRIKYILWSFFLFLLVGIGIGWAMYPFSH |
| Ga0187819_100272783 | 3300017943 | Freshwater Sediment | SVAFGFLGRRQPKDRVKYILWSFFLFLLVGVGIGWAMYPFSR |
| Ga0187819_102086223 | 3300017943 | Freshwater Sediment | IISIAFGFLSRRQPIDRVKYILWSLFLFLLVGVGIGWAMYPFSR |
| Ga0187817_105785052 | 3300017955 | Freshwater Sediment | GFLSRRQPIDRVKYILWSLFLFLLVGVGIGWAMYPFSR |
| Ga0187778_111966182 | 3300017961 | Tropical Peatland | ISIAFGFLSRRKPIDRVKYILWSLFLFLLVGVGIGWAMYPFSR |
| Ga0187863_105125473 | 3300018034 | Peatland | IISVAFGFLGRRRPKDRIKYILWSFFLFLAVGIGIAWAMYPFSR |
| Ga0066655_101126743 | 3300018431 | Grasslands Soil | IFAVVISVAFGFLGRRQPKERLKYILWTLFLFLLIGVGIGWAMYPFSH |
| Ga0066662_123239671 | 3300018468 | Grasslands Soil | ISIAFGFLSKRKLPDRVKYAVWAFFMFILIGVAIGWAMYPFSR |
| Ga0066662_129928121 | 3300018468 | Grasslands Soil | AFGFLSRRRPLDRIKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0193729_11590852 | 3300019887 | Soil | GFLSRRGTYKRAKYILWSFVLFLLIGVGIGWAMYPFSH |
| Ga0179592_101298461 | 3300020199 | Vadose Zone Soil | LGRRRPKDRFKYILWSLFLFLLVGIGVGWAMFPFSR |
| Ga0210407_100377921 | 3300020579 | Soil | ISVAFGFLGRRRPKDRFKYILWSLFLFLLVGIGIGWAMFPFSR |
| Ga0210403_1000524613 | 3300020580 | Soil | MVLFALLISIVFGFLSRRRTSERIKYILWSLILFLLIGVGIGWAMYPFSR |
| Ga0210403_100762534 | 3300020580 | Soil | MLLFALLVSIAFGFLSRRRPLDRAKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0210399_100294996 | 3300020581 | Soil | MVLFALLISIAFGFLSRRRTSERVKYILWSLILFLLIGVGIGWAMYPFSQ |
| Ga0210399_100828891 | 3300020581 | Soil | LISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR |
| Ga0210399_104252143 | 3300020581 | Soil | MLLFALMISIAFGFLSRRRPLERVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0210404_102763042 | 3300021088 | Soil | IAFGFLSRRRPIERVKYIVWSLFLFLLIGVGIGWAMYPFSR |
| Ga0210404_106320442 | 3300021088 | Soil | MLLFALMISIAFGFLSRRRPLERVKYIVWSLLLFLLFGIGIGWAMYPFSR |
| Ga0210400_100858957 | 3300021170 | Soil | FLLFAVVISVAFGFLGRRRPKDRAKYILWSLFLFLLVGIGIGWAMFPFSR |
| Ga0210408_1000032351 | 3300021178 | Soil | MLLFALMISIAFGFLSRRRPMDRVKYMVWSLLLFLLFGIGIGWAMYPFSR |
| Ga0210388_116201631 | 3300021181 | Soil | ALMVSIAFGFLSRRPLRERARYVGWSFLLFVLIGIGIGWMMYPFSR |
| Ga0210387_114695501 | 3300021405 | Soil | GYLGRRQPKDRLKYILWSFFLFLVVGIGIGWAMYPFSR |
| Ga0210392_100372081 | 3300021475 | Soil | VSFGFLSRRRPSDRIKYILWSLFLFLFIGIGIGWAMYPFSR |
| Ga0187846_101016332 | 3300021476 | Biofilm | MIVFALIISVAFGFLSRRRPKDRLKYILWSLLLFLLFGVGIGWAMYPFSH |
| Ga0210398_103299843 | 3300021477 | Soil | FALMVSIAFGFLSRRPLRERARYVGWSFLLFVLIGIGIGWMMYPFSR |
| Ga0210410_100951546 | 3300021479 | Soil | AFGFLSRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0210410_102484314 | 3300021479 | Soil | LFAVVISIAFGFLGRRRPKDRLKYILWSLFLFLLVGIGIGWAMFPFSR |
| Ga0126371_112954311 | 3300021560 | Tropical Forest Soil | AFGFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR |
| Ga0212123_100268586 | 3300022557 | Iron-Sulfur Acid Spring | LSRRRPLERVKYIVWSLLLFLLFGIGIGWAMYPFSR |
