Metagenome Family F020482

Overview

Basic Information

• Family ID: F020482
• Family Type: Metagenome
• Number of Sequences: 223
• Average Sequence Length: 36 residues
• Representative Sequence: MEETFLNKGILEKLTREGKSLAFYTTVNKAETLNKP
• Number of Associated Samples: 8
• Number of Associated Scaffolds: 222

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.69 %
• % of genes near scaffold ends (potentially truncated): 0.45 %
• % of genes from short scaffolds (< 2000 bps): 5.83 %
• Associated GOLD sequencing projects: 6
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (78.475 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated (100.000 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant corpus (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 50.00%
  β-sheet: 0.00%
  Coil/Unstructured: 50.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 222 Family Scaffolds
PF00078	RVT_1	8.56
PF00145	DNA_methylase	5.41
PF00665	rve	3.15
PF07727	RVT_2	2.25
PF04725	PsbR	1.35
PF06920	DHR-2_Lobe_A	1.35
PF10520	Lipid_desat	0.90
PF01090	Ribosomal_S19e	0.90
PF02130	YbeY	0.90
PF13650	Asp_protease_2	0.90
PF00628	PHD	0.90
PF00847	AP2	0.90
PF05699	Dimer_Tnp_hAT	0.90
PF05368	NmrA	0.90
PF00226	DnaJ	0.45
PF02183	HALZ	0.45
PF00141	peroxidase	0.45
PF14223	Retrotran_gag_2	0.45
PF15801	zf-C6H2	0.45
PF10551	MULE	0.45
PF00227	Proteasome	0.45
PF05225	HTH_psq	0.45
PF08541	ACP_syn_III_C	0.45
PF00005	ABC_tran	0.45
PF03110	SBP	0.45
PF00182	Glyco_hydro_19	0.45
PF05631	MFS_5	0.45
PF00481	PP2C	0.45
PF03083	MtN3_slv	0.45
PF13637	Ank_4	0.45
PF02326	YMF19	0.45
PF00923	TAL_FSA	0.45
PF07842	GCFC	0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 222 Family Scaffolds
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	5.41
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	3.15
COG4584	Transposase	Mobilome: prophages, transposons [X]	3.15
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	3.15
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	3.15
COG2238	Ribosomal protein S19E (S16A)	Translation, ribosomal structure and biogenesis [J]	0.90
COG0319	ssRNA-specific RNase YbeY, 16S rRNA maturation enzyme	Translation, ribosomal structure and biogenesis [J]	0.90
COG0638	20S proteasome, alpha and beta subunits	Posttranslational modification, protein turnover, chaperones [O]	0.45
COG0711	FoF1-type ATP synthase, membrane subunit b or b'	Energy production and conversion [C]	0.45
COG0176	Transaldolase/fructose-6-phosphate aldolase	Carbohydrate transport and metabolism [G]	0.45
COG0631	Serine/threonine protein phosphatase PrpC	Signal transduction mechanisms [T]	0.45
COG3179	Chitinase, GH19 family	Carbohydrate transport and metabolism [G]	0.45
COG0376	Catalase (peroxidase I)	Inorganic ion transport and metabolism [P]	0.45
COG3484	Predicted proteasome-type protease	Posttranslational modification, protein turnover, chaperones [O]	0.45
COG3979	Chitodextrinase	Carbohydrate transport and metabolism [G]	0.45
COG4095	Sugar transporter, SemiSWEET family, contains PQ motif	Carbohydrate transport and metabolism [G]	0.45
COG5405	ATP-dependent protease HslVU (ClpYQ), peptidase subunit	Posttranslational modification, protein turnover, chaperones [O]	0.45

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
All Organisms	root	All Organisms	21.52 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
cellular organisms	root	All Organisms → cellular organisms	21.52 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	20.63 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.90 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	16.14 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.90 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.45 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.90 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.90 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.45 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	10.31 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.90 %
Klebsormidiophyceae	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae	0.90 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.45 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7.62 %
Klebsormidiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales	0.90 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.90 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.45 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Bryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta	3.14 %
Klebsormidiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae	0.90 %
Enterobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter	0.90 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.45 %
Marchantiophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta	0.45 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Bryophytina	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina	3.14 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Klebsormidium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium	0.90 %
Marchantiopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida	0.45 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.45 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Bryopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	3.14 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Marchantiidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae	0.45 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.45 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Dicranidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae	1.79 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Marchantiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales	0.45 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.45 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Pseudoditrichales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales	1.79 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Cyclostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Cyclostomata	0.45 %
Marchantiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae	0.45 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Ditrichaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae	1.79 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Hyperoartia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Cyclostomata → Hyperoartia	0.45 %
Marchantia	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia	0.45 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Ceratodon	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon	1.79 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.45 %
Petromyzontiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Cyclostomata → Hyperoartia → Petromyzontiformes	0.45 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	1.79 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Petromyzontidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Cyclostomata → Hyperoartia → Petromyzontiformes → Petromyzontidae	0.45 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.45 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	1.79 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Petromyzon	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Cyclostomata → Hyperoartia → Petromyzontiformes → Petromyzontidae → Petromyzon	0.45 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.45 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.48 %
Ceratodon purpureus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	1.79 %
Klebsormidium nitens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	0.90 %
Enterobacter cloacae complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	0.90 %
Petromyzon marinus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Cyclostomata → Hyperoartia → Petromyzontiformes → Petromyzontidae → Petromyzon → Petromyzon marinus	0.45 %
Marchantia polymorpha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	0.45 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300009500|Ga0116229_10000120	Not Available	76840
3300009500|Ga0116229_10000229	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	65577
3300009500|Ga0116229_10000345	Not Available	58264
3300009500|Ga0116229_10000912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	43764
3300009500|Ga0116229_10001647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	35307
3300009500|Ga0116229_10002280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	30921
3300009500|Ga0116229_10002574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	29402
3300009500|Ga0116229_10002917	Not Available	27970
3300009500|Ga0116229_10003104	Not Available	27241
3300009500|Ga0116229_10004803	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	22131
3300009500|Ga0116229_10005610	Not Available	20392
3300009500|Ga0116229_10006106	Not Available	19485
3300009500|Ga0116229_10006364	Not Available	18996
3300009500|Ga0116229_10006483	Not Available	18807
3300009500|Ga0116229_10007055	Not Available	17912
3300009500|Ga0116229_10007876	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	16720
3300009500|Ga0116229_10008778	All Organisms → cellular organisms → Eukaryota	15597
3300009500|Ga0116229_10009160	Not Available	15194
3300009500|Ga0116229_10009327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	14987
