| Basic Information | |
|---|---|
| Family ID | F020449 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 224 |
| Average Sequence Length | 45 residues |
| Representative Sequence | FAPDARAARAYQQINTVYAALTTFTDPLFRSMADGLQGLERA |
| Number of Associated Samples | 184 |
| Number of Associated Scaffolds | 224 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.91 % |
| % of genes near scaffold ends (potentially truncated) | 93.75 % |
| % of genes from short scaffolds (< 2000 bps) | 92.86 % |
| Associated GOLD sequencing projects | 178 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.393 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.464 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.018 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.089 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 224 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 10.71 |
| PF00440 | TetR_N | 7.14 |
| PF13489 | Methyltransf_23 | 3.57 |
| PF13189 | Cytidylate_kin2 | 3.57 |
| PF00106 | adh_short | 2.68 |
| PF02746 | MR_MLE_N | 2.68 |
| PF08669 | GCV_T_C | 2.23 |
| PF07690 | MFS_1 | 2.23 |
| PF00171 | Aldedh | 2.23 |
| PF08281 | Sigma70_r4_2 | 1.79 |
| PF13671 | AAA_33 | 1.79 |
| PF00196 | GerE | 1.34 |
| PF01979 | Amidohydro_1 | 1.34 |
| PF07366 | SnoaL | 1.34 |
| PF13450 | NAD_binding_8 | 0.89 |
| PF13378 | MR_MLE_C | 0.89 |
| PF05988 | DUF899 | 0.89 |
| PF02782 | FGGY_C | 0.89 |
| PF00248 | Aldo_ket_red | 0.45 |
| PF00274 | Glycolytic | 0.45 |
| PF00313 | CSD | 0.45 |
| PF08279 | HTH_11 | 0.45 |
| PF04672 | Methyltransf_19 | 0.45 |
| PF13738 | Pyr_redox_3 | 0.45 |
| PF12681 | Glyoxalase_2 | 0.45 |
| PF13380 | CoA_binding_2 | 0.45 |
| PF08352 | oligo_HPY | 0.45 |
| PF08241 | Methyltransf_11 | 0.45 |
| PF03880 | DbpA | 0.45 |
| PF08240 | ADH_N | 0.45 |
| PF12697 | Abhydrolase_6 | 0.45 |
| PF03006 | HlyIII | 0.45 |
| PF01179 | Cu_amine_oxid | 0.45 |
| PF12706 | Lactamase_B_2 | 0.45 |
| PF01471 | PG_binding_1 | 0.45 |
| PF13377 | Peripla_BP_3 | 0.45 |
| PF03640 | Lipoprotein_15 | 0.45 |
| PF01593 | Amino_oxidase | 0.45 |
| PF00903 | Glyoxalase | 0.45 |
| PF03551 | PadR | 0.45 |
| PF03734 | YkuD | 0.45 |
| PF12680 | SnoaL_2 | 0.45 |
| PF02545 | Maf | 0.45 |
| PF03364 | Polyketide_cyc | 0.45 |
| PF13462 | Thioredoxin_4 | 0.45 |
| PF01242 | PTPS | 0.45 |
| PF13561 | adh_short_C2 | 0.45 |
| PF13191 | AAA_16 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 224 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 10.71 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 5.36 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.23 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.23 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.23 |
| COG0513 | Superfamily II DNA and RNA helicase | Replication, recombination and repair [L] | 1.34 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.89 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.45 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.45 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.45 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.45 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.45 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.45 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.45 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.39 % |
| Unclassified | root | N/A | 36.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01A0YBP | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 2170459024|GZRSKLJ01COMTY | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101940155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300001593|JGI12635J15846_10137317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1698 | Open in IMG/M |
| 3300005177|Ga0066690_10312144 | Not Available | 1063 | Open in IMG/M |
| 3300005331|Ga0070670_101477687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300005332|Ga0066388_105471176 | Not Available | 643 | Open in IMG/M |
| 3300005332|Ga0066388_105920745 | Not Available | 618 | Open in IMG/M |
| 3300005335|Ga0070666_11343117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300005435|Ga0070714_100266584 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300005437|Ga0070710_10293184 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300005440|Ga0070705_100182570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1422 | Open in IMG/M |
| 3300005445|Ga0070708_100141956 | Not Available | 2228 | Open in IMG/M |
| 3300005458|Ga0070681_11446140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300005526|Ga0073909_10195837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300005712|Ga0070764_10795790 | Not Available | 587 | Open in IMG/M |
| 3300005764|Ga0066903_100523491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2020 | Open in IMG/M |
| 3300005764|Ga0066903_102402586 | Not Available | 1019 | Open in IMG/M |
| 3300005764|Ga0066903_108179397 | Not Available | 535 | Open in IMG/M |
| 3300006052|Ga0075029_100350223 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300006052|Ga0075029_100708346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 680 | Open in IMG/M |
| 3300006162|Ga0075030_101611013 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006163|Ga0070715_11048848 | Not Available | 511 | Open in IMG/M |
| 3300006175|Ga0070712_101289850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 636 | Open in IMG/M |
| 3300006573|Ga0074055_11817117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300006806|Ga0079220_10798758 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300006852|Ga0075433_10199721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1778 | Open in IMG/M |
