| Basic Information | |
|---|---|
| Family ID | F020275 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 225 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQEAR |
| Number of Associated Samples | 177 |
| Number of Associated Scaffolds | 225 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.33 % |
| % of genes near scaffold ends (potentially truncated) | 98.67 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (42.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 225 Family Scaffolds |
|---|---|---|
| PF12680 | SnoaL_2 | 5.33 |
| PF00465 | Fe-ADH | 2.22 |
| PF00126 | HTH_1 | 2.22 |
| PF01814 | Hemerythrin | 2.22 |
| PF00378 | ECH_1 | 1.78 |
| PF10604 | Polyketide_cyc2 | 1.78 |
| PF02274 | ADI | 1.78 |
| PF08327 | AHSA1 | 1.78 |
| PF13845 | Septum_form | 1.78 |
| PF00571 | CBS | 1.78 |
| PF01177 | Asp_Glu_race | 1.78 |
| PF04343 | DUF488 | 1.33 |
| PF01636 | APH | 1.33 |
| PF07690 | MFS_1 | 1.33 |
| PF01548 | DEDD_Tnp_IS110 | 0.89 |
| PF07885 | Ion_trans_2 | 0.89 |
| PF08044 | DUF1707 | 0.89 |
| PF01381 | HTH_3 | 0.89 |
| PF13560 | HTH_31 | 0.89 |
| PF05988 | DUF899 | 0.89 |
| PF01717 | Meth_synt_2 | 0.89 |
| PF04978 | DUF664 | 0.44 |
| PF00144 | Beta-lactamase | 0.44 |
| PF01638 | HxlR | 0.44 |
| PF00004 | AAA | 0.44 |
| PF13463 | HTH_27 | 0.44 |
| PF04672 | Methyltransf_19 | 0.44 |
| PF01799 | Fer2_2 | 0.44 |
| PF13520 | AA_permease_2 | 0.44 |
| PF01255 | Prenyltransf | 0.44 |
| PF11139 | SfLAP | 0.44 |
| PF02659 | Mntp | 0.44 |
| PF01872 | RibD_C | 0.44 |
| PF09851 | SHOCT | 0.44 |
| PF13622 | 4HBT_3 | 0.44 |
| PF02861 | Clp_N | 0.44 |
| PF01568 | Molydop_binding | 0.44 |
| PF13365 | Trypsin_2 | 0.44 |
| PF09587 | PGA_cap | 0.44 |
| PF08281 | Sigma70_r4_2 | 0.44 |
| PF13191 | AAA_16 | 0.44 |
| PF00891 | Methyltransf_2 | 0.44 |
| PF13091 | PLDc_2 | 0.44 |
| PF00196 | GerE | 0.44 |
| PF00873 | ACR_tran | 0.44 |
| PF01436 | NHL | 0.44 |
| PF06325 | PrmA | 0.44 |
| PF13359 | DDE_Tnp_4 | 0.44 |
| PF06736 | TMEM175 | 0.44 |
| PF00005 | ABC_tran | 0.44 |
| PF07859 | Abhydrolase_3 | 0.44 |
| PF01243 | Putative_PNPOx | 0.44 |
| PF00027 | cNMP_binding | 0.44 |
| PF00486 | Trans_reg_C | 0.44 |
| PF13207 | AAA_17 | 0.44 |
| PF13302 | Acetyltransf_3 | 0.44 |
| PF04972 | BON | 0.44 |
| PF01906 | YbjQ_1 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
|---|---|---|---|
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 2.22 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 2.22 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 2.22 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 2.22 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 1.78 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 1.78 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 1.78 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 1.33 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.89 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.89 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.89 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.44 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.44 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.44 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.44 |
| COG1971 | Putative Mn2+ efflux pump MntP | Inorganic ion transport and metabolism [P] | 0.44 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.44 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.44 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.44 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.44 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.44 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.44 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003368|JGI26340J50214_10166910 | Not Available | 548 | Open in IMG/M |
| 3300005175|Ga0066673_10882383 | Not Available | 509 | Open in IMG/M |
| 3300005337|Ga0070682_101617589 | Not Available | 560 | Open in IMG/M |
| 3300005355|Ga0070671_100957342 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005435|Ga0070714_101915262 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005436|Ga0070713_100773373 | Not Available | 919 | Open in IMG/M |
| 3300005437|Ga0070710_10279627 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005439|Ga0070711_100327623 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300005467|Ga0070706_101190971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis | 700 | Open in IMG/M |
| 3300005544|Ga0070686_100437098 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300005548|Ga0070665_100345956 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300005614|Ga0068856_100408532 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300005614|Ga0068856_100747614 | Not Available | 998 | Open in IMG/M |