3300009500|Ga0116229_10009805	All Organisms → cellular organisms → Eukaryota → Viridiplantae	14530
3300009500|Ga0116229_10013464	Not Available	11558
3300009500|Ga0116229_10013524	Not Available	11522
3300009500|Ga0116229_10014889	Not Available	10721
3300009500|Ga0116229_10020330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	8422
3300009500|Ga0116229_10021766	Not Available	7970
3300009500|Ga0116229_10026626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6768
3300009500|Ga0116229_10031553	Not Available	5907
3300009500|Ga0116229_10040645	Not Available	4872
3300009500|Ga0116229_10045198	Not Available	4502
3300009500|Ga0116229_10047784	Not Available	4324
3300009500|Ga0116229_10063028	Not Available	3553
3300009500|Ga0116229_10121738	Not Available	2317
3300009500|Ga0116229_10144934	Not Available	2085
3300009500|Ga0116229_11092420	Not Available	639
3300009510|Ga0116230_10003322	All Organisms → cellular organisms → Eukaryota	15709
3300009510|Ga0116230_10003963	Not Available	14470
3300009510|Ga0116230_10004843	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13185
3300009510|Ga0116230_10004892	All Organisms → cellular organisms → Eukaryota	13118
3300009510|Ga0116230_10009611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9538
3300009510|Ga0116230_10010429	Not Available	9174
3300009510|Ga0116230_10010797	Not Available	9017
3300009510|Ga0116230_10017204	Not Available	7080
3300009510|Ga0116230_10017615	Not Available	6985
3300009510|Ga0116230_10020014	All Organisms → cellular organisms → Eukaryota	6519
3300009510|Ga0116230_10034488	Not Available	4790
3300009510|Ga0116230_10048095	Not Available	3932
3300009510|Ga0116230_10053764	Not Available	3669
3300009510|Ga0116230_10081165	Not Available	2838
3300009510|Ga0116230_10176860	Not Available	1753
3300009510|Ga0116230_10251073	Not Available	1419
3300009510|Ga0116230_10705674	Not Available	756
3300009697|Ga0116231_10000216	Not Available	86569
3300009697|Ga0116231_10000831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	58800
3300009697|Ga0116231_10001207	Not Available	51947
3300009697|Ga0116231_10002231	Not Available	40494
3300009697|Ga0116231_10003003	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	35236
3300009697|Ga0116231_10003399	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	33127
3300009697|Ga0116231_10003674	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	31644
3300009697|Ga0116231_10006045	Not Available	23446
3300009697|Ga0116231_10007306	Not Available	20362
3300009697|Ga0116231_10007306	Not Available	20362
3300009697|Ga0116231_10008315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	18277
3300009697|Ga0116231_10009122	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16955
3300009697|Ga0116231_10009321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha	16640
3300009697|Ga0116231_10009913	Not Available	15688
3300009697|Ga0116231_10010181	Not Available	15323
3300009697|Ga0116231_10015660	Not Available	9690
3300009701|Ga0116228_10002126	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida	17005
3300009701|Ga0116228_10011803	Not Available	7799
3300009701|Ga0116228_10011978	Not Available	7741
3300009701|Ga0116228_10036917	Not Available	4036
3300009701|Ga0116228_10048864	Not Available	3390
3300009701|Ga0116228_10088977	Not Available	2325
3300009701|Ga0116228_10227343	All Organisms → cellular organisms → Eukaryota	1326
3300009709|Ga0116227_10000093	All Organisms → cellular organisms → Eukaryota	148865
3300009709|Ga0116227_10000194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	106064
3300009709|Ga0116227_10002424	Not Available	42483
3300009709|Ga0116227_10005594	Not Available	26335
3300009709|Ga0116227_10014392	Not Available	12067
3300009709|Ga0116227_10015908	Not Available	11010
3300009709|Ga0116227_10016330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	10689
3300009709|Ga0116227_10016853	Not Available	10365
3300009709|Ga0116227_10025494	Not Available	6894
3300009709|Ga0116227_10042870	Not Available	4342
3300009709|Ga0116227_10052401	Not Available	3709
3300009787|Ga0116226_10005401	Not Available	11410
3300009787|Ga0116226_10007565	Not Available	9798
3300009787|Ga0116226_10010275	Not Available	8582
3300009787|Ga0116226_10012395	Not Available	7910
3300009787|Ga0116226_10038746	Not Available	4759
3300009787|Ga0116226_10102111	Not Available	2964
3300009787|Ga0116226_10106282	Not Available	2904
3300009787|Ga0116226_10221147	Not Available	1962
3300009787|Ga0116226_10258976	Not Available	1799
3300009787|Ga0116226_10292301	Not Available	1680
3300009787|Ga0116226_10857911	Not Available	886
3300027807|Ga0209208_10000224	All Organisms → cellular organisms → Eukaryota	67572
