| Basic Information | |
|---|---|
| Family ID | F020616 |
| Family Type | Metagenome |
| Number of Sequences | 223 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 223 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.95 % |
| % of genes near scaffold ends (potentially truncated) | 82.06 % |
| % of genes from short scaffolds (< 2000 bps) | 83.86 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.686 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.314 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.601 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.601 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 223 Family Scaffolds |
|---|---|---|
| PF13495 | Phage_int_SAM_4 | 3.14 |
| PF00589 | Phage_integrase | 2.24 |
| PF13620 | CarboxypepD_reg | 1.79 |
| PF07638 | Sigma70_ECF | 1.79 |
| PF00069 | Pkinase | 1.79 |
| PF13360 | PQQ_2 | 1.35 |
| PF07676 | PD40 | 1.35 |
| PF00753 | Lactamase_B | 1.35 |
| PF13676 | TIR_2 | 0.90 |
| PF07714 | PK_Tyr_Ser-Thr | 0.90 |
| PF01266 | DAO | 0.90 |
| PF01553 | Acyltransferase | 0.90 |
| PF04972 | BON | 0.90 |
| PF13450 | NAD_binding_8 | 0.90 |
| PF00392 | GntR | 0.90 |
| PF08281 | Sigma70_r4_2 | 0.90 |
| PF00989 | PAS | 0.90 |
| PF13649 | Methyltransf_25 | 0.45 |
| PF09286 | Pro-kuma_activ | 0.45 |
| PF13751 | DDE_Tnp_1_6 | 0.45 |
| PF13271 | DUF4062 | 0.45 |
| PF00498 | FHA | 0.45 |
| PF01695 | IstB_IS21 | 0.45 |
| PF16640 | Big_3_5 | 0.45 |
| PF01895 | PhoU | 0.45 |
| PF05090 | VKG_Carbox | 0.45 |
| PF01807 | zf-CHC2 | 0.45 |
| PF12833 | HTH_18 | 0.45 |
| PF12804 | NTP_transf_3 | 0.45 |
| PF02687 | FtsX | 0.45 |
| PF12704 | MacB_PCD | 0.45 |
| PF07883 | Cupin_2 | 0.45 |
| PF07690 | MFS_1 | 0.45 |
| PF04116 | FA_hydroxylase | 0.45 |
| PF13231 | PMT_2 | 0.45 |
| PF03682 | UPF0158 | 0.45 |
| PF16483 | Glyco_hydro_64 | 0.45 |
| PF11994 | DUF3489 | 0.45 |
| PF13618 | Gluconate_2-dh3 | 0.45 |
| PF02838 | Glyco_hydro_20b | 0.45 |
| PF09587 | PGA_cap | 0.45 |
| PF14319 | Zn_Tnp_IS91 | 0.45 |
| PF02985 | HEAT | 0.45 |
| PF06210 | DUF1003 | 0.45 |
| PF13519 | VWA_2 | 0.45 |
| PF00850 | Hist_deacetyl | 0.45 |
| PF05598 | DUF772 | 0.45 |
| PF00440 | TetR_N | 0.45 |
| PF01546 | Peptidase_M20 | 0.45 |
| PF16576 | HlyD_D23 | 0.45 |
| PF01522 | Polysacc_deac_1 | 0.45 |
| PF11138 | DUF2911 | 0.45 |
| PF00027 | cNMP_binding | 0.45 |
| PF03601 | Cons_hypoth698 | 0.45 |
| PF13478 | XdhC_C | 0.45 |
| PF00535 | Glycos_transf_2 | 0.45 |
| PF05738 | Cna_B | 0.45 |
| PF13247 | Fer4_11 | 0.45 |
| PF00665 | rve | 0.45 |
| PF02371 | Transposase_20 | 0.45 |
| PF02954 | HTH_8 | 0.45 |
| PF09335 | SNARE_assoc | 0.45 |
| PF05163 | DinB | 0.45 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.45 |
| PF00144 | Beta-lactamase | 0.45 |
| PF03098 | An_peroxidase | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 223 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 10.76 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.79 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.90 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.45 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.45 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.45 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.45 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.45 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.45 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.45 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.45 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.45 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.45 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.45 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.69 % |
| Unclassified | root | N/A | 10.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02IK6GR | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 515 | Open in IMG/M |
| 2189573000|GPBTN7E02FY59W | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 519 | Open in IMG/M |
| 3300000567|JGI12270J11330_10038075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2721 | Open in IMG/M |
| 3300000567|JGI12270J11330_10273165 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300000574|JGI1357J11328_10196151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 547 | Open in IMG/M |
| 3300000955|JGI1027J12803_109589061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 700 | Open in IMG/M |
| 3300004092|Ga0062389_104859357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 506 | Open in IMG/M |
| 3300005340|Ga0070689_101389401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 634 | Open in IMG/M |
| 3300005356|Ga0070674_100632451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 908 | Open in IMG/M |
| 3300005366|Ga0070659_101043168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 719 | Open in IMG/M |
| 3300005434|Ga0070709_10383631 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005471|Ga0070698_100672927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 976 | Open in IMG/M |
| 3300005533|Ga0070734_10046207 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300005533|Ga0070734_10087669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1836 | Open in IMG/M |
| 3300005533|Ga0070734_10206990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1130 | Open in IMG/M |
| 3300005534|Ga0070735_10044209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2992 | Open in IMG/M |
| 3300005563|Ga0068855_100661759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1121 | Open in IMG/M |
| 3300005564|Ga0070664_100383308 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300005564|Ga0070664_100654544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 976 | Open in IMG/M |
| 3300005591|Ga0070761_10208220 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300005591|Ga0070761_10690392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 639 | Open in IMG/M |
| 3300005591|Ga0070761_10716324 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005617|Ga0068859_100163221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2307 | Open in IMG/M |