| Ga0137417_12106911 | 3300024330 | Vadose Zone Soil | LPEPAPADRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSH |
| Ga0208687_10901441 | 3300025469 | Peatland | AFLLFAAVISIAFGFLGRRRPKDRIKYILWSFFLFLVVGIGIAWAMYPFSR |
| Ga0208715_10775122 | 3300025482 | Arctic Peat Soil | MFIFALLISISFGFLSRRRPLDRVKYILWSLFLFLAIGIGIGWVMYPF |
| Ga0207707_102451813 | 3300025912 | Corn Rhizosphere | SRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0207660_101102504 | 3300025917 | Corn Rhizosphere | FLSRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0209863_100149993 | 3300026281 | Prmafrost Soil | MTLHFSHFQSMLLFALAISVAFGFLSRRPALERLKYIGWSVLMFLLIGVGIGWVMYPFSR |
| Ga0209240_10000516 | 3300026304 | Grasslands Soil | MLLFALLISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSH |
| Ga0209154_10501884 | 3300026317 | Soil | IAFGFLSRRQPIERVKYIVWSLLLFLLIGVGIGWAMYPFSR |
| Ga0209375_10614143 | 3300026329 | Soil | IAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR |
| Ga0209473_12749242 | 3300026330 | Soil | LVISVAFGFLGRRRPMERLKYILWTLLLFLLIGVGIGWAMYPFSH |
| Ga0257163_10440802 | 3300026359 | Soil | MLLFALLISIAFGFLSRRGPLERVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0257181_10767762 | 3300026499 | Soil | MVLFAMIISVAFGFLSRRRPIDRVKYIVWSLFLFLLVSVAIGWAMYPFTR |
| Ga0209059_10632241 | 3300026527 | Soil | TIFAVVISIAFGFLGRRRPVDRLKYILWTLFLFLLVGVGIGWAMYPFSH |
| Ga0209376_13851391 | 3300026540 | Soil | VIFALVISVAFGFLGRRQPKERVKYILWTLLLFLLVGVGIGWAMYPFSR |
| Ga0209648_100255361 | 3300026551 | Grasslands Soil | ISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSY |
| Ga0209648_105487292 | 3300026551 | Grasslands Soil | ALLISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSH |
| Ga0208603_10375341 | 3300027109 | Forest Soil | FGFLGRRRPKDRMKYILWSFFLFLLVGIGVGWAMFPFSR |
| Ga0209327_10498521 | 3300027307 | Forest Soil | FGFLSRRPMRERAKYIGWSFLLFVLIGVGIGWMMYPFSR |
| Ga0209733_11556992 | 3300027591 | Forest Soil | MVIFALVISVAFGFLSRRSAYRRARYILWSFILFLLIGVGIGWAMYPFSH |
| Ga0209329_10718102 | 3300027605 | Forest Soil | MFLFALGISIAFGFLSRRPPLERLKYVGWSLLLFLLIGIGIGWVMYPFSR |
| Ga0209625_10552591 | 3300027635 | Forest Soil | MLLFALMISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0209388_11399642 | 3300027655 | Vadose Zone Soil | FGFLSRRQPIERIKYIVWSLFLFLLIGVGIGWAMYPFSR |
| Ga0208565_10656001 | 3300027662 | Peatlands Soil | FLGRRRPKDRIKYILWSLFLFLAVGIGIAWAMYPFSR |
| Ga0208990_11134691 | 3300027663 | Forest Soil | FLSRRRPIERVKYIVWSLFLFLLIGVGIGWTMYPFSH |
| Ga0209588_10482002 | 3300027671 | Vadose Zone Soil | MLLFALLISIAFGFLSRRRPMERVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0209118_10000974 | 3300027674 | Forest Soil | MVLFGLIISVAFGFLSRRRPIDRVKYIVWSLFLFLLVGVAIGWAMYPLTR |
| Ga0209011_11463692 | 3300027678 | Forest Soil | ISTAFGFLSRKRPVERLQYILWSLFLFLLIGIGIGWAMYPFSR |
| Ga0209178_13334991 | 3300027725 | Agricultural Soil | LFALLISVAFGFLSRRRTSERVKYILWSFFLFLLIGVGIGWAMYPFSK |