3300027807|Ga0209208_10001201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	36189
3300027807|Ga0209208_10007830	Not Available	14368
3300027807|Ga0209208_10010588	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	11954
3300027807|Ga0209208_10011849	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	11121
3300027807|Ga0209208_10011957	Not Available	11066
3300027807|Ga0209208_10015734	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	9145
3300027807|Ga0209208_10015830	All Organisms → cellular organisms → Eukaryota	9104
3300027807|Ga0209208_10018692	Not Available	8073
3300027807|Ga0209208_10021697	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Klebsormidiophyceae → Klebsormidiales → Klebsormidiaceae → Klebsormidium → Klebsormidium nitens	7234
3300027807|Ga0209208_10023493	Not Available	6799
3300027807|Ga0209208_10036025	Not Available	4799
3300027807|Ga0209208_10078947	Not Available	2429
3300027807|Ga0209208_10093771	Not Available	2089
3300027807|Ga0209208_10118316	Not Available	1709
3300027807|Ga0209208_10257358	Not Available	919
3300027860|Ga0209611_10000121	Not Available	90134
3300027860|Ga0209611_10000123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	90031
3300027860|Ga0209611_10000184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	78793
3300027860|Ga0209611_10000389	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Cyclostomata → Hyperoartia → Petromyzontiformes → Petromyzontidae → Petromyzon → Petromyzon marinus	63009
3300027860|Ga0209611_10000705	All Organisms → cellular organisms → Eukaryota → Viridiplantae	52077
3300027860|Ga0209611_10000708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	52014
3300027860|Ga0209611_10001035	All Organisms → cellular organisms → Eukaryota → Viridiplantae	45922
3300027860|Ga0209611_10002324	Not Available	33323
3300027860|Ga0209611_10003674	Not Available	26499
3300027860|Ga0209611_10004907	Not Available	22683
3300027860|Ga0209611_10005149	Not Available	22082
3300027860|Ga0209611_10005207	Not Available	21942
3300027860|Ga0209611_10005580	Not Available	21016
3300027860|Ga0209611_10005739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	20651
3300027860|Ga0209611_10006524	All Organisms → cellular organisms → Eukaryota → Viridiplantae	19061
3300027860|Ga0209611_10006576	Not Available	18949
3300027860|Ga0209611_10007014	All Organisms → cellular organisms → Eukaryota	18180
3300027860|Ga0209611_10009193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex	15060
3300027860|Ga0209611_10012403	Not Available	11994
3300027860|Ga0209611_10012963	Not Available	11579
3300027860|Ga0209611_10013334	Not Available	11305
3300027860|Ga0209611_10013993	Not Available	10860
3300027860|Ga0209611_10020741	Not Available	7689
3300027860|Ga0209611_10023646	Not Available	6793
3300027860|Ga0209611_10024954	Not Available	6464
3300027860|Ga0209611_10031017	Not Available	5222
3300027860|Ga0209611_10040068	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus	4108
3300027860|Ga0209611_10049575	Not Available	3397
3300027860|Ga0209611_10050280	All Organisms → cellular organisms → Eukaryota → Viridiplantae	3357
3300027860|Ga0209611_10051235	Not Available	3304
3300027860|Ga0209611_10051541	Not Available	3287
3300027860|Ga0209611_10144710	Not Available	1516
3300027860|Ga0209611_10473683	Not Available	707

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Peat Moss	Host-Associated → Plants → Peat Moss	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified	100.00%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified	100.00%

Habitat

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated	100.00%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300009500	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG	Host-Associated
3300009510	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG	Host-Associated
3300009697	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG	Host-Associated
3300009701	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG	Host-Associated
3300009709	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG	Host-Associated
3300009787	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG	Host-Associated
3300027807	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)	Host-Associated
3300027860	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0116229_1000012021	3300009500	Host-Associated	MEETLLNKGILEKLIREGKSLTFYTTVNKAETLNKP*
Ga0116229_100001762	3300009500	Host-Associated	MEETFPDKGILLKLTREGKSLAFYTTINKVETLNKP*
Ga0116229_1000022945	3300009500	Host-Associated	MEEILPDEGILEKLTREGKSLAFYIVVSKVETLNKP*
Ga0116229_100002585	3300009500	Host-Associated	MEETFHDKGILEKLTREGKSLAFYTTINKAETLNKP*