| 3300005841|Ga0068863_100563765 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005921|Ga0070766_10867455 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005921|Ga0070766_11015019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300005993|Ga0080027_10479395 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006050|Ga0075028_100279317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 925 | Open in IMG/M |
| 3300006052|Ga0075029_100868624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 617 | Open in IMG/M |
| 3300006059|Ga0075017_100347319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300006102|Ga0075015_100501914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 699 | Open in IMG/M |
| 3300006102|Ga0075015_100986487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300006163|Ga0070715_10380642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300006174|Ga0075014_100075456 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300006237|Ga0097621_100005837 | All Organisms → cellular organisms → Bacteria | 8696 | Open in IMG/M |
| 3300006237|Ga0097621_101458718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 649 | Open in IMG/M |
| 3300006237|Ga0097621_101753471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 591 | Open in IMG/M |
| 3300006354|Ga0075021_10880457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 581 | Open in IMG/M |
| 3300006354|Ga0075021_11106898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 519 | Open in IMG/M |
| 3300006358|Ga0068871_100012366 | All Organisms → cellular organisms → Bacteria | 6288 | Open in IMG/M |
| 3300006846|Ga0075430_100463874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1045 | Open in IMG/M |
| 3300006847|Ga0075431_100345627 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300009088|Ga0099830_10526915 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300009090|Ga0099827_10716499 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300009098|Ga0105245_11940149 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009098|Ga0105245_11984669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 635 | Open in IMG/M |
| 3300009143|Ga0099792_10505330 | Not Available | 757 | Open in IMG/M |
| 3300009143|Ga0099792_10746435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 637 | Open in IMG/M |
| 3300009174|Ga0105241_10103491 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300009174|Ga0105241_11257193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 703 | Open in IMG/M |
| 3300009174|Ga0105241_12202629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300009176|Ga0105242_10250168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1597 | Open in IMG/M |
| 3300009176|Ga0105242_12116011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 607 | Open in IMG/M |
| 3300009176|Ga0105242_12504713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 564 | Open in IMG/M |
| 3300009177|Ga0105248_10120843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 2955 | Open in IMG/M |
| 3300009177|Ga0105248_10222107 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300009177|Ga0105248_12419412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 598 | Open in IMG/M |
| 3300009177|Ga0105248_12574826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 580 | Open in IMG/M |
| 3300009177|Ga0105248_12859172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 550 | Open in IMG/M |
| 3300009177|Ga0105248_12884486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 548 | Open in IMG/M |
| 3300009521|Ga0116222_1314112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 678 | Open in IMG/M |
| 3300009522|Ga0116218_1134355 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300009522|Ga0116218_1569657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 502 | Open in IMG/M |
| 3300009523|Ga0116221_1041791 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300009525|Ga0116220_10099925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1229 | Open in IMG/M |
| 3300009545|Ga0105237_10128767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2526 | Open in IMG/M |
| 3300009551|Ga0105238_10091507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3029 | Open in IMG/M |
| 3300010358|Ga0126370_12349528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 528 | Open in IMG/M |
| 3300010379|Ga0136449_100350114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2655 | Open in IMG/M |
| 3300010379|Ga0136449_102794468 | Not Available | 689 | Open in IMG/M |
| 3300010398|Ga0126383_12379206 | Not Available | 615 | Open in IMG/M |
| 3300010403|Ga0134123_10484368 | Not Available | 1159 | Open in IMG/M |
| 3300011119|Ga0105246_10692394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300011270|Ga0137391_10640949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300011270|Ga0137391_10735933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 817 | Open in IMG/M |
| 3300011270|Ga0137391_11071806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 653 | Open in IMG/M |
| 3300011270|Ga0137391_11422567 | Not Available | 539 | Open in IMG/M |
| 3300011271|Ga0137393_11579596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 545 | Open in IMG/M |
| 3300011444|Ga0137463_1119331 | Not Available | 992 | Open in IMG/M |
| 3300012096|Ga0137389_11531142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 563 | Open in IMG/M |
| 3300012189|Ga0137388_10230810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1679 | Open in IMG/M |
| 3300012189|Ga0137388_11373779 | Not Available | 645 | Open in IMG/M |
| 3300012189|Ga0137388_11906060 | Not Available | 524 | Open in IMG/M |
| 3300012351|Ga0137386_10470288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 906 | Open in IMG/M |
| 3300012361|Ga0137360_10286490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1364 | Open in IMG/M |