| 3300006893|Ga0073928_10216264 | Not Available | 1489 | Open in IMG/M |
| 3300006953|Ga0074063_14125342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 578 | Open in IMG/M |
| 3300006954|Ga0079219_11707830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300009089|Ga0099828_11476622 | Not Available | 600 | Open in IMG/M |
| 3300009524|Ga0116225_1467617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
| 3300009525|Ga0116220_10225802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128 | 814 | Open in IMG/M |
| 3300009525|Ga0116220_10492684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300009698|Ga0116216_10915057 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010047|Ga0126382_11144084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 693 | Open in IMG/M |
| 3300010048|Ga0126373_11306555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| 3300010341|Ga0074045_10065675 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
| 3300010343|Ga0074044_10777403 | Not Available | 625 | Open in IMG/M |
| 3300010360|Ga0126372_10203360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1652 | Open in IMG/M |
| 3300010360|Ga0126372_10985430 | Not Available | 853 | Open in IMG/M |
| 3300010366|Ga0126379_10484237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1306 | Open in IMG/M |
| 3300010366|Ga0126379_10639083 | Not Available | 1153 | Open in IMG/M |
| 3300010366|Ga0126379_12032885 | Not Available | 677 | Open in IMG/M |
| 3300010366|Ga0126379_12753553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300010376|Ga0126381_100442217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1821 | Open in IMG/M |
| 3300010376|Ga0126381_103400394 | Not Available | 626 | Open in IMG/M |
| 3300010379|Ga0136449_103622773 | Not Available | 585 | Open in IMG/M |
| 3300010396|Ga0134126_12182015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300010398|Ga0126383_11521347 | Not Available | 759 | Open in IMG/M |
| 3300010398|Ga0126383_11989169 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010398|Ga0126383_12391423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300010866|Ga0126344_1437879 | Not Available | 1256 | Open in IMG/M |
| 3300012189|Ga0137388_11099649 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012205|Ga0137362_10572707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 974 | Open in IMG/M |
| 3300012350|Ga0137372_10620565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| 3300012944|Ga0137410_11048437 | Not Available | 696 | Open in IMG/M |
| 3300012971|Ga0126369_10799937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1025 | Open in IMG/M |
| 3300012971|Ga0126369_11680136 | Not Available | 724 | Open in IMG/M |
| 3300012971|Ga0126369_12708527 | Not Available | 580 | Open in IMG/M |
| 3300012972|Ga0134077_10329983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300013307|Ga0157372_10187386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2396 | Open in IMG/M |
| 3300014326|Ga0157380_10286946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1509 | Open in IMG/M |
| 3300014497|Ga0182008_10683920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300015051|Ga0137414_1230276 | Not Available | 7696 | Open in IMG/M |
| 3300016270|Ga0182036_10357150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1128 | Open in IMG/M |
| 3300016294|Ga0182041_11411000 | Not Available | 639 | Open in IMG/M |
| 3300016371|Ga0182034_10284294 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300016422|Ga0182039_10476527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
| 3300016422|Ga0182039_11895011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300017926|Ga0187807_1140162 | Not Available | 770 | Open in IMG/M |
| 3300017928|Ga0187806_1007404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3032 | Open in IMG/M |
| 3300017928|Ga0187806_1175316 | Not Available | 718 | Open in IMG/M |
| 3300017928|Ga0187806_1288317 | Not Available | 576 | Open in IMG/M |
| 3300017932|Ga0187814_10343505 | Not Available | 576 | Open in IMG/M |
| 3300017933|Ga0187801_10361908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300017936|Ga0187821_10251868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300017943|Ga0187819_10886004 | Not Available | 500 | Open in IMG/M |
| 3300017959|Ga0187779_10176066 | Not Available | 1329 | Open in IMG/M |
| 3300017970|Ga0187783_10057936 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300017970|Ga0187783_10848472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300017970|Ga0187783_11099963 | Not Available | 572 | Open in IMG/M |
| 3300017973|Ga0187780_11426131 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300017974|Ga0187777_10308947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 1082 | Open in IMG/M |
| 3300017975|Ga0187782_11444650 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 541 | Open in IMG/M |
| 3300017995|Ga0187816_10574374 | Not Available | 507 | Open in IMG/M |
| 3300017999|Ga0187767_10108719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300018001|Ga0187815_10062785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
| 3300018006|Ga0187804_10006985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → Marmoricola mangrovicus | 3725 | Open in IMG/M |
| 3300018007|Ga0187805_10125914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
| 3300018007|Ga0187805_10254086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 806 | Open in IMG/M |
| 3300018042|Ga0187871_10812935 | Not Available | 522 | Open in IMG/M |
| 3300018047|Ga0187859_10906048 | Not Available | 508 | Open in IMG/M |