| 3300005764|Ga0066903_104204441 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005764|Ga0066903_105121030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300005764|Ga0066903_106417952 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005764|Ga0066903_108583535 | Not Available | 520 | Open in IMG/M |
| 3300005841|Ga0068863_100769088 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300006028|Ga0070717_11046146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 743 | Open in IMG/M |
| 3300006028|Ga0070717_11714387 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006059|Ga0075017_100974306 | Not Available | 660 | Open in IMG/M |
| 3300006086|Ga0075019_11027615 | Not Available | 533 | Open in IMG/M |
| 3300006163|Ga0070715_10037168 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300006175|Ga0070712_100679493 | Not Available | 876 | Open in IMG/M |
| 3300006175|Ga0070712_100970876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 734 | Open in IMG/M |
| 3300006175|Ga0070712_101518071 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006176|Ga0070765_101495195 | Not Available | 636 | Open in IMG/M |
| 3300006804|Ga0079221_11293170 | Not Available | 573 | Open in IMG/M |
| 3300006806|Ga0079220_11401728 | Not Available | 593 | Open in IMG/M |
| 3300006852|Ga0075433_11269438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300006854|Ga0075425_101713601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300009012|Ga0066710_102550662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300009093|Ga0105240_10175902 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300009156|Ga0111538_12852239 | Not Available | 605 | Open in IMG/M |
| 3300009522|Ga0116218_1211446 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300009545|Ga0105237_11015299 | Not Available | 836 | Open in IMG/M |
| 3300009553|Ga0105249_12605391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300009672|Ga0116215_1041793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2094 | Open in IMG/M |
| 3300010043|Ga0126380_10043304 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
| 3300010046|Ga0126384_10103971 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300010048|Ga0126373_10079750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2980 | Open in IMG/M |
| 3300010048|Ga0126373_10318434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1557 | Open in IMG/M |
| 3300010358|Ga0126370_10584874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 961 | Open in IMG/M |
| 3300010366|Ga0126379_13405964 | Not Available | 533 | Open in IMG/M |
| 3300010371|Ga0134125_10637433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
| 3300010371|Ga0134125_12158826 | Not Available | 606 | Open in IMG/M |
| 3300010371|Ga0134125_12782011 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010376|Ga0126381_102519512 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010376|Ga0126381_103458330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300010396|Ga0134126_10650122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1202 | Open in IMG/M |
| 3300010397|Ga0134124_10057025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3298 | Open in IMG/M |
| 3300010398|Ga0126383_12167505 | Not Available | 642 | Open in IMG/M |
| 3300010401|Ga0134121_12091364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300010876|Ga0126361_10264649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1889 | Open in IMG/M |
| 3300012200|Ga0137382_11303111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300012212|Ga0150985_115672062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 727 | Open in IMG/M |
| 3300012469|Ga0150984_107138623 | Not Available | 600 | Open in IMG/M |
| 3300012498|Ga0157345_1053771 | Not Available | 519 | Open in IMG/M |
| 3300012948|Ga0126375_10464743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 933 | Open in IMG/M |
| 3300013307|Ga0157372_11253412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 856 | Open in IMG/M |
| 3300014164|Ga0181532_10238417 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300015372|Ga0132256_100709299 | Not Available | 1122 | Open in IMG/M |
| 3300015374|Ga0132255_101327894 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300016294|Ga0182041_10489641 | Not Available | 1064 | Open in IMG/M |
| 3300016294|Ga0182041_12268286 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300016341|Ga0182035_10225063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1499 | Open in IMG/M |