| 3300012362|Ga0137361_10845024 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012363|Ga0137390_10539126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1138 | Open in IMG/M |
| 3300012923|Ga0137359_10178924 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300012923|Ga0137359_10510603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1060 | Open in IMG/M |
| 3300012923|Ga0137359_10984895 | Not Available | 724 | Open in IMG/M |
| 3300012930|Ga0137407_10791737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 895 | Open in IMG/M |
| 3300012930|Ga0137407_10954791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 812 | Open in IMG/M |
| 3300012930|Ga0137407_11416646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300012951|Ga0164300_10063778 | Not Available | 1505 | Open in IMG/M |
| 3300013105|Ga0157369_11634398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 655 | Open in IMG/M |
| 3300013296|Ga0157374_11811544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 636 | Open in IMG/M |
| 3300013296|Ga0157374_12210115 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300013296|Ga0157374_12522148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 542 | Open in IMG/M |
| 3300013297|Ga0157378_10311081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1528 | Open in IMG/M |
| 3300013306|Ga0163162_10010663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8935 | Open in IMG/M |
| 3300013306|Ga0163162_13453981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 503 | Open in IMG/M |
| 3300013308|Ga0157375_10002131 | All Organisms → cellular organisms → Bacteria | 17095 | Open in IMG/M |
| 3300013832|Ga0120132_1011057 | Not Available | 1501 | Open in IMG/M |
| 3300014153|Ga0181527_1203638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina widdelii | 824 | Open in IMG/M |
| 3300014158|Ga0181521_10075527 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300014490|Ga0182010_10018054 | All Organisms → cellular organisms → Bacteria | 3195 | Open in IMG/M |
| 3300014501|Ga0182024_10798029 | Not Available | 1151 | Open in IMG/M |
| 3300014745|Ga0157377_11087157 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300014838|Ga0182030_11500383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 556 | Open in IMG/M |
| 3300014969|Ga0157376_10027905 | All Organisms → cellular organisms → Bacteria | 4481 | Open in IMG/M |
| 3300014969|Ga0157376_11023658 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300014969|Ga0157376_11676242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300016319|Ga0182033_12114465 | Not Available | 513 | Open in IMG/M |
| 3300017821|Ga0187812_1129170 | Not Available | 818 | Open in IMG/M |
| 3300017933|Ga0187801_10120516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1007 | Open in IMG/M |
| 3300017942|Ga0187808_10124585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
| 3300017942|Ga0187808_10414858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 617 | Open in IMG/M |
| 3300017942|Ga0187808_10519608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 553 | Open in IMG/M |
| 3300017955|Ga0187817_10749919 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300017972|Ga0187781_10233960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300017973|Ga0187780_11417366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 512 | Open in IMG/M |
| 3300018001|Ga0187815_10185332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 881 | Open in IMG/M |
| 3300018006|Ga0187804_10033444 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300018007|Ga0187805_10069408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1585 | Open in IMG/M |
| 3300018007|Ga0187805_10529486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 554 | Open in IMG/M |
| 3300018008|Ga0187888_1240333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 707 | Open in IMG/M |
| 3300018012|Ga0187810_10134080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 988 | Open in IMG/M |
| 3300018012|Ga0187810_10321244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 642 | Open in IMG/M |
| 3300018042|Ga0187871_10817912 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018058|Ga0187766_11260593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 537 | Open in IMG/M |
| 3300018062|Ga0187784_10390827 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300018062|Ga0187784_10644404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 850 | Open in IMG/M |
| 3300020579|Ga0210407_10596437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 861 | Open in IMG/M |
| 3300020580|Ga0210403_10958401 | Not Available | 672 | Open in IMG/M |
| 3300020581|Ga0210399_11013338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 668 | Open in IMG/M |
| 3300021168|Ga0210406_10527139 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300021168|Ga0210406_10904934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 663 | Open in IMG/M |
| 3300021180|Ga0210396_11422663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 573 | Open in IMG/M |
| 3300021181|Ga0210388_10761626 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300021401|Ga0210393_10508125 | Not Available | 984 | Open in IMG/M |
| 3300021403|Ga0210397_11605334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 505 | Open in IMG/M |
| 3300021405|Ga0210387_11564666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 562 | Open in IMG/M |
| 3300021420|Ga0210394_10620344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300021433|Ga0210391_10954300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 668 | Open in IMG/M |
| 3300021433|Ga0210391_11159142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 599 | Open in IMG/M |
| 3300021445|Ga0182009_10849964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 501 | Open in IMG/M |
| 3300021474|Ga0210390_11367983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 565 | Open in IMG/M |
| 3300021478|Ga0210402_10358789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1353 | Open in IMG/M |