| 3300018062|Ga0187784_11438106 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018064|Ga0187773_10667950 | Not Available | 644 | Open in IMG/M |
| 3300018085|Ga0187772_10475384 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300018433|Ga0066667_10498799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300019887|Ga0193729_1210856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300020581|Ga0210399_11281938 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300021088|Ga0210404_10382590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 785 | Open in IMG/M |
| 3300021088|Ga0210404_10479635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300021401|Ga0210393_10866997 | Not Available | 733 | Open in IMG/M |
| 3300021474|Ga0210390_10617998 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300022523|Ga0242663_1031626 | Not Available | 856 | Open in IMG/M |
| 3300022557|Ga0212123_10192778 | Not Available | 1520 | Open in IMG/M |
| 3300022709|Ga0222756_1032560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 723 | Open in IMG/M |
| 3300022712|Ga0242653_1024061 | Not Available | 873 | Open in IMG/M |
| 3300024227|Ga0228598_1072459 | Not Available | 689 | Open in IMG/M |
| 3300024232|Ga0247664_1014317 | Not Available | 1834 | Open in IMG/M |
| 3300024275|Ga0247674_1018762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300024286|Ga0247687_1056243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300024323|Ga0247666_1022155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1355 | Open in IMG/M |
| 3300025320|Ga0209171_10131020 | Not Available | 1491 | Open in IMG/M |
| 3300025633|Ga0208480_1044863 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300025899|Ga0207642_10302921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300025910|Ga0207684_10722350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300025914|Ga0207671_10452483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
| 3300025916|Ga0207663_10744378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300025924|Ga0207694_10409577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1128 | Open in IMG/M |
| 3300025929|Ga0207664_10333062 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300025929|Ga0207664_11885091 | Not Available | 520 | Open in IMG/M |
| 3300025945|Ga0207679_11916620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300026067|Ga0207678_10224130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1609 | Open in IMG/M |
| 3300026078|Ga0207702_10126722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2293 | Open in IMG/M |
| 3300026277|Ga0209350_1166288 | Not Available | 501 | Open in IMG/M |
| 3300026959|Ga0207852_1024800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300026999|Ga0207949_1003194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1442 | Open in IMG/M |
| 3300027031|Ga0208986_1039444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300027039|Ga0207855_1023130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300027158|Ga0208725_1023723 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300027432|Ga0209421_1084276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300027516|Ga0207761_1034663 | Not Available | 992 | Open in IMG/M |
| 3300027570|Ga0208043_1135672 | Not Available | 648 | Open in IMG/M |
| 3300027576|Ga0209003_1026560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 966 | Open in IMG/M |
| 3300027680|Ga0207826_1198368 | Not Available | 541 | Open in IMG/M |
| 3300027692|Ga0209530_1048334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
| 3300027787|Ga0209074_10346372 | Not Available | 608 | Open in IMG/M |
| 3300027855|Ga0209693_10493772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
| 3300027875|Ga0209283_10994400 | Not Available | 500 | Open in IMG/M |
| 3300027908|Ga0209006_10016912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 6613 | Open in IMG/M |
| 3300028742|Ga0302220_10112690 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300028806|Ga0302221_10112023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
| 3300028876|Ga0307286_10087884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
| 3300029701|Ga0222748_1129379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 516 | Open in IMG/M |
| 3300029943|Ga0311340_10036005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6019 | Open in IMG/M |
| 3300029943|Ga0311340_10444881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1175 | Open in IMG/M |
| 3300029943|Ga0311340_10891349 | Not Available | 740 | Open in IMG/M |
| 3300029999|Ga0311339_11138580 | Not Available | 719 | Open in IMG/M |
| 3300030058|Ga0302179_10190946 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300030490|Ga0302184_10440536 | Not Available | 501 | Open in IMG/M |
| 3300030503|Ga0311370_10691491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
| 3300030626|Ga0210291_10259777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 577 | Open in IMG/M |
| 3300031236|Ga0302324_103081881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300031543|Ga0318516_10657703 | Not Available | 596 | Open in IMG/M |
| 3300031543|Ga0318516_10844467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300031544|Ga0318534_10513404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
| 3300031544|Ga0318534_10865872 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031546|Ga0318538_10053345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1983 | Open in IMG/M |
| 3300031549|Ga0318571_10066403 | Not Available | 1112 | Open in IMG/M |
| 3300031564|Ga0318573_10562231 | Not Available | 614 | Open in IMG/M |
| 3300031564|Ga0318573_10772296 | Not Available | 516 | Open in IMG/M |