Ga0116229_1000034520	3300009500	Host-Associated	MEEILPDKRILEKLIREGKSLAFYTVVNKAETLNKPQP*
Ga0116229_1000091234	3300009500	Host-Associated	MEETFPDKGILEKLKKEGKSLTFYTAVNKTETLNKP*
Ga0116229_1000164739	3300009500	Host-Associated	MEETLPNKGILEKLTRERKNLAFYIVVNKAETLNKP*
Ga0116229_1000198912	3300009500	Host-Associated	MEETLPDKGILEKLTREGKSLAFYTTINEAKTLNKP*
Ga0116229_1000228026	3300009500	Host-Associated	MEETLPYKGILEKLIREGKSLAFYTTVNKVETLNKP*
Ga0116229_1000257426	3300009500	Host-Associated	MTVEETLPDKGILEKLTREGKSLTFNTSINKVETLNKP*
Ga0116229_1000291721	3300009500	Host-Associated	MEETLLNKGILEKLTREGNNLAFYTTTNKLKTLNKS*
Ga0116229_100029181	3300009500	Host-Associated	MEETFPNKGILEKLTRKGKSLTFYIVVNKDEALNKP*
Ga0116229_1000310420	3300009500	Host-Associated	MEETLPNKGILEKLTREGKSLAFYITVNKAKNLNKP*
Ga0116229_100040303	3300009500	Host-Associated	MEEIILDKGILEKLKRERKSLAFYTIINKAETLKKPQP*
Ga0116229_1000480327	3300009500	Host-Associated	MEETLLDKGILEKLTREGKNLAFYTVVNKVETLNKP*
Ga0116229_100056109	3300009500	Host-Associated	MDETLPNKGILKKLTKEGKNLTFYTVANKLKTLNKP*
Ga0116229_100061063	3300009500	Host-Associated	MTMEETLSKKSILEKLPKEGKSLDFYIAINKVETLNKP*
Ga0116229_1000636418	3300009500	Host-Associated	MEEILPNKGILEKLTREGKSMAFYTTVNKAETLNKP*
Ga0116229_1000648317	3300009500	Host-Associated	MKKIHPDKNFLEKLTREGKSLTFYIAVNKAETLNKP*
Ga0116229_1000705510	3300009500	Host-Associated	MEEIFPNKGILEKITREGKSLAFYIIVNEAETLNKP*
Ga0116229_100078764	3300009500	Host-Associated	MEETLLYKRILEKLTREGKSLAFYTTINKAETLNKP*
Ga0116229_1000877813	3300009500	Host-Associated	LAIEETFLDKGILEKLTREGKSLAFYIAINKVETLNKP*
Ga0116229_100091607	3300009500	Host-Associated	MEETLFNKGIVEKLTREGKSLAFYTVVNKAETLNKS*
Ga0116229_1000932713	3300009500	Host-Associated	MEEILLDKGILEKLTRERKSLGFYTVVNKAEILNKP*
Ga0116229_1000980513	3300009500	Host-Associated	MEETLLDKGILEKPTSERKSLASYTTINKAEKLNKP*
Ga0116229_100134377	3300009500	Host-Associated	MEETLPGKGILEKLIRKGKNLAFYIAANKLKTLNKT*
Ga0116229_1001346410	3300009500	Host-Associated	MEETFPNKGILKKLTKKEKSLAFYIVVNKVKTLNKP*
Ga0116229_100135245	3300009500	Host-Associated	MEETLPDKGILEKLTREGKSLAFYTTINKVKTLNKP*
Ga0116229_1001488920	3300009500	Host-Associated	MEETLPNKRILEKLTREGKSLAFYIVVDKAETLNKP*
Ga0116229_100199798	3300009500	Host-Associated	MEETLLDKGILEKLAKKGKSLTFYKDVNKVEALNKP*
Ga0116229_100203301	3300009500	Host-Associated	MEETFLNKGILEKLTREGKSLAFYTTVNKAKTLNKP*
Ga0116229_100217662	3300009500	Host-Associated	MEETFPNKLGILEKLTREGKSLAFYIAVNKAETLNKP*
Ga0116229_1002296611	3300009500	Host-Associated	MEETLPDKGILEKLTRKGKSLAFYIVVNKVETLNKP*
Ga0116229_100266262	3300009500	Host-Associated	MEEILSNKGILEKLTKEGKNLAFYIAVPKVETLNKP*
Ga0116229_100294813	3300009500	Host-Associated	MEETFPDKRILKKLTNEGKSLAFYTTIHKVKTLNKP*
Ga0116229_100315537	3300009500	Host-Associated	MEETLPNKGILEKLTREGKSLAFYKVVNKAETPNKPEP*
Ga0116229_100406453	3300009500	Host-Associated	MEETFPDKGILEKLTRKGKSWAFYTAANKPKTLNKP*
Ga0116229_100451982	3300009500	Host-Associated	MEETFPDKRIKKKLIRIGKSLAFYIVINKVETLNKP*
Ga0116229_100477842	3300009500	Host-Associated	MEETLLDKEILEKLTKERKNLAFYVAINKAETLNEP*
Ga0116229_100528344	3300009500	Host-Associated	MEETLPDKGILEKLVKEGVSLAFYIAINKVEALNKS*
Ga0116229_100630285	3300009500	Host-Associated	MEETLPNKGILEKLTREGKNLASYTAVNKAETLNKP*
Ga0116229_101035961	3300009500	Host-Associated	MEEIFPHKGILEKLTRERKSLAFYATVNKTETLNKP*
Ga0116229_101217382	3300009500	Host-Associated	MEETFPNKGILEKLTREGKSLAFYTAINKVKTLKKP*
Ga0116229_101340122	3300009500	Host-Associated	MNVEESFLDKGILEKLIRERKSLVFYTTVNKVETLNKP*
Ga0116229_101449341	3300009500	Host-Associated	MEETFLNKGILEKLTKEGKSLAFYTTVNKAKTLNKP*
Ga0116229_110924201	3300009500	Host-Associated	MEETLLDKGLLKKLKREGKSLAFYIAVNKVETLNKP*
Ga0116230_1000332214	3300009510	Host-Associated	MEETFPDKGLLEKLTKEGKNLAFYTTVNKAETLNKPQP*
Ga0116230_100039633	3300009510	Host-Associated	MEEIFPYKGILEKLTREGKNMAFYIIVNKAETLNKP*
Ga0116230_100048432	3300009510	Host-Associated	MEETLPNKGILEKLTREGKSLGFYTSVNKVETVNKP*
Ga0116230_100048926	3300009510	Host-Associated	MEETLPNKGILEELIKEGKSLDFYTSFNKAKTLNKP*
Ga0116230_100096112	3300009510	Host-Associated	MEETLIDKGILEKLTREGKSLAFHTIINKAKTLNKP*
Ga0116230_100104297	3300009510	Host-Associated	MEETLLDKRIFKKLTREGKSLAFYTAINKVETPNKP*
Ga0116230_100107977	3300009510	Host-Associated	MEETLPDKGILEKLIREGKSLAFYIVVKKVETLNKP*
Ga0116230_100172041	3300009510	Host-Associated	MEEILPDKGILEKQTRERKSLAFYITVIKAETLNKP*
Ga0116230_100176159	3300009510	Host-Associated	MEETFLNKGILKKLTRKGKSLAFKIDVNKVETLNKP*
Ga0116230_100195266	3300009510	Host-Associated	MEETLPDKIILEKLTRKGKNLAFYTIANKAKTLNKP*
Ga0116230_100200145	3300009510	Host-Associated	MEKTLPDKGILEKLTRKGKILAFYIIINKVETLNKP*
Ga0116230_100327931	3300009510	Host-Associated	MEETLPNKEILKKLTKEGKSLAFYTIANKVETLNKS*
Ga0116230_100344881	3300009510	Host-Associated	MKETFPDKGILEKLTRARKSLAFYTTVNKAETLNKS*