| 3300021478|Ga0210402_10368219 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300021559|Ga0210409_10101161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2659 | Open in IMG/M |
| 3300023255|Ga0224547_1048805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 550 | Open in IMG/M |
| 3300024290|Ga0247667_1034559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 959 | Open in IMG/M |
| 3300024331|Ga0247668_1051765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300025576|Ga0208820_1015088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 2615 | Open in IMG/M |
| 3300025911|Ga0207654_10134761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1567 | Open in IMG/M |
| 3300025912|Ga0207707_10032724 | All Organisms → cellular organisms → Bacteria | 4551 | Open in IMG/M |
| 3300025912|Ga0207707_11421193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 553 | Open in IMG/M |
| 3300025914|Ga0207671_11022712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 651 | Open in IMG/M |
| 3300025920|Ga0207649_11533026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 527 | Open in IMG/M |
| 3300025924|Ga0207694_10228705 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300025934|Ga0207686_11794042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 508 | Open in IMG/M |
| 3300025937|Ga0207669_10527380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 949 | Open in IMG/M |
| 3300025941|Ga0207711_10146617 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300025942|Ga0207689_10048393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3506 | Open in IMG/M |
| 3300025944|Ga0207661_10196447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300025944|Ga0207661_11321352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300025949|Ga0207667_10139336 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300025949|Ga0207667_10379835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
| 3300025949|Ga0207667_10395375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300025949|Ga0207667_11257537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 718 | Open in IMG/M |
| 3300026023|Ga0207677_10132675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1894 | Open in IMG/M |
| 3300026023|Ga0207677_10162428 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300026035|Ga0207703_11880089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 575 | Open in IMG/M |
| 3300026041|Ga0207639_10269594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
| 3300026078|Ga0207702_11112223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 784 | Open in IMG/M |
| 3300026118|Ga0207675_102312068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300027570|Ga0208043_1092995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300027604|Ga0208324_1111315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 760 | Open in IMG/M |
| 3300027641|Ga0208827_1114521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300027667|Ga0209009_1073636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis panaciterrae | 860 | Open in IMG/M |
| 3300027905|Ga0209415_10355389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300027905|Ga0209415_10834302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 637 | Open in IMG/M |
| 3300027908|Ga0209006_10664503 | Not Available | 856 | Open in IMG/M |
| 3300028379|Ga0268266_11684599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300028381|Ga0268264_10006076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10201 | Open in IMG/M |
| 3300029883|Ga0311327_10884225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 516 | Open in IMG/M |
| 3300029910|Ga0311369_10858562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300029922|Ga0311363_11519875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 535 | Open in IMG/M |
| 3300029943|Ga0311340_10967117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 702 | Open in IMG/M |
| 3300029955|Ga0311342_10186928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2022 | Open in IMG/M |
| 3300030007|Ga0311338_10601846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1131 | Open in IMG/M |
| 3300030057|Ga0302176_10262898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 691 | Open in IMG/M |
| 3300031231|Ga0170824_119182703 | Not Available | 1081 | Open in IMG/M |
| 3300031234|Ga0302325_10612688 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300031234|Ga0302325_11325025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 944 | Open in IMG/M |
| 3300031234|Ga0302325_11332771 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobaculum → Chlorobaculum limnaeum | 940 | Open in IMG/M |
| 3300031234|Ga0302325_11576533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYMSc13B | 840 | Open in IMG/M |
| 3300031234|Ga0302325_13089406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 535 | Open in IMG/M |
| 3300031236|Ga0302324_102395324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 648 | Open in IMG/M |
| 3300031525|Ga0302326_11834748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 792 | Open in IMG/M |
| 3300031708|Ga0310686_104302724 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300031708|Ga0310686_106097902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 945 | Open in IMG/M |
| 3300031708|Ga0310686_112556207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2165 | Open in IMG/M |
| 3300031708|Ga0310686_119840648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 512 | Open in IMG/M |
| 3300031754|Ga0307475_10933892 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300032160|Ga0311301_10280713 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300032160|Ga0311301_10779268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 1320 | Open in IMG/M |
| 3300032160|Ga0311301_11950240 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300032783|Ga0335079_10077282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3785 | Open in IMG/M |
| 3300032783|Ga0335079_11931148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 571 | Open in IMG/M |