| 3300031681|Ga0318572_10521462 | Not Available | 708 | Open in IMG/M |
| 3300031681|Ga0318572_10802553 | Not Available | 560 | Open in IMG/M |
| 3300031682|Ga0318560_10140429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300031713|Ga0318496_10076339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1771 | Open in IMG/M |
| 3300031719|Ga0306917_10595807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
| 3300031719|Ga0306917_10925778 | Not Available | 682 | Open in IMG/M |
| 3300031723|Ga0318493_10144223 | Not Available | 1228 | Open in IMG/M |
| 3300031723|Ga0318493_10701454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300031723|Ga0318493_10803760 | Not Available | 530 | Open in IMG/M |
| 3300031748|Ga0318492_10052957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1900 | Open in IMG/M |
| 3300031748|Ga0318492_10240242 | Not Available | 934 | Open in IMG/M |
| 3300031748|Ga0318492_10298733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 838 | Open in IMG/M |
| 3300031768|Ga0318509_10635718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 594 | Open in IMG/M |
| 3300031769|Ga0318526_10264605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 704 | Open in IMG/M |
| 3300031771|Ga0318546_10845694 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031778|Ga0318498_10513378 | Not Available | 527 | Open in IMG/M |
| 3300031780|Ga0318508_1166073 | Not Available | 629 | Open in IMG/M |
| 3300031798|Ga0318523_10559262 | Not Available | 564 | Open in IMG/M |
| 3300031819|Ga0318568_10118247 | Not Available | 1601 | Open in IMG/M |
| 3300031821|Ga0318567_10282895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
| 3300031821|Ga0318567_10647304 | Not Available | 600 | Open in IMG/M |
| 3300031831|Ga0318564_10353169 | Not Available | 645 | Open in IMG/M |
| 3300031835|Ga0318517_10303958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300031846|Ga0318512_10589725 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031859|Ga0318527_10526507 | Not Available | 504 | Open in IMG/M |
| 3300031860|Ga0318495_10383262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300031879|Ga0306919_11296073 | Not Available | 552 | Open in IMG/M |
| 3300031890|Ga0306925_11873860 | Not Available | 571 | Open in IMG/M |
| 3300031894|Ga0318522_10047245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1512 | Open in IMG/M |
| 3300031897|Ga0318520_10711042 | Not Available | 628 | Open in IMG/M |
| 3300031910|Ga0306923_12400165 | Not Available | 523 | Open in IMG/M |
| 3300031946|Ga0310910_11543278 | Not Available | 509 | Open in IMG/M |
| 3300031947|Ga0310909_10135910 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300031996|Ga0308176_10196074 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300032008|Ga0318562_10878860 | Not Available | 512 | Open in IMG/M |
| 3300032010|Ga0318569_10453424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300032039|Ga0318559_10052349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1713 | Open in IMG/M |
| 3300032041|Ga0318549_10213443 | Not Available | 867 | Open in IMG/M |
| 3300032042|Ga0318545_10216439 | Not Available | 686 | Open in IMG/M |
| 3300032052|Ga0318506_10115951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1155 | Open in IMG/M |
| 3300032060|Ga0318505_10192639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
| 3300032060|Ga0318505_10195954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
| 3300032065|Ga0318513_10017960 | All Organisms → cellular organisms → Bacteria | 2910 | Open in IMG/M |
| 3300032066|Ga0318514_10596309 | Not Available | 588 | Open in IMG/M |
| 3300032076|Ga0306924_10409313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1552 | Open in IMG/M |
| 3300032076|Ga0306924_11044791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
| 3300032089|Ga0318525_10668620 | Not Available | 529 | Open in IMG/M |
| 3300032091|Ga0318577_10471986 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032261|Ga0306920_100073148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5026 | Open in IMG/M |
| 3300032515|Ga0348332_10233012 | Not Available | 827 | Open in IMG/M |
| 3300032805|Ga0335078_12010879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300032828|Ga0335080_12081240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300032895|Ga0335074_10063275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5036 | Open in IMG/M |
| 3300032895|Ga0335074_10408551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → Marmoricola mangrovicus | 1468 | Open in IMG/M |
| 3300032895|Ga0335074_11594899 | Not Available | 511 | Open in IMG/M |
| 3300032896|Ga0335075_11069141 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300032954|Ga0335083_10700916 | Not Available | 822 | Open in IMG/M |
| 3300033134|Ga0335073_11273408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300033289|Ga0310914_10112544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2358 | Open in IMG/M |
| 3300033289|Ga0310914_10237406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1636 | Open in IMG/M |
| 3300033289|Ga0310914_10967678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300033290|Ga0318519_10918504 | Not Available | 541 | Open in IMG/M |
| 3300034124|Ga0370483_0073472 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.68% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.45% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.45% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.45% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_6435600 | 2032320005 | Soil | MVAVGDEFAPDTKSARAYQKINRVYAALTSFTDPLFRSMAEGLEGLERA |