| Ga0209580_101996403 | 3300027842 | Surface Soil | FGFLSRRRPLDRVKYMLWSLFLFLLVGIGIGWAMYPFSR |
| Ga0209180_100180215 | 3300027846 | Vadose Zone Soil | VLFALIISVAFGFLSRRRPIDRVKYIVWSLFMFLLVGVAIGWAMYPFTR |
| Ga0209180_100505773 | 3300027846 | Vadose Zone Soil | MLFFALVISVAFGFLSRRRPLDRVKYMLWSLFLFLLVGIGIGWAMYPFSR |
| Ga0209180_101975611 | 3300027846 | Vadose Zone Soil | FAVLISVAFGFLSRRRLIDRVKYMVWSLFLFLLIGVGIGWAMYPFSR |
| Ga0209180_102950002 | 3300027846 | Vadose Zone Soil | MLLFALMISIAFGFLSRRRPLDRVKYIAWSLLLFLLFGIGIGWGMYPFSR |
| Ga0209180_106200073 | 3300027846 | Vadose Zone Soil | ISIAFGFLSRRRPIDRVKYIVWSLFLFLLIGVGIGWAMYPFSR |
| Ga0209283_100721781 | 3300027875 | Vadose Zone Soil | AFGFLSRRRTADRVKYILWSLFLFLLIGVGIGWAMYPFSR |
| Ga0209283_100726071 | 3300027875 | Vadose Zone Soil | FGFLARRRPVDRVKYIVWSLFLFLLIGVGIGWAMYPFSR |
| Ga0209590_100836651 | 3300027882 | Vadose Zone Soil | FLSRRRQIDRVKYIVWSLFLFLLIGVGIGWAMYPFSY |
| Ga0209488_101223564 | 3300027903 | Vadose Zone Soil | MLLFALVISGAFGFLSRRRPLDRVKYILWSLFLFLLVGIGIGWAMYPFSR |
| Ga0265354_10163921 | 3300028016 | Rhizosphere | MTLFALLISIAFGFLSRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0265349_10013644 | 3300028037 | Soil | SIAFGFLSRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0137415_109399151 | 3300028536 | Vadose Zone Soil | MVLFALIISVAFGFLSRRRPIDRVKYIAWSLFLFLLVGVTIGWAMYPFTR |
| Ga0137415_113979332 | 3300028536 | Vadose Zone Soil | MLLFALMISMAFGFLSRRRPLDRVKYIAWSLLPFLLFGIGIGWAMYPFSR |
| Ga0308309_109663552 | 3300028906 | Soil | MVLFALMVSIAFGFLSRRPMRERAKYIGWSFLLFVVIGIGIGWMMYPFSR |
| Ga0302178_104623061 | 3300030013 | Palsa | TLFAAAISVAFGFLSRRPTLDRLKYIAWSFLLFLVIAVVLGWAMYPLSR |
| Ga0265750_10072603 | 3300030813 | Soil | FGFLSRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0075405_114326071 | 3300030847 | Soil | FFAAVISVAFGYLGRRQPKDRLKYILWSFFLFLVVGIGIGWAMYPFSR |
| Ga0073994_100399323 | 3300030991 | Soil | MLLFALLISVAFGFLSRRGPLDRVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0170834_1038663752 | 3300031057 | Forest Soil | MFLFALGISIAFGFLSRRPALERLKYVGWSLLLFLLIGIGIGWPSAP |
| Ga0170834_1092275031 | 3300031057 | Forest Soil | AVSIAFGFLSRRPMRERMKYIGWSFFLFLLIGIGIGWAMYPFSR |
| Ga0265760_100175584 | 3300031090 | Soil | IAFGFLSRRRTSDRVKYIIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0170823_133727282 | 3300031128 | Forest Soil | MFLFALGISIAFGFLSRRPALERSKYVGWSLLLFLLIGIGIGWPSAP |
| Ga0170824_1144685421 | 3300031231 | Forest Soil | AFGYLGRRQPKDRLKYILWSFFLFVVVGIGIGWAMYPFSR |
| Ga0170820_103490663 | 3300031446 | Forest Soil | SVAFGFLSRRPMRDRAKYIGWSFLLFVLIGVGIGWMMYPFSR |
| Ga0170818_1069147011 | 3300031474 | Forest Soil | ILFALMVSVAFGFLSRRPMRDRAKYIGWSFLLFVLIGVGIGWMMYPFSR |
| Ga0318542_102635312 | 3300031668 | Soil | FLGRRQPQERVKYILWSFLLFLLVGIGIGWVMYPFSR |
| Ga0307474_102612602 | 3300031718 | Hardwood Forest Soil | AFGFLSRRRTSERVKYILWSLILFLLIGVGIGWAMYPFSR |
| Ga0307474_103079952 | 3300031718 | Hardwood Forest Soil | MLLFALMISIAFGFLSRRRPMDRVKYIIWSLLLFVLFGIGIGWAMYPFSR |