Ga0116230_100480954	3300009510	Host-Associated	MEETLPNKGILEKLTREGKSLAFYIAVNKAKTLNKP*
Ga0116230_100537641	3300009510	Host-Associated	MEEILPDKGLKKKLTRKENSLAFYIVINKAETLNKP*
Ga0116230_100572342	3300009510	Host-Associated	MEETLSDKGILEKLTKEGKSLAFYTIVNKVETLNKP*
Ga0116230_100811652	3300009510	Host-Associated	MKETLPNKGIIEKLTKEGKSLTLYTIVNKAKTLNNP*
Ga0116230_100855164	3300009510	Host-Associated	MEETLPDKGILEKLIREGKNLAFYTIVNKAETLNKP*
Ga0116230_101034532	3300009510	Host-Associated	MEETLLDKGILKKLTREGKNLIFYTTMHKAETLNKP*
Ga0116230_101179072	3300009510	Host-Associated	MEETLLDKGILEKFTKEGKSLAFYTAINKVETLNKP*
Ga0116230_101467914	3300009510	Host-Associated	MEETFPDKRILEKLIREGKNLVFYIAVNKVKTLNKP*
Ga0116230_101744092	3300009510	Host-Associated	MEEILLDKGILEKLTRKGKNLAFYKVVNKVETLNKP*
Ga0116230_101768601	3300009510	Host-Associated	MEETVLDKGILEKLTKEERSLAFYTTVNKAETLNKP*
Ga0116230_102368233	3300009510	Host-Associated	MEETLLDKGVLEKLIKEGKSLAFYTTINKAETLNNP*
Ga0116230_102510733	3300009510	Host-Associated	MEETLPNKGILEKLIREGKSLAFYTSINKAETLNKP*
Ga0116230_104106142	3300009510	Host-Associated	MEEILPDKGILEKLTKGWKNLAFYIIVNKAETLNKPKP*
Ga0116230_105185701	3300009510	Host-Associated	MEETLPEKGIIKKLTRERKSLAFYTTINKAKTLNKP*
Ga0116230_106928011	3300009510	Host-Associated	MEETLLDKGILEILIREGKSLAFYTIVNKAETLNKP*
Ga0116230_107056741	3300009510	Host-Associated	MEEILFDKKILEKLISEKKSLGFYTTVNKAETLNKP*
Ga0116230_108227431	3300009510	Host-Associated	MEETLLDKGILKKLTREGKNLIFYTTVHKAETLNKP*
Ga0116231_1000021660	3300009697	Host-Associated	MEETLLNKGILEKLTREGKSLTFYTTVNKAETLNKP*
Ga0116231_100008313	3300009697	Host-Associated	MEETFPYKGILEKLIREGKSLAFSIAVNKAETLNKP*
Ga0116231_100012077	3300009697	Host-Associated	MEETLPNKGILEKLIREGKSLAFYITVNKAKNLNKP*
Ga0116231_1000223123	3300009697	Host-Associated	MEETFLNKGILEKLTREGNNLAFYTTTNKLKTLNKS*
Ga0116231_100030033	3300009697	Host-Associated	MEETLLDKGILKKMTKEGKSLAFYITVNKAETLNKP*
Ga0116231_100033994	3300009697	Host-Associated	MEETFPDKGILKKLKKEGKSLTFYTAVNKTETLNKP*
Ga0116231_1000367431	3300009697	Host-Associated	MEETLSDKGILEKLTKEGKNLAFYTVVNKAETLNKP*
Ga0116231_1000563928	3300009697	Host-Associated	MIVEETLPDKGILEKLTREGKSLTFNTSINKVETLNKP*
Ga0116231_1000604516	3300009697	Host-Associated	MEETFLDKGILEKLIREGKSLTFYIAVNKAKILNKP*
Ga0116231_1000730612	3300009697	Host-Associated	MEEILPHKGILEKLTRERKSLAFYATVNKTETLNKP*
Ga0116231_1000730619	3300009697	Host-Associated	MEETLLDKGIPKKLARKGKSLASYTIVNKAETLNKP*
Ga0116231_100083159	3300009697	Host-Associated	MEETFFNKGILEKLTREGKSLAFYATINKVKTLNKP*
Ga0116231_1000912220	3300009697	Host-Associated	MEETFPDKGILEKLTREGKSLVFYTTVNKAETLNKP*
Ga0116231_1000932116	3300009697	Host-Associated	MEETFPNKGILEKPTRERKNLAFYIAVNKAETLNKP*
Ga0116231_1000991313	3300009697	Host-Associated	MEETFLNKGILEKLTREGKSLAFYTTVNKAETLNKP*
Ga0116231_1001018112	3300009697	Host-Associated	MEETLFNKGIVEKLTREGKSLAFYTVVNKAETLNKP*
Ga0116231_1001566012	3300009697	Host-Associated	MEETFPNKLGILEKLTREGKSLAFYIAINKAKTLNKP*
Ga0116231_102495591	3300009697	Host-Associated	MEETLPNKGVLEKLTREGRSLAFYTTINKLKFNKP*
Ga0116228_1000212623	3300009701	Host-Associated	MEETLPNKGILEKIIIERKNLAFYTTVNKVETLNKP*
Ga0116228_100038228	3300009701	Host-Associated	MEETLPDKIILEKLTRKGKNLAFYTTANKAKTLNKP*
Ga0116228_100118038	3300009701	Host-Associated	MEETFPDKGILEKLIREGKSLAFYIVVKKVETLNKP*
Ga0116228_100119784	3300009701	Host-Associated	MEETFFDKGILENLTREEKSLAFYTIVNKAKTLNKP*
Ga0116228_100239057	3300009701	Host-Associated	MEETLPDKGILKKLTREGKSLAFYTIVNKVETLNKP*
Ga0116228_100369172	3300009701	Host-Associated	MEETLHDKGILEKLIREGKSLAFYIVFNKAKTLNKP*
Ga0116228_100488643	3300009701	Host-Associated	MEETLHDKRILEKLTREKKSLAFYTAINKAKTLNKP*
Ga0116228_100731461	3300009701	Host-Associated	MEEILPHNGIIKKLTRKKKSLAFYTIVNKVETLNKL*
Ga0116228_100889772	3300009701	Host-Associated	MEETLLDKGILKNLIRARKSLAFYIAINKAKTLNK*
Ga0116228_101005201	3300009701	Host-Associated	MEKTLPDKGILEKLTRKGKNLAFYIIINKVETLNKP*
Ga0116228_101657972	3300009701	Host-Associated	MEETLHDKGILEKLIRERKSLAFYIVVNKAKTLNKP*
Ga0116228_102273433	3300009701	Host-Associated	MEETLLNKGILKKLTKEGKSLAFYITINKVETLNKP*
Ga0116228_106284391	3300009701	Host-Associated	MEEIPLDKFFLEKLIREGKSLAFYAIINKVETLNMP*
Ga0116227_1000009335	3300009709	Host-Associated	MEETLPDKGILEKLTKEGKSLAFYTTINKVETLNKP*
Ga0116227_100001946	3300009709	Host-Associated	MEETLHDKGILEKLVKEGVSLAFYIAINKVEALNKS*
Ga0116227_1000201133	3300009709	Host-Associated	MEETFHEKGILEKLTREGKSLAFYTTINKAETLNKP*
Ga0116227_1000242419	3300009709	Host-Associated	MEETLLDKGILKKLTKEGKSLAFYKAVNKAETLNKP*
Ga0116227_100037673	3300009709	Host-Associated	MEETFLDKGILEKLTRKGKSLAFYTTVNKAETLNKP*
Ga0116227_1000559434	3300009709	Host-Associated	MEETFPDKGILEKLTRKGKSWAFYTAANKLKTLNKP*