| FD1_06434260 | 2170459024 | Grass Soil | DARAARAYQRINTVYAALTTFTDPLFRSMADGLQGLERA |
| INPhiseqgaiiFebDRAFT_1019401551 | 3300000364 | Soil | FGPDARAARAYQRINTVYAGLTTFTDPLFRSMADGLQGLDRA* |
| JGI12635J15846_101373171 | 3300001593 | Forest Soil | MVTVGGQFAPRAPAARAYQKINKIYAGLTTFTDPLFRSMADGLQGLERA* |
| Ga0066690_103121441 | 3300005177 | Soil | MVAAGDEFGPDARAARAYQRINTVYAGLTTFTDPLFRSMADGLQGLERA* |
| Ga0070670_1014776871 | 3300005331 | Switchgrass Rhizosphere | AVGDEFAPDAKAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA* |
| Ga0066388_1054711761 | 3300005332 | Tropical Forest Soil | ATAAMVTAGDEFAPDPRAARAYQKINKVYAGLTTFTDPLFRAMADGLQDLERT* |
| Ga0066388_1059207452 | 3300005332 | Tropical Forest Soil | GPDLTSSRAYRKINKVYAGLTAFTDPLFHAMADVLEGLERT* |
| Ga0070666_113431172 | 3300005335 | Switchgrass Rhizosphere | GDEFAPDAKAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA* |
| Ga0070714_1002665841 | 3300005435 | Agricultural Soil | PGQEFTPDPGAVRAYQQINQVYATLTSHTDPLFRAMADGLAGLDRT* |
| Ga0070710_102931841 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DPGAVRAYQQINQVYATLTSHTDPLFRAMADGLAGLDRT* |
| Ga0070705_1001825702 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA* |
| Ga0070708_1001419561 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ATAAMVAVGDEFAPDTRAARAYQKINTVYAALTSFTDPLFRTMADGLEGLERA* |
| Ga0070681_114461402 | 3300005458 | Corn Rhizosphere | AVGDEFAPDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA* |
| Ga0073909_101958371 | 3300005526 | Surface Soil | ARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA* |
| Ga0070764_107957902 | 3300005712 | Soil | AVRAYRQINQVYATLTSHTDPLFRSMADGLAGLDRR* |
| Ga0066903_1005234914 | 3300005764 | Tropical Forest Soil | GDEFAPDPRAARAYQKINKVYAGLTTFTDPLFRAVADGLQDLEHT* |
| Ga0066903_1024025862 | 3300005764 | Tropical Forest Soil | AGDEFAPDPRAARAYQKINKVYAGLTTFTDPLFRAVADGLEDLERT* |
| Ga0066903_1081793972 | 3300005764 | Tropical Forest Soil | AGDEFAPDPRAARAYQKINKVYAGLTTFTDPLFRAVADGLQDLERT* |
| Ga0075029_1003502231 | 3300006052 | Watersheds | AARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT* |
| Ga0075029_1007083461 | 3300006052 | Watersheds | PDAPAVRAYQQINKIYAGLTSFTDPLFRSMADVLQGLDRA* |
| Ga0075030_1016110132 | 3300006162 | Watersheds | FAPDARAARAYQQINTVYAALTTFTDPLFRSMADGLQGLERA* |
| Ga0070715_110488481 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RAYQQINRVYATLTRHTDPLFRAMADGLAGLDRT* |
| Ga0070712_1012898502 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | WDQATAAMIAVGDQFTPGAPAVRAYQQINKIYAGLTSFTDPLFRSMADALQGLERA* |
| Ga0074055_118171171 | 3300006573 | Soil | AARAYQKINTVYAALTSFTDPLFRTMADGLQGLERA* |
| Ga0079220_107987582 | 3300006806 | Agricultural Soil | AAMVAAGDEFGPDARAVGAYQRINTVYAALATVTDPLFRSMADGLQGLERA* |
| Ga0075433_101997211 | 3300006852 | Populus Rhizosphere | AAMVAAGDEFAPDTRNTRAYQKINKVYAGLTTFTDPLFRSMTDVLEGLERA* |
| Ga0073928_102162642 | 3300006893 | Iron-Sulfur Acid Spring | GDEFAPDATAARAYQKINKVYAGLTTFTDPLFRSMAEVLQGLERA* |
| Ga0074063_141253422 | 3300006953 | Soil | ATAAMVSPGQQFTPDPGAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT* |
| Ga0079219_117078302 | 3300006954 | Agricultural Soil | VAVGDEFAPDTKSARAYQKISTVYAALASFTDPLFRSMAEGLEGLERA* |
| Ga0099828_114766222 | 3300009089 | Vadose Zone Soil | MVADGEEFAPDARAARAYQQINTVYAGLTSLTDPLFRSMAEGLQGLDRA* |
| Ga0116225_14676172 | 3300009524 | Peatlands Soil | GAYRKINRVYAGLTAYTDPLFRAMADGLKGLDRA* |
| Ga0116220_102258022 | 3300009525 | Peatlands Soil | FAPDAKAVRAYQQINKVYAALTTFTDPLFRSMADGLHGLERA* |
| Ga0116220_104926841 | 3300009525 | Peatlands Soil | TVGDEFAPDALAASAYRKINHVYAGLTAFTDPLFRAMADGLQGLERA* |
| Ga0116216_109150572 | 3300009698 | Peatlands Soil | DWDQATAAMVSAGDRFAPDARAARAYQQINTVYAALTTFTDPLFRSMADGLQGLERA* |
| Ga0126382_111440841 | 3300010047 | Tropical Forest Soil | GDEFAPDARAARAYQKINKVYAGLTTFTDPLFRSIADGLQGLERT* |
| Ga0126373_113065552 | 3300010048 | Tropical Forest Soil | AMVSAGDQFTPDAQAARAYQKINQVYAGLTTFTDPLFRSMAAALQGLERA* |
| Ga0074045_100656753 | 3300010341 | Bog Forest Soil | AARAYQQINQVYATLTSHTDPLFRSMADGLVGLDRT* |
| Ga0074044_107774031 | 3300010343 | Bog Forest Soil | FTPDPRAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT* |
| Ga0126372_102033603 | 3300010360 | Tropical Forest Soil | APDARAARAYQKINKVYAGLTTFTDPLFRSIADGIQGLERS* |
| Ga0126372_109854304 | 3300010360 | Tropical Forest Soil | APDARAARAYQKINKVYAGLTTFTDPLFRSIADGIQGLERT* |
| Ga0126379_104842371 | 3300010366 | Tropical Forest Soil | RAYQKINKVYAGLTTFTDPLFRAVADGLQDLEHT* |
| Ga0126379_106390831 | 3300010366 | Tropical Forest Soil | TAGDEFAPDPRAARAYQKINKVYAGLSAFTDPLFRAVADGLQDLERT* |
| Ga0126379_120328852 | 3300010366 | Tropical Forest Soil | AAMVAASDEFAPDARNTRAYQKINKVYAGLTTFTDPLFRAVADGLQDLERT* |
| Ga0126379_127535531 | 3300010366 | Tropical Forest Soil | DWGRATAAMVTAGDEFAPDPRAARAYQKINKVYAGLPTFTDPLFRAVADGLQDLERT* |
| Ga0126381_1004422171 | 3300010376 | Tropical Forest Soil | TAAMVTAGDDFAPDARAARAYQKINKVYAGLTSFTDPLFRSLADGLEGLERA* |
| Ga0126381_1034003941 | 3300010376 | Tropical Forest Soil | TAAMVTAGDDFAPDARAARAYQKINKVYAGLTSFTDPLFRSMADGLEGLERA* |
| Ga0136449_1036227731 | 3300010379 | Peatlands Soil | AVRAYQQINKVYAALTTFTDPLFRSMADGLQGLERA* |
| Ga0134126_121820152 | 3300010396 | Terrestrial Soil | AMVAVGDEFAPDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA* |
| Ga0126383_115213471 | 3300010398 | Tropical Forest Soil | PDATAARVYQKINKVYAGLTAFTDPLFRSMANVLQGLEHA* |
| Ga0126383_119891691 | 3300010398 | Tropical Forest Soil | DEFAPDARAARAYQKINKVYAGLTTFTDPLFRSIADGIQGLERI* |
| Ga0126383_123914232 | 3300010398 | Tropical Forest Soil | VTAGGEFAPDPEAARAYQQINKVYAALPAFTDPLFRAMADGLRGLDRA* |
| Ga0126344_14378791 | 3300010866 | Boreal Forest Soil | DQATAAMVAVGDRFTPDAPAVRAYRQVNKIYAGLTSVTDPLFRSMADALQGLERA* |