| 3300032805|Ga0335078_11151483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300032829|Ga0335070_11988982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 523 | Open in IMG/M |
| 3300032892|Ga0335081_12033888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 612 | Open in IMG/M |
| 3300032892|Ga0335081_12295710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 564 | Open in IMG/M |
| 3300033158|Ga0335077_12055904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 529 | Open in IMG/M |
| 3300033402|Ga0326728_10049190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6216 | Open in IMG/M |
| 3300033412|Ga0310810_10232057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2049 | Open in IMG/M |
| 3300033513|Ga0316628_100456867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.04% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.90% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.90% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.90% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.45% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.45% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.45% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.45% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.45% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.45% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.45% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.45% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_04071630 | 2170459005 | Grass Soil | MNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF |
| N55_08208380 | 2189573000 | Grass Soil | MTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMALD |
| JGI12270J11330_100380754 | 3300000567 | Peatlands Soil | MNDLIVAEKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFMAWFQ* |
| JGI12270J11330_102731651 | 3300000567 | Peatlands Soil | MNELIAPQRIAQWQELKALVLDSVSSPITKRVYNMALEEFYAWF |
| JGI1357J11328_101961512 | 3300000574 | Groundwater | MNELMVVEKIAEWQRLKALVLDSVSSSISRRVYNMALDEFMAPRRR* |
| JGI1027J12803_1095890611 | 3300000955 | Soil | MTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNM |
| Ga0062389_1048593572 | 3300004092 | Bog Forest Soil | MTDLIVAEKIAQWQKSRALVLDSVSSPITKRVYNRALDEFMNRFRR |
| Ga0070689_1013894012 | 3300005340 | Switchgrass Rhizosphere | MTDLIAIQKISGWEKLKTLVLDSVSSPITKRVYNMALDEF |
| Ga0070674_1006324512 | 3300005356 | Miscanthus Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF |
| Ga0070659_1010431681 | 3300005366 | Corn Rhizosphere | MTDLIAIQKISGWEKLKTLVLDSVSSPITKRVYNMALDEFL |
| Ga0070709_103836312 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLISLEKIAQWQKLKTLVLDSLSSPITKRVYNMALDEFMGW |
| Ga0070698_1006729271 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEKIAGWEKLKALVLDSVSSPITKRVYNMALEEFLVWFQ |
| Ga0070734_100462071 | 3300005533 | Surface Soil | MNDLMVVEKIAQWQKLKGMVLDSVSSPITKRVYNMALDEFMAWFQQ |
| Ga0070734_100876693 | 3300005533 | Surface Soil | MNDLIAVEKIAQWQKLKALVLDSVSSPITKRVYTWR* |
| Ga0070734_102069901 | 3300005533 | Surface Soil | MNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALEEF |
| Ga0070735_100442094 | 3300005534 | Surface Soil | MHDLVVVEKHEEWHRLKALVLDSVSSPTTRRVYNMALNEFIAWFKEA |
| Ga0070731_101806182 | 3300005538 | Surface Soil | MNDLAVVEKPAQREKLKAMVLDSVSSPITKRVYNKALNEF |
| Ga0068855_1006617593 | 3300005563 | Corn Rhizosphere | MNDLISLEKIAQWQRLKTLVLDSVSSPITKRVYNMALDEFMCWF |
| Ga0070664_1003833081 | 3300005564 | Corn Rhizosphere | MNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALD |
| Ga0070664_1006545441 | 3300005564 | Corn Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMAL |
| Ga0070761_102082201 | 3300005591 | Soil | MNELIVIEKIAQWEKLKQLVLDSVSSPITKRVYNMALDEFMEWFQ |
| Ga0070761_106903922 | 3300005591 | Soil | MNNLIAVEKIARWLKLKAMVLDSVPPPITKRVYNMALEEFL |
| Ga0070761_107163242 | 3300005591 | Soil | MNELIELDKIAQWQKLKALVLDSVSSPITKRVYNMALEEFYAWF* |
| Ga0068856_1005809781 | 3300005614 | Corn Rhizosphere | MPNNVPKMTDLIAIQKIAGWEKLKTLVLDSVSSPI |
| Ga0068859_1001632214 | 3300005617 | Switchgrass Rhizosphere | MNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP* |
| Ga0068863_1005637653 | 3300005841 | Switchgrass Rhizosphere | MTDLIEIQKIAGWEKLKALVLDSVSSPITKRVYKMA |
| Ga0070766_108674552 | 3300005921 | Soil | MNELIAVQKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFYG |
| Ga0070766_110150191 | 3300005921 | Soil | MNAIAIEKIAQWEKLKALVLDSVSSPITKRVYNMALNEFM |
| Ga0080027_104793952 | 3300005993 | Prmafrost Soil | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWFQQ |
| Ga0075028_1002793173 | 3300006050 | Watersheds | MNELIAVQKIAGWEKLKTLVLDSVSSPITKRVYNMAL |
| Ga0075029_1008686242 | 3300006052 | Watersheds | MSDLIAIQKIAGWEKLKTMVLDSVSSPITKRVYNMALDEFL |
| Ga0075017_1003473191 | 3300006059 | Watersheds | MTDLIAIQKIVGWEKLKTLVLDSVSSPITKRVYNMAL |
| Ga0075015_1005019142 | 3300006102 | Watersheds | MNELIVVEKLAEWQRLKTLVLDSVSSPITKRVYNMALDEF |
| Ga0075015_1009864871 | 3300006102 | Watersheds | MNDLMVVEKIAQWQTLKTLVLDSVSSPITKRVYNMA |
| Ga0070715_103806421 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMA |
| Ga0075014_1000754565 | 3300006174 | Watersheds | MNDLMVVEKIAQWQTLKTLVLDSVSSPITKRVYNM |
| Ga0097621_1000058374 | 3300006237 | Miscanthus Rhizosphere | VNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP* |
| Ga0097621_1014587181 | 3300006237 | Miscanthus Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFM |
| Ga0097621_1017534712 | 3300006237 | Miscanthus Rhizosphere | MNDLISLEKIAQWQKWKTLVIDSVSSPITKRVYNMALDEFMS* |
| Ga0075021_108804572 | 3300006354 | Watersheds | MNELISIEKVAQWQKLKTLVLDSVSSPITKRVYNMA |
| Ga0075021_111068981 | 3300006354 | Watersheds | VNDLIAVEKIAQWQKLKTLVLDSVPSPITKRVYNMALDEFMG |
| Ga0068871_1000123663 | 3300006358 | Miscanthus Rhizosphere | MNDLISLEKIAQWQRLKTLVLDSVSSPITKRIQHGA* |
| Ga0075430_1004638742 | 3300006846 | Populus Rhizosphere | MAPLMTNNRTKMNDLIAVKKLAEWDRLKALVLDSVSSPITRHVYNMAWL* |
| Ga0075431_1003456271 | 3300006847 | Populus Rhizosphere | VDDLIAVKKLAEWDRLKALVLDSVSSPITRLVYNMALNEFMNSY |