Ga0116227_1001137614	3300009709	Host-Associated	MEEILLDKGILEKLTRERKSLGFYTFVNKAEILNKP*
Ga0116227_1001439215	3300009709	Host-Associated	MEETLFDKGILEKLTRKGKSLAFHITINKVETLNKS*
Ga0116227_1001590813	3300009709	Host-Associated	MEETFFNKGIQKKLTREGKSLAFYTTINKAETLNKP*
Ga0116227_100163308	3300009709	Host-Associated	MEETLLNKGILEKLTREGKSLAFYTTVNKAKTLNKP*
Ga0116227_1001685312	3300009709	Host-Associated	MEETFPNKLGILEKLTREGKSLAFYIAINKAETLNKP*
Ga0116227_100252966	3300009709	Host-Associated	MEEILLYKGILEKLTREGKNLAFYTIVNKAKTLNKP*
Ga0116227_100254947	3300009709	Host-Associated	MEETLLDKQILERLTREGKSLAFYLAINKVETLNKP*
Ga0116227_100428702	3300009709	Host-Associated	MEETLLDKEILEKLTKERKNLVFYVAINKAKTLNEP*
Ga0116227_100524013	3300009709	Host-Associated	MEKTLSDKGILEKLTKEGKNLAFYTVVNKAETLNKP*
Ga0116226_100020409	3300009787	Host-Associated	MEETLLDKGILEKLTREGKNLAFYIIVNKAETLNKP*
Ga0116226_1000260512	3300009787	Host-Associated	MEETLPNKIILEKLTRKGKNLAFYTAANKAKTLNKP*
Ga0116226_1000391613	3300009787	Host-Associated	MEETLSQKGILEKLTRKRKNLAYYTTINKVETLNKP*
Ga0116226_100041436	3300009787	Host-Associated	MEETLPYKGILEKLTREGKSLAFYTTINKVETLNKP*
Ga0116226_1000540116	3300009787	Host-Associated	MEKTFLDKGILEKLTREKKSLAFYIIVNKVETLNKP*
Ga0116226_100075654	3300009787	Host-Associated	MEKIFPNKGILEKLTREGNILAFYIVVNKVKTLNKL*
Ga0116226_100102755	3300009787	Host-Associated	MEETLLNKGILEKLIKVGKSLAFYIAVNKAETLNKP*
Ga0116226_1001239510	3300009787	Host-Associated	MEEILPDKGIRKKLTRKENNLAFYIVINKAETLNKP*
Ga0116226_100155661	3300009787	Host-Associated	MEETLLDKGILEKLIRERKSLTFYIVVNKVKTLNKP*
Ga0116226_100387465	3300009787	Host-Associated	MEETLPDKGILEKLIREGKSLAFYIAINKVETLNKP*
Ga0116226_100520603	3300009787	Host-Associated	MEETLPDKGILKKLTREWKSLAFYTVINKVETLNKP*
Ga0116226_100542525	3300009787	Host-Associated	MEEIFPYKGILEKLTREGKNMAFYIIVNKVETLNKP*
Ga0116226_100801663	3300009787	Host-Associated	MEETLTNKRILEKLTRKGKSLAFYTAVNKVETLNKP*
Ga0116226_100947824	3300009787	Host-Associated	MEKILFDKRILERFTRKGKSLAFYTAVNKIETLNKP*
Ga0116226_100952381	3300009787	Host-Associated	MEEILVDKGILEKRTREGKNLAFYTTINKVETLNKP*
Ga0116226_101021112	3300009787	Host-Associated	MEETLLDEGILEKLIREGKSLAFSIAVNKAETLNKP*
Ga0116226_101062822	3300009787	Host-Associated	MDETFPNKGILEKLTREGKSLAFYTIVNKAKTINKP*
Ga0116226_101079776	3300009787	Host-Associated	MEETLPDKRIIKKLIKEEKNLTFYIIVNKAETLNKP*
Ga0116226_101161371	3300009787	Host-Associated	MEETFPDKGILEKLTREGKNLAFHTTVNKVETLNKP*
Ga0116226_101597861	3300009787	Host-Associated	MEETLLDKGILEKLTREGKSMAFYIIVNKVETLNKP*
Ga0116226_102211472	3300009787	Host-Associated	MEETFPDKGILEKLTRARKSLAFYTTVNKAETLNKS*
Ga0116226_102399251	3300009787	Host-Associated	MEEIFPDKGILEKLTREGKKLSFYTIVNKVETLNKP*
Ga0116226_102589762	3300009787	Host-Associated	MEETLLDEGILEKFTKEGKSLAFYIAINKVETLNKP*
Ga0116226_102864662	3300009787	Host-Associated	MEDTLSNKGILEKLTKKGKSLAFYTFENKVETQNKP*
Ga0116226_102923011	3300009787	Host-Associated	MEKTLPNKGILEKLIREGNNLAFYIAVNKAETLNKP
Ga0116226_106642061	3300009787	Host-Associated	TMEETFPDKGILEKLTREGKSLSFYIAINKVETLNKP*
Ga0116226_108579111	3300009787	Host-Associated	MEETFPNKGILEKLTREGKNLAFDTTINKAETLNKP*
Ga0116226_109415901	3300009787	Host-Associated	MEEILLDKGILEKLTRKGKNMAFYIVVNKAKTLNKP*
Ga0116226_111515072	3300009787	Host-Associated	MEETLLDKGILKKLTREGKNLIFYTTMHKVETLNKP*
Ga0209208_1000022460	3300027807	Host-Associated	MEETLPNKGILEELIKEGKSLDFYTSFNKAKTLNKP
Ga0209208_1000120111	3300027807	Host-Associated	MEETFPDKGLLEKLTKEGKNLAFYTTVNKAETLNKPQP
Ga0209208_100019776	3300027807	Host-Associated	MKETFPDKGILEKLTRARKSLAFYTTVNKAETLNKS
Ga0209208_1000783015	3300027807	Host-Associated	MEEIFPYKGILEKLTREGKNMAFYIIVNKAETLNKP
Ga0209208_100105882	3300027807	Host-Associated	MEETLHDKRILEKLTREKKSLAFYTAINKAKTLNKP
Ga0209208_1001184913	3300027807	Host-Associated	MEEILPKKGILKKLIREGKSLAFYITVNKTKTLNKP
Ga0209208_100119574	3300027807	Host-Associated	MEETFLNKGILKKLTRKGKSLAFKIDVNKVETLNKP
Ga0209208_100135342	3300027807	Host-Associated	MEETLLDKGILEKLIRERKSLTFYIVVNKVKTLNKP
Ga0209208_100157342	3300027807	Host-Associated	MEETLPEKGIIKKLTRERKSLAFYTTINKAKTLNKP
Ga0209208_100158305	3300027807	Host-Associated	MEEILLDKFFLEKMIREGKSLAFYAIINKVETLNMP
Ga0209208_100177888	3300027807	Host-Associated	MEETLPDKGILKKLTREGKSLAFYTIVNKVETLNKP
Ga0209208_100186926	3300027807	Host-Associated	MEETLPDKGILEKLIREGKSLAFYIVVKKVETLNKP
Ga0209208_100216977	3300027807	Host-Associated	MEEILPDKGILEKQTRERKSLAFYITVIKAETLNKP
Ga0209208_100234931	3300027807	Host-Associated	MEETFPDKGILEKLIREGKSLAFYIVVKKVETLNKP
Ga0209208_100238065	3300027807	Host-Associated	MEKTLPDKGILEKLTRKGKNLAFYIIINKVETLNKP
Ga0209208_100340471	3300027807	Host-Associated	MEETLPNKEILKKLTKEGKSLAFYTIANKVETLNKS
Ga0209208_100348355	3300027807	Host-Associated	MEETLLDKGVLEKLIKEGKSLAFYTTINKAETLNNP