| Ga0137388_110996492 | 3300012189 | Vadose Zone Soil | MVADGEEFAPDARAARAYQQINTVYAGLTSLTDPLFRSMADGLAGLDRA* |
| Ga0137362_105727073 | 3300012205 | Vadose Zone Soil | AVGDEFTPDAPAARAYQKINTVYAALTTFTDPLFRSIADALQGLDRA* |
| Ga0137372_106205651 | 3300012350 | Vadose Zone Soil | TAAMISPGDEFAPDRRAARAYQKINKVYATLATFTDPLFRSMADGLHGLERA* |
| Ga0137410_110484371 | 3300012944 | Vadose Zone Soil | TGDEFGPDARAARAYQRINTVYAGLTTFTDPLFRSMADGLQGLERA* |
| Ga0126369_107999371 | 3300012971 | Tropical Forest Soil | AGRAYRKINQVYAGLTGFTDPLFRFMADGLHGLERA* |
| Ga0126369_116801362 | 3300012971 | Tropical Forest Soil | DPRAARAYQKINKVYAGLTTFTDPLFRAVADGLEDLERT* |
| Ga0126369_127085271 | 3300012971 | Tropical Forest Soil | EFAPDPRAARAYQKINKVYAGLTTFTDPLFRAVADGLQDLERT* |
| Ga0134077_103299832 | 3300012972 | Grasslands Soil | GDEFAPDAQAARAYQKINKVYAALSTFTDPLFRSMADGLEGLERA* |
| Ga0157372_101873861 | 3300013307 | Corn Rhizosphere | ARTYQRINTVYAGLTTFTDPLFRSMADGLQGLERA* |
| Ga0157380_102869462 | 3300014326 | Switchgrass Rhizosphere | EFAPDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA* |
| Ga0182008_106839201 | 3300014497 | Rhizosphere | EFTPDTKAARAYQKINTTYAALTSFTDPLFRSMAEGLEGLERA* |
| Ga0137414_12302763 | 3300015051 | Vadose Zone Soil | MSRRRGVAPDARAARAYQKINKVYAALTTFTDPLFRSMADGLQGLERA* |
| Ga0182036_103571501 | 3300016270 | Soil | ATAAMVTVGDQFAPDARAARAYQQINKIYAGLTAVTDPLFRSMAAGLAGLERA |
| Ga0182041_114110002 | 3300016294 | Soil | PADVPHPLAVRVGGQFAPDPRAARAYQGDQPREINKVYATVTTVTGPLFRSMADGLRGLERAPGPGRR |
| Ga0182034_102842942 | 3300016371 | Soil | RAARAYQQINKVYAGLTTFTDPLFRAVADGLQDLERT |
| Ga0182039_104765272 | 3300016422 | Soil | VTAGQGFGPQARASRAYQKINTVYAGLTAFTDPLFRSMVDGLQGLERA |
| Ga0182039_118950111 | 3300016422 | Soil | MVTAGDEFAPDARAARAYQKINKVYAGLNTFTDPLFRAVADGLQGLERS |
| Ga0187807_11401621 | 3300017926 | Freshwater Sediment | APAVRAYQEINKVYAALTTFTDPLFRWMADGLQDLDRA |
| Ga0187806_10074045 | 3300017928 | Freshwater Sediment | DEFIPDARTARAYQQINKVYAALTTFTDPLFRSMADGLQGLERT |
| Ga0187806_11753162 | 3300017928 | Freshwater Sediment | MVSVGDKFAPDARAVRAYQQINKVYAALTTFTDPLFRSMADGLQGLERA |
| Ga0187806_12883171 | 3300017928 | Freshwater Sediment | TADAYQKINEVYAGLTAFTDPLFRAMADGLQGLERA |
| Ga0187814_103435051 | 3300017932 | Freshwater Sediment | RAARAYQQINQVYATLTRHTDPLFRSMADGLAGLDRT |
| Ga0187801_103619081 | 3300017933 | Freshwater Sediment | TPDARAARAYQQINKIYAGLTAVTDPLFRSMAAGLQGLERA |
| Ga0187821_102518681 | 3300017936 | Freshwater Sediment | RAARAYQKINTVYAALTGFTDPLFRAMADGLEGLERA |
| Ga0187819_108860041 | 3300017943 | Freshwater Sediment | SGDEFAPDTRAARAYQEINKVYATLTAFTDLLFRSMADRLQGLERAPGPGRR |
| Ga0187779_101760662 | 3300017959 | Tropical Peatland | MFPHPPPARVGDQFAPDPRAARAYQEINKMFATLTAFTDPLFRSMADGLQGLERAPGPGR |
| Ga0187783_100579361 | 3300017970 | Tropical Peatland | DAFTPDAPAAGAYQQINQVYATLTSFTDPLFRSMADSLHGLERA |
| Ga0187783_108484722 | 3300017970 | Tropical Peatland | MVSSGDEFVLDPRAARVYQEISKEYATLTAFTDPLSRSMADRL |
| Ga0187783_110999631 | 3300017970 | Tropical Peatland | DATAARTYQKINKVYAGLTTFTDPLFRSMANVLQGLARA |
| Ga0187780_114261311 | 3300017973 | Tropical Peatland | AAAVRAYQQINKVYATLTTFTDPLFRSMDGGLQGLDRA |
| Ga0187777_103089474 | 3300017974 | Tropical Peatland | EFSPDARAARAYHQINKVYAAVTTFTDPLFHSMADGLQGLERA |
| Ga0187782_114446502 | 3300017975 | Tropical Peatland | MISPGDEFVPDARAARAYQQINQVYATLTSFTDPLFRSMADGL |
| Ga0187816_105743741 | 3300017995 | Freshwater Sediment | EFAPDERTADAYQKINEVYAGLTAFTDPLFRAMADGLQGLERA |
| Ga0187767_101087192 | 3300017999 | Tropical Peatland | AARAYEKISKVYGSLTALADPLFRSMADGLQGLERT |
| Ga0187815_100627851 | 3300018001 | Freshwater Sediment | AAMVTAGEEFAPDERTADAYQKINEVYAGLTAFTDPLFRAMADGLQGLERA |
| Ga0187804_100069851 | 3300018006 | Freshwater Sediment | TAAMVTAGDEFPPDPRAADAYRKVNQVYAGLTAYTDPLFRAMAEGLDGLERA |
| Ga0187805_101259141 | 3300018007 | Freshwater Sediment | MVTAGEEFAPDERTADAYQKINEVYAGLTAFTDPLFRAMADGLQGLERA |
| Ga0187805_102540861 | 3300018007 | Freshwater Sediment | MVTAGEEFAPDERTADAYQKINEVYAGLTAFTDPLFRAMAASLAGLERA |
| Ga0187871_108129352 | 3300018042 | Peatland | TAAMVSPGQQFTPDPRAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0187859_109060481 | 3300018047 | Peatland | QQFTPDPRAARAYQQINQVYATLTSHTDPLLRSMAEGLAGLDRT |
| Ga0187784_114381061 | 3300018062 | Tropical Peatland | AMVRPGRQFVPDPRAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0187773_106679501 | 3300018064 | Tropical Peatland | MVTMGDQFTPDARAARAYQQINKIYAGLTAVTDPLFRSMAAGLAGLERA |
| Ga0187772_104753841 | 3300018085 | Tropical Peatland | ATAAMVSAGEEFLPDPAAARAYQKINNVYAALTTFTDPLFRAMAEGLQGLERA |
| Ga0066667_104987991 | 3300018433 | Grasslands Soil | EFVPDTRAARAYQKINTVYAALTSFTDPLFRSMADGLEGLERA |
| Ga0193729_12108561 | 3300019887 | Soil | ARAYQKINKAYAALTTFTDPLFRSMAGALQDLDRA |
| Ga0210399_112819381 | 3300020581 | Soil | GDRFAPDVRAARAYQQINTVYAALTTFTDPLFRSMADGLQGLERA |
| Ga0210404_103825902 | 3300021088 | Soil | VPDAPAVRAYQQINKVYATLTSYTDPLFRSMADGLQGLDRA |
| Ga0210404_104796351 | 3300021088 | Soil | DARAARAYQKINKVYAALTTFTDPLFRSMADGLLGLERA |
| Ga0210393_108669972 | 3300021401 | Soil | LRAARAYQQINQVYATLTSHTDLLFRSMADGLAGLDRT |
| Ga0210390_106179981 | 3300021474 | Soil | GQQFTPDPRAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0242663_10316261 | 3300022523 | Soil | AAMVAIGDQFTPDATAVRAYQQINQIYAGLTSFTDPLFRSMADALQGLERA |
| Ga0212123_101927782 | 3300022557 | Iron-Sulfur Acid Spring | QATAAMVSAGDEFAPDATAARAYQKINKVYAGLTTFTDPLFRSMAEVLQGLERA |
| Ga0222756_10325601 | 3300022709 | Soil | AMVAIGDQFTPDATAVRAYQQINKIYAGLTSFTDPLFRSMADALQGLERA |
| Ga0242653_10240611 | 3300022712 | Soil | VRAYQQINKIYAGLTSFTDPLFRSMAEALQGLERA |
| Ga0228598_10724592 | 3300024227 | Rhizosphere | VGHGIYPDWGQATAAMVAAGDEFAPDAAAARAYRQINTVYAGLTAVTDPLFRSMADGLRGLERA |