| Ga0099830_105269153 | 3300009088 | Vadose Zone Soil | MTDLIAVQRIAGWEKLKTLVLDSVSSPITKRVYNM |
| Ga0099827_107164991 | 3300009090 | Vadose Zone Soil | MNELIVVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFYNWFQ |
| Ga0105245_119401491 | 3300009098 | Miscanthus Rhizosphere | MTELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMG |
| Ga0105245_119846691 | 3300009098 | Miscanthus Rhizosphere | MTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMA |
| Ga0099792_105053301 | 3300009143 | Vadose Zone Soil | MTDLIAVQRIAGWEKLKTLVLDSVSSPITKRVYNMALDEFM |
| Ga0099792_107464352 | 3300009143 | Vadose Zone Soil | MNDLVVVQKIAGWEKLKALVLDSVSSPITKRVYNMALDEFCLAAGDAN* |
| Ga0105241_101034913 | 3300009174 | Corn Rhizosphere | MNDLISLEKIAHLQKLKMLALDSRSSPTTKRVYSPILLD |
| Ga0105241_112571931 | 3300009174 | Corn Rhizosphere | MTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMAL |
| Ga0105241_122026291 | 3300009174 | Corn Rhizosphere | VNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEF |
| Ga0105242_102501681 | 3300009176 | Miscanthus Rhizosphere | MADLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLAWVPAGNPAR |
| Ga0105242_121160112 | 3300009176 | Miscanthus Rhizosphere | VNDLIAVEKIAQWQNLKTLVLDSVSSPITKRVYNMALLARGEYP* |
| Ga0105242_125047131 | 3300009176 | Miscanthus Rhizosphere | MSDLIAVERIAQWQKLKTLVLDSVSSPITKRVYNMALDEFM |
| Ga0105248_101208432 | 3300009177 | Switchgrass Rhizosphere | MNSLSILEKSTEWQRLKALVLDSVSSPLTRRVYSMALDEFVAWFQQSPRP |
| Ga0105248_102221072 | 3300009177 | Switchgrass Rhizosphere | MNELISLEKIAQWQKLKTLVLNSVSSLITKRVYNMALD* |
| Ga0105248_124194122 | 3300009177 | Switchgrass Rhizosphere | MNDLIAVKRLAEWQRMKALVLDSVSSPITRRVYNMALNEFMDW |
| Ga0105248_125748261 | 3300009177 | Switchgrass Rhizosphere | MNELISLEKIAQWQKLKTLVLDSVSSPIPKRVYNMAL |
| Ga0105248_128591722 | 3300009177 | Switchgrass Rhizosphere | MNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWFQQ |
| Ga0105248_128844862 | 3300009177 | Switchgrass Rhizosphere | MNDLMVVEKIAQWQKLKALVLDSVSSPITRRVYNMALD |
| Ga0116222_13141121 | 3300009521 | Peatlands Soil | MNELTVVDKASEWRRMKALVLDSVSSPITKRVYNMALDEF |
| Ga0116218_11343552 | 3300009522 | Peatlands Soil | LIVAEKIAQLQKLKMLVLDSVSSPITKRVYNMALDEFMAWFQ* |
| Ga0116218_15696572 | 3300009522 | Peatlands Soil | MNELTVVDKASEWRRMKALVLDSVSSPITKRVYNMALDEFFSWYGR |
| Ga0116221_10417913 | 3300009523 | Peatlands Soil | MTDLIVVEKIAEWQRLKALVLDSVSSPITRRVYNMALEEFITWFRQ |
| Ga0116220_100999251 | 3300009525 | Peatlands Soil | MNDLIVVEKIAHWEKLKALVLDSVSSPITKRVYNMALNEFLAW |
| Ga0105237_101287673 | 3300009545 | Corn Rhizosphere | MNELIAIQKIAGLEKLKTLVLDRVSSPITKRVYNM |
| Ga0105238_100915072 | 3300009551 | Corn Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVLQHGAG* |
| Ga0126370_123495281 | 3300010358 | Tropical Forest Soil | MSDLVVLEKPAEWDRLKQMVLDSVSSPITKRVYNMALDEFHGRF* |
| Ga0136449_1003501143 | 3300010379 | Peatlands Soil | MTDLIAIQKIAGWEKLKTLVLDSVSSPIRKRVYNMALDEFLG |
| Ga0136449_1027944682 | 3300010379 | Peatlands Soil | MNDLISLEKIAQWQKLKTRVLDSVSSRITKRVYNM |
| Ga0126383_123792061 | 3300010398 | Tropical Forest Soil | MNDLQVVEKLAEWQRLKALVLESVSSPLTRRAYNMALDEFMT* |
| Ga0134123_104843681 | 3300010403 | Terrestrial Soil | MNDLVLATKAADWYKLKALVLDSVSSPITRRVYNMALDEFMVWFRLEPR |
| Ga0105246_106923942 | 3300011119 | Miscanthus Rhizosphere | MNALNVVEKLAEWQRLKSLVLDSVASPITRRVYNMALDE |
| Ga0137391_106409493 | 3300011270 | Vadose Zone Soil | MTDLIAVQKIAEWEKLKMLVLDSVSSPITKRVYNMALDE |
| Ga0137391_107359332 | 3300011270 | Vadose Zone Soil | MTDLIAVQKIAGWEKLKTLVLDSVSSPITKRVYNMA |
| Ga0137391_110718063 | 3300011270 | Vadose Zone Soil | MNDLISLEKIAQWQKLKALVLDRVSSPITKRVYNMALEEFMQWFQN |
| Ga0137391_114225671 | 3300011270 | Vadose Zone Soil | MNDLIVVEKIADWHRLKTLVLDSVSSPITRRVYNM |
| Ga0137393_115795961 | 3300011271 | Vadose Zone Soil | MTELIVVEKTAEWQRLKTLVLDSVSSPITRRVYNMALDE |
| Ga0137463_11193311 | 3300011444 | Soil | MNDLVLAAKAADWYKLKTLVLDSVSSPITRRVYNM |
| Ga0137389_115311421 | 3300012096 | Vadose Zone Soil | MNDLIAVEKIAQWQKLKALVLDSVSSPITKRVYNMALNE |
| Ga0137388_102308101 | 3300012189 | Vadose Zone Soil | MNDLVVVQKIAGWEKLKALVLDSVSSPITKRVNNMALDEFL |
| Ga0137388_113737791 | 3300012189 | Vadose Zone Soil | MNDLIAVKKLAEWDKLKALVLDSVSSSITKRVYNMALNEFMNWYGL |
| Ga0137388_119060601 | 3300012189 | Vadose Zone Soil | MNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMAW |
| Ga0137386_104702881 | 3300012351 | Vadose Zone Soil | MNDLIAAKRLAEWERMKALVLDSVSSPITRRVCNMALNEFIDC |
| Ga0137360_102864903 | 3300012361 | Vadose Zone Soil | MNDLVLAEKAADWTRLKTLVLDSVSSPITRRVYNMALNE |
| Ga0137361_108450242 | 3300012362 | Vadose Zone Soil | MNDLIPVKKLAECDRLKALVLDSVSSPITKRVYNMA |
| Ga0137390_105391262 | 3300012363 | Vadose Zone Soil | MTDLITIQRIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLGWF |
| Ga0137359_101789242 | 3300012923 | Vadose Zone Soil | MKWTGAFTDLIALEKLANWQKLKTLVLDSVSSPIT |
| Ga0137359_105106031 | 3300012923 | Vadose Zone Soil | MNDLIAVEKIAQCQKLKALVLDSVSSPITKRVYNMALNEFM |
| Ga0137359_109848952 | 3300012923 | Vadose Zone Soil | MNDLIVVEKIAGWEKLKALVLNSVSSPITKRVYNMALDEFLVWF |
| Ga0137407_107917373 | 3300012930 | Vadose Zone Soil | MTELTAIPKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFYDWYQ |
| Ga0137407_109547911 | 3300012930 | Vadose Zone Soil | MNDLIAVKKLAEWDRLKTLVLDSVSSPITRRVYNIALNEFWRVWFSTK* |
| Ga0137407_114166461 | 3300012930 | Vadose Zone Soil | MTDLISLEEIAQWQKLKTLVLDSVSSPITERVCSGALCAR* |
| Ga0164300_100637782 | 3300012951 | Soil | MNHLVLAEKAAEWNFLKKLVLDSVSSPITRRVYNMALNEFLDWFR |
| Ga0157369_116343981 | 3300013105 | Corn Rhizosphere | MNELISLEMIAQWQKLKMLVLDSISSPITKRVYNMPLDEFMGWFQQD |
| Ga0157374_118115442 | 3300013296 | Miscanthus Rhizosphere | MMNDLIAVEKIAQWQKLKTLVLDSVPSPITKRVYNMALD |
| Ga0157374_122101151 | 3300013296 | Miscanthus Rhizosphere | MNHLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP* |
| Ga0157374_125221481 | 3300013296 | Miscanthus Rhizosphere | MNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWFQLV |
| Ga0157378_103110812 | 3300013297 | Miscanthus Rhizosphere | MNDLIAVEKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFMGWFQQ |
| Ga0163162_100106638 | 3300013306 | Switchgrass Rhizosphere | MNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWF |
| Ga0163162_134539811 | 3300013306 | Switchgrass Rhizosphere | MNDLMVVEKIAQWQKLKTLVLDSVSSPITRRVYNITLDEFLNWFQ |
| Ga0157375_1000213111 | 3300013308 | Miscanthus Rhizosphere | MTALISLEKIAQWQKLKTLVLDSVSSPITKRVYSMALDEFMGWFQ* |
| Ga0120132_10110572 | 3300013832 | Permafrost | MNDLVVLDKIAHWQKLKGMVLDSVSSPITKRVYNMALNEFMN |
| Ga0181527_12036382 | 3300014153 | Bog | MTDLIAVQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLAWF |
| Ga0181521_100755271 | 3300014158 | Bog | MTDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLGW |
| Ga0182010_100180544 | 3300014490 | Fen | VSPEADLIVLPQTNQWQKLKTLVLDSVSSPITKRVYNHALDEFFA |
| Ga0182024_107980293 | 3300014501 | Permafrost | LVVVEKIAQWQRLKSLVLDSVSSPITKRVYNMALDEFMAW |
| Ga0157377_110871571 | 3300014745 | Miscanthus Rhizosphere | MNDLISLEKIAQWQKLKMLVLDSISSPITKRVYNMPLDEFMGWFQQ |
| Ga0182030_115003832 | 3300014838 | Bog | MNDLIAVQKIARWEKLKAMVLDSVSSPITKRVYNMALEEFLAW |
| Ga0157376_100279051 | 3300014969 | Miscanthus Rhizosphere | MNDLISLEEIAQWQKLKTLVLDSVSSPITKRVYNMAL |
| Ga0157376_110236582 | 3300014969 | Miscanthus Rhizosphere | VNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGWF |
| Ga0157376_116762422 | 3300014969 | Miscanthus Rhizosphere | MTDLIAIQKTAGWEKLKTLVLDSVSSPITKRVYNMALD |
| Ga0182033_121144651 | 3300016319 | Soil | MRRAFPMNPLVPAEKLSQWRRLKTLVLDSVSSPTTRRMYNMALEEFIG |
| Ga0187812_11291701 | 3300017821 | Freshwater Sediment | MNDLIVAEKIAQWQKLKALVLDSVSSPITKRVYSM |
| Ga0187801_101205162 | 3300017933 | Freshwater Sediment | MNDLIVAEKIAQWQKLKSLVLDSVSSPITKRVYNMALDEFIDWFR |
| Ga0187808_101245851 | 3300017942 | Freshwater Sediment | MNDLIVAEKIAQWQKLKALVLDSVSSPTTKRVYNMALDEFMAWFQL |
| Ga0187808_104148581 | 3300017942 | Freshwater Sediment | MNDLIVAEKPAEWQRLKALVLDSVSSPITRRVYNMALDEFMAGY |
| Ga0187808_105196082 | 3300017942 | Freshwater Sediment | MNDLIVAEKIAQWQKLKALVLDSVSSPITRRVYNMALDEFMEW |
| Ga0187817_107499192 | 3300017955 | Freshwater Sediment | MNDLIAVEKIAGWTKLKALVLDSVSSPITKRVYNMAL |
| Ga0187783_105324711 | 3300017970 | Tropical Peatland | MNALTVVERPAQWDRLKQIVLDSVSSPITKRVYNKALDEFLVWFRQA |
| Ga0187781_102339601 | 3300017972 | Tropical Peatland | MNEIAVIKRTAEWQRLKPLVLDSVSSPITKRVYNMALDEF |
| Ga0187780_114173661 | 3300017973 | Tropical Peatland | MNDLVVVEKPAQWDRLKALVLDSVSSPITKRVYNMA |
| Ga0187815_101853322 | 3300018001 | Freshwater Sediment | MTDLIVAEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFM |
| Ga0187804_100334441 | 3300018006 | Freshwater Sediment | MHDLIAVERIAQWEKLKTLVLDSVSSPITKRVYNMALNEFMA |
| Ga0187805_100694083 | 3300018007 | Freshwater Sediment | MHDLIAVERIAQWKKLKTLVLDSVSSPITKRVYNMA |
| Ga0187805_105294862 | 3300018007 | Freshwater Sediment | MNDLIAVEKIAQWQKLKMLVLDSVSSPITKRVYNM |
| Ga0187888_12403331 | 3300018008 | Peatland | MTDLIVVPQMNQWQKLKALVLDSVSSPITKRVYNHSL |
| Ga0187810_101340802 | 3300018012 | Freshwater Sediment | MNDLIVAEKIAQWQKLKALVLDSVSSPITKRLYSMALDEFLAWFR |
| Ga0187810_103212442 | 3300018012 | Freshwater Sediment | MNDLIVAEKIAQWQKLKALVLDSVSSPITKRVYSMALD |
| Ga0187871_108179121 | 3300018042 | Peatland | MTDLIVVPQINQWHKLKTLVLDSVSSPITRRVYNLGLDEFFAW |
| Ga0187766_112605931 | 3300018058 | Tropical Peatland | MNDLIVAKNIANWQRLKALVLDSVSSPITKRVYSMALDEFLAWFR |
| Ga0187784_103908271 | 3300018062 | Tropical Peatland | MNDLVVVEQPAHWSRLKQLVLDSVSSPITKRVYNMAL |
| Ga0187784_106444041 | 3300018062 | Tropical Peatland | MNDLMVVEKPAEWDRLKALMLDSVSSPITKRVYSMALD |
| Ga0182025_12966501 | 3300019786 | Permafrost | MNDLIAMEKIAHWQKLKGMVLDSVSSPITKRVLQYGA |
| Ga0210407_105964372 | 3300020579 | Soil | MNDLVVVEKIAQWQKLKALVLDSVSSPITKRVYNMALDEFLLWFQ |
| Ga0210403_109584012 | 3300020580 | Soil | MNDLIVVEKIAQWQRLKALVLDSVSSPITKRVYNMALDEF |
| Ga0210399_110133383 | 3300020581 | Soil | MNDLIVVEKIAGWEKLKALVLDSVSSPITKRVYNMALDEFLAW |
| Ga0210406_105271392 | 3300021168 | Soil | MNDLVVLEKIAQWEKLKALVLDSVSSPITKRVYNMALNEFMASF |
| Ga0210406_109049342 | 3300021168 | Soil | MNELIAVEKIAQWQKLKALVLDSVSSPITKRVYNMAL |
| Ga0210396_114226631 | 3300021180 | Soil | MPNNEDKMNDLIVVQKIAGWEKLKALVLDSVSSPITKRVYNMALNE |
| Ga0210388_107616261 | 3300021181 | Soil | MHDLIAVERIAQWEKLKTLVLDSVSSPITKRVYNMAL |
| Ga0210393_105081251 | 3300021401 | Soil | MNDLVVIEKIAQWEKLKMLVLDSVSSPITKRVYNM |
| Ga0210397_116053341 | 3300021403 | Soil | MNDLVAIEKIAQWEKLKTLVLDSVSSPITKRVYNMALNE |
| Ga0210387_115646662 | 3300021405 | Soil | MNDLIVIEKIAQWEKLKMLVLDSVSSPITKRVYNMALNEF |
| Ga0210394_106203441 | 3300021420 | Soil | MNELIAVQKIAGWEKLKALVLDSVSSPITRRVYNMALNEFL |
| Ga0210391_109543001 | 3300021433 | Soil | MNDLAVVEKPAQWEKLKAMVLDSVSSPITKRVYNMALNEFM |
| Ga0210391_111591421 | 3300021433 | Soil | MNELTIARRTAEWQRLKPLVLDSVSSPITKRVYNMALDEFF |
| Ga0182009_108499642 | 3300021445 | Soil | VNDLIAVERIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMG |
| Ga0210390_113679832 | 3300021474 | Soil | VNDLIVVEKNAQWRRLKTLVLDSVSSPITKRVYNMALDEFYNWFQ |
| Ga0210402_103587891 | 3300021478 | Soil | LVVVEKIAGWEKLKALVLDSVSSPITKRVYNMALDEFLV |
| Ga0210402_103682193 | 3300021478 | Soil | MNDLIAIEKIAQREKLKALVLDSVSSPITKRVYNMG |
| Ga0210409_101011611 | 3300021559 | Soil | MNDLMLVEKLAHWEKLKALVLDSVSSPITKRVYNMALNE |
| Ga0224547_10488053 | 3300023255 | Soil | MNELVAIEKIAQWEKLKALVLDSVSSPITKRVYNMALNEFMAWF |
| Ga0247667_10345591 | 3300024290 | Soil | MTELIVVEKIAEWQRLKALVLDSVSSPITRRVYNMALDEFIN |
| Ga0247668_10517652 | 3300024331 | Soil | MTELIVVEKIAEWQRLKALVLDSVSSPITRRVYNMALDEFINWYKQA |
| Ga0208820_10150884 | 3300025576 | Peatland | MNDLIVVPQTNHWHKLKALVLDSVSSPITKRVYNL |
| Ga0207654_101347613 | 3300025911 | Corn Rhizosphere | MNDLISLEKIAQWQKWKTLVIDSVSSPITKRVYNMALDEFMS |
| Ga0207707_100327241 | 3300025912 | Corn Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVLQHGAG |
| Ga0207707_114211931 | 3300025912 | Corn Rhizosphere | MNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNM |
| Ga0207671_110227122 | 3300025914 | Corn Rhizosphere | MTDLIAIQKIAGWEKLKTLVLDSFSSPITKRVYNMALDEFL |
| Ga0207649_115330262 | 3300025920 | Corn Rhizosphere | MTDLIEIQKIAGWEKLKALVLDSVSSPITKRVYNMA |
| Ga0207694_102287052 | 3300025924 | Corn Rhizosphere | MNELISLEKIAQWQKLKTLVLDSVSSPLTKRVYNMALD |
| Ga0207686_117940421 | 3300025934 | Miscanthus Rhizosphere | MSDLIAVERIAQWQKLKTLVLDSVSSPITKRVYNMALDEF |
| Ga0207669_105273802 | 3300025937 | Miscanthus Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFIS |
| Ga0207711_101466172 | 3300025941 | Switchgrass Rhizosphere | MNELISLEKIAQWQKLKTLVLNSVSSLITKRVYNMALD |
| Ga0207689_100483933 | 3300025942 | Miscanthus Rhizosphere | MTDLIVIQKIAGWEKLKTLVLDSVSSPITKRVYNMALDEFLSWFQ |
| Ga0207661_101964473 | 3300025944 | Corn Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFI |
| Ga0207661_113213521 | 3300025944 | Corn Rhizosphere | MNELISLEKIAQWQQLKTLVLDSVSSPITKRVYNMALDEFMGWFQQA |
| Ga0207667_101393361 | 3300025949 | Corn Rhizosphere | MTDLIAIQKISGWEKLKTLVLDSVSSPITKRVYNMALD |
| Ga0207667_103798351 | 3300025949 | Corn Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALD |
| Ga0207667_103953752 | 3300025949 | Corn Rhizosphere | MNDLITLEKIAQWQKLKTLVLDSVSSPITKRVYTMALDEFMGWFQQA |
| Ga0207667_112575371 | 3300025949 | Corn Rhizosphere | MNELISLEKIAQWQKVKTLVLDSVSSPITKRVYNMALD |
| Ga0207677_101326753 | 3300026023 | Miscanthus Rhizosphere | MNDLISLEKIAQWQRLKTLVLDSVSSPITKRVYNMALDEFMGW |
| Ga0207677_101624282 | 3300026023 | Miscanthus Rhizosphere | MNDLISLEKIAQWQRLKTLVLDSVSSPITKRIQHGA |
| Ga0207703_118800891 | 3300026035 | Switchgrass Rhizosphere | MNDLMVVEKIAQWQRLKTLVLDSVSSPITRRVYNMALDEFLHWFQQ |
| Ga0207639_102695942 | 3300026041 | Corn Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFMGW |
| Ga0207702_111122231 | 3300026078 | Corn Rhizosphere | MNDLIAIQKIAGWEKLKTLVLDSVSSPITKRVYNM |
| Ga0207675_1023120681 | 3300026118 | Switchgrass Rhizosphere | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYSMALDEF |
| Ga0208043_10929951 | 3300027570 | Peatlands Soil | MNDLIVAEKIAQWQKLKMLVLDSVSSPITKRVYNMALDE |
| Ga0208324_11113152 | 3300027604 | Peatlands Soil | MNDLIVAEKIAQWQKLKMLVLDSVSSPITKRVYNMALDEFMAWFQ |
| Ga0208827_11145211 | 3300027641 | Peatlands Soil | MNDLIVVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFYLWFQQE |
| Ga0209009_10736362 | 3300027667 | Forest Soil | MNDLIVVEKIAQWQKLKALVLDSVSSPITRRVYNMALDES |
| Ga0209415_103553891 | 3300027905 | Peatlands Soil | MNDLIVVEKIAQWQRLKALVLDSVSSRITKRVYSM |
| Ga0209415_108343021 | 3300027905 | Peatlands Soil | MNDLISLEKIAQWQKLKTLVLDSVSSPITKRVYNM |
| Ga0209006_106645031 | 3300027908 | Forest Soil | MLELTVLDNAKKWQKLKTLVLDSVSSPITRGIYNMALDEFVVW |
| Ga0268266_116845991 | 3300028379 | Switchgrass Rhizosphere | MNALNVVEKLAEWQRLKSLVLDSVASPITRRVYNM |
| Ga0268264_100060763 | 3300028381 | Switchgrass Rhizosphere | VNDLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALLARGEYP |
| Ga0311327_108842251 | 3300029883 | Bog | MTDLIAIQKIAEWEKLKTLVLDSVSSPITKRVYNMALD |
| Ga0311369_108585623 | 3300029910 | Palsa | MTDLIAVQKIAGWEKLKALVLDSVSSPITKRVYNMALNEF |
| Ga0311363_115198751 | 3300029922 | Fen | MTEIIAVERVEKEAVWLRLKTMVLDSVSSPITRRVYNMALDEFIGWFHQGGHAGFTK |
| Ga0311340_109671172 | 3300029943 | Palsa | MGLPKASDWRRMKSLVLDSVSSPITKRVYNMALDEFFSWYAQ |
| Ga0311342_101869282 | 3300029955 | Bog | MTEIIAVERVEKEAVWLRLKTMVLDSVSSPITRRVYNMALDEFIGWFHQGGHAGF |
| Ga0311338_106018462 | 3300030007 | Palsa | MNQLIVVEKIAQWQKLKTLVLDSVSSPITKRVYNMALDEFYAWFQQG |
| Ga0302176_102628981 | 3300030057 | Palsa | MNELTVVDKATEWRRMKSLVLDSVSSPITKRVYNMALDE |
| Ga0170824_1191827032 | 3300031231 | Forest Soil | MNELISLEKIAQWQKLKTLVLDSVSSPITKRVYNMALNEFMGWFQQ |
| Ga0302325_106126881 | 3300031234 | Palsa | MNDLIAVEKIAQWQKLKTLVLDGVSSPITKRVYNMALDAFY |
| Ga0302325_113250251 | 3300031234 | Palsa | MNELTVVDKATEWRRMKSLVLDSVRSPITKRVYNMALDEFFG |
| Ga0302325_113327711 | 3300031234 | Palsa | MNELTVVSKTAEWQRLKTLVLDSVSSLITRRVYNMAL |
| Ga0302325_115765331 | 3300031234 | Palsa | MSKLIAVEKIAQWQKLKTLVLDSVSSPITKRVYNMALEEFYAWF |
| Ga0302325_130894061 | 3300031234 | Palsa | MNDLIVVEKIAQWRRLKALVLDSVSSPITKRVYNMALDEFMAWF |
| Ga0302325_132162642 | 3300031234 | Palsa | MNDLIPVEKIAGRHKLKAMVLDSVSSPITKRVGSGCT |
| Ga0302324_1023953241 | 3300031236 | Palsa | MNDLMAVQKIERWEKVKALVLDSVSSPITKRVYNMALNE |
| Ga0302326_118347482 | 3300031525 | Palsa | MTEIIAVERVEKEAVWLRLKTMVLDSVSSPITRRVYNMALDEFIGWFHQGGHS |
| Ga0310686_1043027242 | 3300031708 | Soil | PIMPNNREQKDPKMDDLIAGERIAGWEKLKALALDSVSSPITKRVYNRRWRRRAW |
| Ga0310686_1060979021 | 3300031708 | Soil | MKDLISLEKIAQWQKLKTLVLDSVSSPITKRVHNTALKSGRSSW |
| Ga0310686_1125562072 | 3300031708 | Soil | MNELIAIEKIAQWEKLKTLVLDSVSSPITKRVYNMA |
| Ga0310686_1198406481 | 3300031708 | Soil | MNDLIVVEKIAQWQRLKSLVLDSVSSPITKRVYNMALDEFMAWFRL |
| Ga0307475_109338922 | 3300031754 | Hardwood Forest Soil | MNDLVVVEKPAQWERLKALVLDSVSSPITKRVYNMALD |
| Ga0311301_102807131 | 3300032160 | Peatlands Soil | VNDLIVVEKIAQWKRLKTLVLDSVSSPITKRVYNMA |
| Ga0311301_107792682 | 3300032160 | Peatlands Soil | MTDLIVVPQTNQWHKLKTLVLDSVSSPITRRVYNL |
| Ga0311301_119502401 | 3300032160 | Peatlands Soil | MNDLIVAEKIAQWQKLKSLVLDSVSSPITRRVYNMALDK |
| Ga0335079_100772821 | 3300032783 | Soil | MAEKLAEWQRLKALVLDSVSSPITRRVYNMALDEFIEWY |
| Ga0335079_119311481 | 3300032783 | Soil | MNDLIVLEKIEQWQKLKALVLDSVSSPITKRVYNMALDEFL |
| Ga0335078_111514831 | 3300032805 | Soil | MNELTIVRRTAEWQRLKPLVLDSVSSPITKRVYNMALEEFFSWYDQE |
| Ga0335070_119889822 | 3300032829 | Soil | MNDLIVAEKIAQWQRLKALVLDSVSSPITKRVYSMALDEFLAWFRQEP |
| Ga0335081_120338881 | 3300032892 | Soil | MNDLIVLEKIEQWQKLKALVLDSVSSPITKRVYNMALDEFLA |
| Ga0335081_122957102 | 3300032892 | Soil | MNDLTIVRRTAEWQRLKHLVLDSVSSPITKRVYNMALDEF |
| Ga0335077_120559041 | 3300033158 | Soil | MTDLIAVERIAQWEKLKALVLDSVSSPITKRVYNMALN |
| Ga0326728_100491903 | 3300033402 | Peat Soil | MNDLAVVEKTTEWQRLTTLVLDSVSSPITKRVYNMALNEFFA |
| Ga0310810_102320575 | 3300033412 | Soil | MNDLTTLEKIAQWQKLKTLVLDSVSSPITKRVYNMALD |
| Ga0316628_1004568671 | 3300033513 | Soil | MNELAVVDKRTEWQRMKSLVLDSVSSPITKRVYNMALDEFFSWYVRE |
| ⦗Top⦘ |