Ga0209208_100359449	3300027807	Host-Associated	MEETLLDKGILEKFTKEGKSLAFYTAINKVETLNKP
Ga0209208_100360251	3300027807	Host-Associated	MKETLPNKGIIEKLTKEGKSLTLYTIVNKAKTLNNP
Ga0209208_100400868	3300027807	Host-Associated	MEETLHDKGILEKLIRERKSLAFYIVVNKAKTLNKP
Ga0209208_100431282	3300027807	Host-Associated	MEETLPDKGILEKLIREGKNLAFYTIVNKAETLNKP
Ga0209208_100553773	3300027807	Host-Associated	MEETLSDKGILEKLTKEGKSLAFYTIVNKVETLNKP
Ga0209208_100662403	3300027807	Host-Associated	MEETLLDKGILKKLTREGKNLIFYTTMHKAETLNKP
Ga0209208_100789472	3300027807	Host-Associated	MEETLPNKGILEKLIREGKSLAFYTSINKAETLNKP
Ga0209208_100937712	3300027807	Host-Associated	MEETLPNKGILEKLTREGKSLAFYIAVNKAKTLNKP
Ga0209208_101183162	3300027807	Host-Associated	MEGTLHDKGILEKLIREGKSLAFYIVFNKVKTLNKP
Ga0209208_101266612	3300027807	Host-Associated	MEEILLDKGILEKLTRKGKNLAFYKVVNKVETLNKP
Ga0209208_102209472	3300027807	Host-Associated	MEETLLDKGILEKLIRERKSLAFYIVVNKAKTINKP
Ga0209208_102573581	3300027807	Host-Associated	MEETVLDKGILEKLTKEERSLAFYTTVNKAETLNKP
Ga0209208_102951492	3300027807	Host-Associated	MEETLLDKGIFKKMTREGKSLAFYTIVNKVETLNKP
Ga0209611_1000007953	3300027860	Host-Associated	MEETLPDKGILEKLTREGKSLAFYTTINEAKTLNKP
Ga0209611_1000012173	3300027860	Host-Associated	MEETLLNKGILEKLTREGKSLTFYTTVNKAETLNKP
Ga0209611_1000012315	3300027860	Host-Associated	MEETFPDKGILLKLTREGKSLAFYTTINKVETLNKP
Ga0209611_1000018465	3300027860	Host-Associated	MEETFPNKGILEKLTRKGKSLTFYIVVNKDEALNKP
Ga0209611_1000038251	3300027860	Host-Associated	MEETFHDKGILEKLTREGKSLAFYTTINKAETLNKP
Ga0209611_1000038956	3300027860	Host-Associated	MEETLSKKSILEKLPKEGKSLDFYIAINKVETLNKP
Ga0209611_1000070535	3300027860	Host-Associated	MEETFPHKGILEELIREGKSLAFYTTVNKVETLNKL
Ga0209611_1000070841	3300027860	Host-Associated	MEETFPDKGILEKLKKEGKSLTFYTAVNKTETLNKP
Ga0209611_100010359	3300027860	Host-Associated	MEEILPDEGILEKLTREGKSLAFYIVVSKVETLNKP
Ga0209611_1000232433	3300027860	Host-Associated	MEETLLDKGILEKLTREGKNLAFYTIVNKVETLNKP
Ga0209611_1000345324	3300027860	Host-Associated	MEETLLDKGILEKLAKKGKSLTFYKDVNKVEALNKP
Ga0209611_100036742	3300027860	Host-Associated	MEETFPDKGILEKLTRKGKSWAFYTAANKPKTLNKP
Ga0209611_100047452	3300027860	Host-Associated	MEEIILDKGILEKLKRERKSLAFYTIINKAETLKKPQP
Ga0209611_1000490720	3300027860	Host-Associated	MEETFPNKGILEKLTRKEKSLAFYIVVNKVKTLNKP
Ga0209611_100051493	3300027860	Host-Associated	MKKIHPDKNFLEKLTREGKSLTFYIAVNKAETLNKP
Ga0209611_1000520716	3300027860	Host-Associated	MDETLPNKGILKKLTKEGKNLTFYTVANKLKTLNKP
Ga0209611_100055304	3300027860	Host-Associated	MEETLLYKRILEKLTREGKSLAFYTTINKAETLNKP
Ga0209611_1000558020	3300027860	Host-Associated	MEETLPNKGILEKLTREGKSLAFYITVNKAKNLNKP
Ga0209611_1000573916	3300027860	Host-Associated	MEETLPYKGILEKLIREGKSLAFYTTVNKVETLNKP
Ga0209611_1000652411	3300027860	Host-Associated	MEETLPNKGILEKLTRERKNLAFYIVVNKAETLNKP
Ga0209611_100065764	3300027860	Host-Associated	MEEILPNKGILEKLTREGKSMAFYTTVNKAETLNKP
Ga0209611_1000701411	3300027860	Host-Associated	MEETFPNKGILEKLTREGKSLAFYTAINKVKTLKKP
Ga0209611_1000919311	3300027860	Host-Associated	MEEILLDKGILEKLTRERKSLGFYTVVNKAEILNKP
Ga0209611_100124037	3300027860	Host-Associated	MEEIFPNKGILEKITREGKSLAFYIIVNEAETLNKP
Ga0209611_100129635	3300027860	Host-Associated	MEETLPDKGILEKLTREGKSLAFYTTINKVKTLNKP
Ga0209611_100133349	3300027860	Host-Associated	MEETLPDKGILEKLTRKGKSLAFYIVVNKVETLNKP
Ga0209611_1001399310	3300027860	Host-Associated	MEETLPDKGILEKLVKEGVSLAFYIAINKVEALNKS
Ga0209611_100203105	3300027860	Host-Associated	MEETLLDKGIPEKLARKGKSLASYTIVNKAETLNKP
Ga0209611_1002074110	3300027860	Host-Associated	MEETFPNKLGILEKLTREGKSLAFYIAVNKAETLNKP
Ga0209611_100236469	3300027860	Host-Associated	MEETLPNKGILEKLTREGKSLAFYKVVNKAETPNKPEP
Ga0209611_100249547	3300027860	Host-Associated	MEETLLDKGILEKPTSERKSLASYTTINKAEKLNKP
Ga0209611_100310173	3300027860	Host-Associated	MEETFPYKGILEKLIREGKSLAFSIAVNKAETLNKP
Ga0209611_100400687	3300027860	Host-Associated	MEETFLNKGILEKLTREGKSLAFYTTVNKAETLNKP
Ga0209611_100495751	3300027860	Host-Associated	MEETFLNKGILEKLTKEGKSLAFYTTVNKAKTLNKP
Ga0209611_100502803	3300027860	Host-Associated	MEETLLDKGLLKKLKREGKSLAFYIAVNKVETLNKP
Ga0209611_100512355	3300027860	Host-Associated	MEETLPNKGILEKLTREGKNLASYTAVNKAETLNKP
Ga0209611_100515412	3300027860	Host-Associated	MEEIFPDKGILKKLTREGKSLAFYIVVNKAKTLNKP
Ga0209611_100751852	3300027860	Host-Associated	MNVEESFLDKGILEKLIRERKSLVFYTTVNKVETLNKP
Ga0209611_101447101	3300027860	Host-Associated	MEEILPDKRILEKLIREGKSLAFYIVVNKAETLNKPQP
Ga0209611_101816171	3300027860	Host-Associated	LTVEETFPDKRILKKLTNEGKSLAFYTTIHKVKTLNKP
Ga0209611_102589111	3300027860	Host-Associated	MEETLPNKGVLEKLTREGRSLAFYTTINKLKFNKP
Ga0209611_104736831	3300027860	Host-Associated	MEETLLNKGILEKLTREGKSLAFYTTVNKAKTLNKP