| Ga0247664_10143171 | 3300024232 | Soil | RAAHAYQKINTVYATLTSFTDPLFRSMAQGLEGLERA |
| Ga0247674_10187622 | 3300024275 | Soil | MVAVGDEFAPDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA |
| Ga0247687_10562431 | 3300024286 | Soil | PDTRAAHAYQKINTVYATLTSFTDPLFRSMAQGLEGLERA |
| Ga0247666_10221551 | 3300024323 | Soil | PDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA |
| Ga0209171_101310202 | 3300025320 | Iron-Sulfur Acid Spring | GDEFAPDATAARAYQKINKVYAGLTTFTDPLFRSMAEVLQGLERA |
| Ga0208480_10448633 | 3300025633 | Arctic Peat Soil | AARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0207642_103029211 | 3300025899 | Miscanthus Rhizosphere | KAARAYQKINTVYAALTSFTDPLFRAMAQGLEGLERA |
| Ga0207684_107223503 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PDARAARAYQQINQVYAGLTSVTDPLFRSMADGLQGLERA |
| Ga0207671_104524831 | 3300025914 | Corn Rhizosphere | AAMVAVGDEFAPDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA |
| Ga0207663_107443782 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FAPDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA |
| Ga0207694_104095772 | 3300025924 | Corn Rhizosphere | AMVAVGDEFAPDAKAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA |
| Ga0207664_103330621 | 3300025929 | Agricultural Soil | ATAAMVSPGQQFTPDPRAVGAYQQINQVYATLTSYTDPLFRAMADGLAGLDRR |
| Ga0207664_118850911 | 3300025929 | Agricultural Soil | TPDPRAARAYQQINQVYATLTSHTDPLFRAMADGLAGLDRA |
| Ga0207679_119166201 | 3300025945 | Corn Rhizosphere | VAVGDEFAPDAKAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA |
| Ga0207678_102241303 | 3300026067 | Corn Rhizosphere | QATAAMVAAGDEFGPDVRAARAYQRINTVYAGLTTFTDPLFRSMADGLQGLERA |
| Ga0207702_101267223 | 3300026078 | Corn Rhizosphere | AVGDEFAPDTTAARAYQKINTVYAALTSFTDPLFRSMAQGLEGLERA |
| Ga0209350_11662882 | 3300026277 | Grasslands Soil | MVAAGDEFVPDTQAARAYQKINRVYAALTTFTDPLFRSMADGLHGLERA |
| Ga0207852_10248001 | 3300026959 | Tropical Forest Soil | SSGDEFAPDPRPARAYQEINKVYATLTAFTDPLFRWMADRLQGLERAPGPGRG |
| Ga0207949_10031941 | 3300026999 | Forest Soil | VGDQFAPDAPAVRAYQQINKIYAGLTSFTDPLFRSMADALQGLERA |
| Ga0208986_10394442 | 3300027031 | Forest Soil | PGTNAARAYQKINTVHAALTSFTDPLFRSMAQGLEGLERA |
| Ga0207855_10231302 | 3300027039 | Tropical Forest Soil | MVSSGDEFAPDPRPARAYQEINKVYATLTAFTDPLFRLMADGLQGLERA |
| Ga0208725_10237233 | 3300027158 | Forest Soil | PDPLAARAYRQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0209421_10842761 | 3300027432 | Forest Soil | MIRPGQQFTPDPRAVRAYQQINQVYATLTSYTDPLFRAMADGLAGLDHR |
| Ga0207761_10346632 | 3300027516 | Tropical Forest Soil | SAAMVSSGDEFAPDPRPARAYQEINKVYATLTAFTDPLFRWMADRLQGLERAPGPGRG |
| Ga0208043_11356722 | 3300027570 | Peatlands Soil | ATAAMVSVGDEFAPDARAVRAYQQINKVYAALTTFTDPLFRSMADGLQGLERA |
| Ga0209003_10265602 | 3300027576 | Forest Soil | VTAGEVFAPDERTAGAYQKINHVYAGLTAFTDPLFRAMAEGLGGLERA |
| Ga0207826_11983681 | 3300027680 | Tropical Forest Soil | VSVGDEFAPDPGAARAYQKISKVYAALTTFTDPLFRLMADGLQGLERA |
| Ga0209530_10483343 | 3300027692 | Forest Soil | VTVGGQFAPRAPAARAYQKINKIYAGLTTFTDPLFRSMADGLQGLERA |
| Ga0209074_103463721 | 3300027787 | Agricultural Soil | MSPHPLPARVGDQFAQDLRAARAYQEINKVYATVTTFTDPLFRSMADGLQGLERAPGPGR |
| Ga0209693_104937721 | 3300027855 | Soil | TAAMVSAGDEFSPDPRAARAYRQVNTVYAALATFTDPLFRSMADALQGLDRS |
| Ga0209283_109944001 | 3300027875 | Vadose Zone Soil | MVADGEEFAPDARAARAYQQINTVYAGLTSLTDPLFRSMAEGLQGLDRA |
| Ga0209006_100169128 | 3300027908 | Forest Soil | DQATAAMVTAGDQLAPDPRAARAYQQINQVYAGLTTFTDPLFRSMADAFEGLDRA |
| Ga0302220_101126901 | 3300028742 | Palsa | FTPNPGAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0302221_101120231 | 3300028806 | Palsa | SQAPAARAYQQINKIYAGLTTFTDPLFRSMADGLQGLERA |
| Ga0307286_100878841 | 3300028876 | Soil | DTKAARAYQKINTVYTALTSFTDPLFRSMAEGLEGLERA |
| Ga0222748_11293791 | 3300029701 | Soil | DAPAVRAYQQINQIYAGLTSFTDPLFRSMADALQGLERA |
| Ga0311340_100360057 | 3300029943 | Palsa | PRAARAYQQINQVYATLTSYTDPLFRAMADGLAGLDRK |
| Ga0311340_104448813 | 3300029943 | Palsa | AAMVSPGPQFTPDPRAARAYQQINQVYATLTSYTDPLFRSMADGLAGLDRT |
| Ga0311340_108913492 | 3300029943 | Palsa | LGQQFTPDPRAVRAYQQINQVYVTLTRYTDPLFRAMADGLAGLDRT |
| Ga0311339_111385801 | 3300029999 | Palsa | PGPQFTPDPRAVRAYQQINQVYATLTRHTDPLFRAMADGLAGLDRT |
| Ga0302179_101909463 | 3300030058 | Palsa | QATAAMVSPGQQFTPDPRAVRAYQQINQVYVTLTRYTDPLFRAMADGLAGLDRT |
| Ga0302184_104405361 | 3300030490 | Palsa | ATAAMVSPGQQFTPAPRAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0311370_106914913 | 3300030503 | Palsa | RAARAYQQINQVYATLTSYTDPLFRAMADGLAGLDRK |
| Ga0210291_102597772 | 3300030626 | Soil | VRAYQQVNEVYAGLTSVTDPLFRSMADALQGLERA |
| Ga0302324_1030818811 | 3300031236 | Palsa | LPAVRVYQQINKVYSALTSFTDPLFRSMADGLQGLERA |
| Ga0318516_106577032 | 3300031543 | Soil | SRAARAYQQINKVYAGLTTFTDPLFRAVADGLQDLERT |
| Ga0318516_108444672 | 3300031543 | Soil | MVTVGDEFAPDAPAARAYEKINKVYAALTTFTDPLFRSMAAGLAGLERA |
| Ga0318534_105134041 | 3300031544 | Soil | PDAPAARAYQKINQVYAALTTYTDPLFRSMAAGLAGLERA |
| Ga0318534_108658722 | 3300031544 | Soil | FAPDAQAARAYQQINTVYAALTTYTDPLFRAMADGLQGLERA |
| Ga0318538_100533451 | 3300031546 | Soil | APDPSAARAYEKINKVYATVTTFTDPLFRSMAAGLQGLGRA |
| Ga0318571_100664032 | 3300031549 | Soil | FAPDPGAARAYQKINKVYAALTTFTDPLFRFMADGFQGLGRA |
| Ga0318573_105622312 | 3300031564 | Soil | AAMVTVGQGFGPQTRASRAYQQINKVYAGLTAFTDPLFRAMADGLQGLERA |
| Ga0318573_107722961 | 3300031564 | Soil | VTLGDQFTPDTRAARVYQQINRVYAGLTTFTDPLFRSMAAGLRGLERA |
| Ga0318572_105214621 | 3300031681 | Soil | DSRAARAYQQINKVYAGLTTFTDPLFRAVADGLQDLERT |
| Ga0318572_108025531 | 3300031681 | Soil | DEFAPDARAGRAYQQINKVYAGLTAFTDPLFRSLADGLQGLERA |