| Ga0307469_112902351 | 3300031720 | Hardwood Forest Soil | ISIAFGFLSRRRTRERVTYIIWSLILFLLIGVGIGWAMFPFSR |
| Ga0306918_112217451 | 3300031744 | Soil | GFLGRRQPKDRIKYILWCFLLFLVVGIGIAWAMYPFSK |
| Ga0307477_1000059613 | 3300031753 | Hardwood Forest Soil | MLFALIISVAFGFLSRRRPIDRVKYIVWSLFLFLLVGVTIGWAMYPFTR |
| Ga0307477_103994692 | 3300031753 | Hardwood Forest Soil | MMLRLDHFQAMFLFALGISIAFGFLSRRPALDRLKYIGWSLLLFLLIGIGIGWVMYPFSR |
| Ga0307475_100555573 | 3300031754 | Hardwood Forest Soil | MMLFALIISVAFGFLSRRRPIDRVKYIVWSLFLFLLVGVTIGWAMYPFTR |
| Ga0307475_101769231 | 3300031754 | Hardwood Forest Soil | MALFALVISVAFGFLSRRRPIDRVKYIVWSLFLFLLVGVTIGWAMYPFTR |
| Ga0318547_101904211 | 3300031781 | Soil | FGFLGRRRPKDRVKYILWTLLLFVLIGVGIGWAMYPFSH |
| Ga0307473_100974993 | 3300031820 | Hardwood Forest Soil | MLLFALLISIAFGFLSRRRPLERVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0307478_104709212 | 3300031823 | Hardwood Forest Soil | MLLFALMISIAFGFLSRRRPMDRVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0307478_112222682 | 3300031823 | Hardwood Forest Soil | FLSKRRPADRVKYIVWALFLFLLVGVGIGWAMYPFSR |
| Ga0310917_111656851 | 3300031833 | Soil | LGRRQPRDRVKYILWSFLLFLVVGIGIAWAMYPFSK |
| Ga0318544_103645501 | 3300031880 | Soil | LVVFALVISIAFGFLGRRRPKDRVKYILWTLLLFVLIGVGIGWAMYPFSH |
| Ga0306921_112795631 | 3300031912 | Soil | AAVISVAFGFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR |
| Ga0310912_104702311 | 3300031941 | Soil | VAFGFLGRRQPKDRIKYILWSFLLFLVVGIGIAWAMYPFSR |
| Ga0310912_109379821 | 3300031941 | Soil | GFLGRRQPKDRVRYILWSFLLFLIVGIGIAWAMYPFSR |
| Ga0306926_100425701 | 3300031954 | Soil | GFLGRRQPKDRVKYILWSFLLFLVVGIGIAWAMYPFSK |
| Ga0307479_101194843 | 3300031962 | Hardwood Forest Soil | MFLFALGISIAFGFLSRRPPLERLKYVGWSLLLFLLIGIVIGWVMYPFSR |
| Ga0307479_108300531 | 3300031962 | Hardwood Forest Soil | MLLFALLISVAFGFLSRRRPMERVKYIAWSLLLFLLFGIGIGWAMYPFSR |
| Ga0307479_110384471 | 3300031962 | Hardwood Forest Soil | ALLISIAFGFLSRRQPMERVKYIVWSLFLFLLIGVGIGWAMYPFSH |
| Ga0307479_112210592 | 3300031962 | Hardwood Forest Soil | MALFALIISVAFGFLSRRRPIDRVKYIVWSLFLFLLVGVTIGWAMYPFTR |
| Ga0307479_117586481 | 3300031962 | Hardwood Forest Soil | IAFGFLSRRQPMERVKYIVWSLFLFLLIGVGIGWAMYPFSH |
| Ga0318577_105403582 | 3300032091 | Soil | SIAFGFLGRRRPKDRVKYIVWSLLLFLLVGIGIGWAMFPFSR |
| Ga0307471_1002454603 | 3300032180 | Hardwood Forest Soil | MLLFALAISIAFGFLSRRRPLDRLKYILWSLLLFLLIGIGIGWAMYPFSR |
| Ga0335079_120292141 | 3300032783 | Soil | GFLSRRRPSDRVKYMIWSLFLFLLIGVGIGWAMYPFSR |
| Ga0335081_102687831 | 3300032892 | Soil | AVISVAFGFLGRRQPKDRVKYILWSFFLFLLVGVGIGWAMYPFSR |
| Ga0335083_103744941 | 3300032954 | Soil | SIAFGFLSRRPMRDRARYIAWSFLLFVLIGIGLGWVMYPFSR |
| Ga0335083_105627162 | 3300032954 | Soil | MLIFAAIVSVAFGFLGRRRPKDRVRYILWSFFLFLAVGIGIGWLMLPFSR |
| Ga0334854_044052_2_133 | 3300033829 | Soil | ISVAFGFLSRRRPIERIKYILWSLFLFLAIGIGIGWAMYPFSR |
| ⦗Top⦘ |