| Ga0318560_101404292 | 3300031682 | Soil | RNSRAYQKINKVYAGLTTFTDPLFRSMTDVLEGLERA |
| Ga0318496_100763391 | 3300031713 | Soil | ARTARAYRKINQVYAALSTFTDPLFRFLADGLQGLERA |
| Ga0306917_105958071 | 3300031719 | Soil | ATAAMVTAGDEFAPHPPAARAYEKINKVYATVTTFTDPLFRSMAAGLQGLERA |
| Ga0306917_109257782 | 3300031719 | Soil | EFAPDPRAARAYQEIDKVYATLNAFTDPLFRSMADRLQDPEHAPGPGRG |
| Ga0318493_101442231 | 3300031723 | Soil | GDEFAPDPGAARAYQKINKVYAALTTFTDPLFRFMADGFQGLGRA |
| Ga0318493_107014541 | 3300031723 | Soil | AAMVTVGDEFAPDAPAARAYEKINKVYAALTTFTDPLFRSMAAGLAGLERA |
| Ga0318493_108037602 | 3300031723 | Soil | GAARAHQGDQPREINKVYATVTTVTGPLFRSMADGLRGLERAPGPGRR |
| Ga0318492_100529571 | 3300031748 | Soil | RNARAYQKINKVYAGLTTFTDPLFRSMTDGLEGLERA |
| Ga0318492_102402421 | 3300031748 | Soil | GDEFAPDPRAARAYQEIDKVYATLNAFTDPLFRSMADRLQDLEHAPGPGRG |
| Ga0318492_102987331 | 3300031748 | Soil | FGPQTRASRAYQQINKVYAGLTAFTDPLFRAMADGLQGLERA |
| Ga0318509_106357181 | 3300031768 | Soil | MVTPGDEFAPDARASRAYQQINEVYAGLTAFTDPMFRSIADGLQGLERF |
| Ga0318526_102646051 | 3300031769 | Soil | WDQATAAMVSVGDEFAPDARTARAYRKINQVYAALSTFTDPLFRFLADGLQGLERA |
| Ga0318546_108456942 | 3300031771 | Soil | TAAMVAAGDNFAPDTRTARAYQKINKVYAGLTTFTDPLFRSMTDGLEGLERA |
| Ga0318498_105133782 | 3300031778 | Soil | AMAAMVTAGDEFAPDSRAARAYQQINKVYAGLTTFTDPLFRAVADGLQDLERT |
| Ga0318508_11660731 | 3300031780 | Soil | GRATAAMVTAGDEFAPDKRNSRAYQKINKVYAGLTTFTDPLFRSMTDVLEGLERA |
| Ga0318523_105592621 | 3300031798 | Soil | TPDARNTRAYQKINKVYAGLTTFTDPLFRSMTDVLEGLERA |
| Ga0318568_101182473 | 3300031819 | Soil | PRAARAYQKINKVYAGLTTFTDPLFRAMADGLRDLERT |
| Ga0318567_102828952 | 3300031821 | Soil | FAPDPRAARAYQKINKVYAGLTAFTDPLFRAVADGLQDLEHT |
| Ga0318567_106473041 | 3300031821 | Soil | VSAGDEFVPDPRAARAYQKINKVYAGLTTFTDPLFRAMADGLQDLERT |
| Ga0318564_103531691 | 3300031831 | Soil | MVTAGDEFAPDKRNSRAYQKINKVYAGLTTFTDPLFRSMTDVLEGLERA |
| Ga0318517_103039581 | 3300031835 | Soil | AGDEFAPDPPAARAYEKINQVYATLTTFTDPLFRSMATGLQGLERA |
| Ga0318512_105897251 | 3300031846 | Soil | DQATAAMVRAGGQFAPDPRAARAYQQINTVYATLTTFTDPLFRSMADGLQGLERA |
| Ga0318527_105265071 | 3300031859 | Soil | TRAYQKINKVYAGLTTFTDPLFRSMIDVLEGLERA |
| Ga0318495_103832622 | 3300031860 | Soil | EATAAMVRAGDEFAPDPPAARAYEKINQVYATLTTFTDPLFRSMATGLQGLERA |
| Ga0306919_112960731 | 3300031879 | Soil | PDPRAARAYQKINKVYAGLPTFTDPLFRAMADGLQDLERT |
| Ga0306925_118738601 | 3300031890 | Soil | PGQQFTPDPQAARAYQQINQVYVTLTSHTDPLFRSMADGLAGLDRT |
| Ga0318522_100472452 | 3300031894 | Soil | MVRAGDGFGPDARAGRAYRKINKVYAGLTGFTDPLFRFMADGLHGLERA |
| Ga0318520_107110422 | 3300031897 | Soil | PGAARAYQKINKVYAALTTFTDPLFRFMADGFQGLGRA |
| Ga0306923_124001652 | 3300031910 | Soil | DEFAPDARNARAYQKINKVYAGLTTFTDPLFRSVTDALEGLERA |
| Ga0310910_115432781 | 3300031946 | Soil | GDEFAPDTRNTRAYQTINKVYAGLTTFTDPLFRSMADVLQGLERA |
| Ga0310909_101359101 | 3300031947 | Soil | TAGDEFAPDPRAARAYQKINKVYAGLTTFTDPLFRAMADGLQDLERT |
| Ga0308176_101960741 | 3300031996 | Soil | DPRAVRAYQQINQVYATLTSYTDPLFRAMADGLAGLDRR |
| Ga0318562_108788602 | 3300032008 | Soil | VSVSDEFTPDARAARAYQQINEVYAAVTTFTDPLFRSMADGLRGLERA |
| Ga0318569_104534241 | 3300032010 | Soil | DARAARAYQQINKIYAGLTAVTDRLFRSMAAGLAGLERA |
| Ga0318559_100523491 | 3300032039 | Soil | SRAYQKINKVYAGLTTFTDPLFRSMTDVLEGLERA |
| Ga0318549_102134432 | 3300032041 | Soil | DEFAPDPRAARAYQEIDKVYATLNAFTDPLFRSMADRLQDLEHAPGPGRG |
| Ga0318545_102164391 | 3300032042 | Soil | PDARAARAYQKINKVYAGLTSFTDPLFRSMADGLEGLERA |
| Ga0318506_101159511 | 3300032052 | Soil | VTAGDEFAPDARAARAYQKINKVYAGLTSFTDPLFRSMADGLEGLERA |
| Ga0318505_101926391 | 3300032060 | Soil | DAQAARAYQQINTVYAALTTYTDLLFRAMADGLQGLERA |
| Ga0318505_101959541 | 3300032060 | Soil | AGRAYRKINKVYAGLTGFTDPLFRFMADGLHGLERA |
| Ga0318513_100179604 | 3300032065 | Soil | DEFAPDPRAARAYQKINKVYAGLTTFTDPLFRAMADGLRDLERT |
| Ga0318514_105963092 | 3300032066 | Soil | TAAMVSPGRQFTPDPRAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0306924_104093131 | 3300032076 | Soil | AALAYEKINKVYATVTTFTDPLFRSMAAGLQGLGRA |
| Ga0306924_110447911 | 3300032076 | Soil | MVRAGDEFAPDAPAARAYQKINQVYAALTTYTDPLFRSMAAGLAGLERA |
| Ga0318525_106686201 | 3300032089 | Soil | AAAAMVTAGDEFAPDARAGRAYQQINKVYAGLTAFTDPLFRSMADGLQGLERA |
| Ga0318577_104719862 | 3300032091 | Soil | NARAYQKINKVYAGLTTFTDPLFRSMTDGLEGLERA |
| Ga0306920_1000731481 | 3300032261 | Soil | MVSVGDEFAPDARTARAYRKINQVYAALSTFTDPLFRFLADGLQGLERA |
| Ga0348332_102330122 | 3300032515 | Plant Litter | PGQQFTPDPRAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0335078_120108791 | 3300032805 | Soil | APDARAARAYQKINKVYGGLTAFADPLFRSMADGLQGLERT |
| Ga0335080_120812402 | 3300032828 | Soil | FAPDGRAARAYQQINKVYATLATFTDPLFRSMADGLHGLDRA |
| Ga0335074_100632755 | 3300032895 | Soil | DEFIPDTQAAGAYQQINKVYATLTTFTDPLFRSMFDGLQGLERG |
| Ga0335074_104085512 | 3300032895 | Soil | EFAPDPRAADAYQKINQVYAGLTAYTDPLFRSMAEGLQGLDRA |
| Ga0335074_115948991 | 3300032895 | Soil | VSPGRQFTPDPGAVRAYQQINQVYASLASHTDPLFRALADGLAGLDRT |
| Ga0335075_110691413 | 3300032896 | Soil | AARAYQKINKVYAGLTSFTDPLFRSMADGLDGLNRAP |
| Ga0335083_107009162 | 3300032954 | Soil | DPQAARAYQQINQVYATLTSHTDPLFRSMADGLAGLDRT |
| Ga0335073_112734081 | 3300033134 | Soil | AVGDEFTPGTKAARAYQKINTVYAALTSFTDPLFRSMAEGLEGLERA |
| Ga0310914_101125444 | 3300033289 | Soil | FGPDARAGRAYRKINKVYAGLTGFTDPLFRFMADGLHGLERA |
| Ga0310914_102374061 | 3300033289 | Soil | DKRNSRAYQKINKVYAGLTTFTDPLFRSMTDVLEGLERA |
| Ga0310914_109676782 | 3300033289 | Soil | APDAPAARAYEKINKVYAALTTFTDPLFRSMAAGLAGLERA |
| Ga0318519_109185042 | 3300033290 | Soil | DWGQAAAAMVTAGDEFAPDARAGRAYQQINKVYAGLTAFTDPLFRSMADGLQGLERA |
| Ga0370483_0073472_2_109 | 3300034124 | Untreated Peat Soil | ARAYQQINQVYATLTSHTDLLFRSMADGLAGLDRT |
| ⦗Top⦘ |