| 3300016341|Ga0182035_12137389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300016422|Ga0182039_10448115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1105 | Open in IMG/M |
| 3300016445|Ga0182038_10767235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300016445|Ga0182038_11168419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 685 | Open in IMG/M |
| 3300017926|Ga0187807_1042511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1407 | Open in IMG/M |
| 3300017926|Ga0187807_1055884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1224 | Open in IMG/M |
| 3300017942|Ga0187808_10471009 | Not Available | 580 | Open in IMG/M |
| 3300017946|Ga0187879_10377832 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300017959|Ga0187779_10270078 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300017959|Ga0187779_10490116 | Not Available | 812 | Open in IMG/M |
| 3300017973|Ga0187780_10324012 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300017974|Ga0187777_10953697 | Not Available | 619 | Open in IMG/M |
| 3300017975|Ga0187782_10620392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
| 3300017993|Ga0187823_10056493 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300018007|Ga0187805_10152685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1050 | Open in IMG/M |
| 3300018037|Ga0187883_10649247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300018481|Ga0190271_11092587 | Not Available | 921 | Open in IMG/M |
| 3300019269|Ga0184644_1332781 | Not Available | 528 | Open in IMG/M |
| 3300020581|Ga0210399_10627114 | Not Available | 888 | Open in IMG/M |
| 3300020583|Ga0210401_10724364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 855 | Open in IMG/M |
| 3300021374|Ga0213881_10244845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300021403|Ga0210397_11585845 | Not Available | 508 | Open in IMG/M |
| 3300021404|Ga0210389_10967374 | Not Available | 661 | Open in IMG/M |
| 3300021405|Ga0210387_10639860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 944 | Open in IMG/M |
| 3300021475|Ga0210392_11100947 | Not Available | 595 | Open in IMG/M |
| 3300021478|Ga0210402_11132506 | Not Available | 710 | Open in IMG/M |
| 3300021560|Ga0126371_10436139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1455 | Open in IMG/M |
| 3300021560|Ga0126371_13061633 | Not Available | 566 | Open in IMG/M |
| 3300025905|Ga0207685_10436040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300025911|Ga0207654_10745001 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300025915|Ga0207693_10255295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1375 | Open in IMG/M |
| 3300025915|Ga0207693_10400482 | Not Available | 1073 | Open in IMG/M |
| 3300025915|Ga0207693_10747117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
| 3300025915|Ga0207693_11142934 | Not Available | 590 | Open in IMG/M |
| 3300025915|Ga0207693_11330919 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025915|Ga0207693_11407114 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300025922|Ga0207646_10046305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3902 | Open in IMG/M |
| 3300025928|Ga0207700_11960416 | Not Available | 512 | Open in IMG/M |
| 3300025929|Ga0207664_10100343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2390 | Open in IMG/M |
| 3300025945|Ga0207679_10335164 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300025945|Ga0207679_11918651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300025949|Ga0207667_11449868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300026121|Ga0207683_11423156 | Not Available | 641 | Open in IMG/M |
| 3300026377|Ga0257171_1078249 | Not Available | 582 | Open in IMG/M |
| 3300027045|Ga0207726_1043229 | Not Available | 614 | Open in IMG/M |
| 3300027310|Ga0207983_1036677 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300027824|Ga0209040_10094554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1702 | Open in IMG/M |
| 3300027873|Ga0209814_10153940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
| 3300027898|Ga0209067_10478437 | Not Available | 705 | Open in IMG/M |
| 3300027908|Ga0209006_10442937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300028716|Ga0307311_10051095 | Not Available | 1099 | Open in IMG/M |
| 3300029992|Ga0302276_10424254 | Not Available | 543 | Open in IMG/M |
| 3300030007|Ga0311338_10660298 | Not Available | 1064 | Open in IMG/M |
| 3300030056|Ga0302181_10157850 | Not Available | 1078 | Open in IMG/M |
| 3300030494|Ga0310037_10071922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1625 | Open in IMG/M |
| 3300030580|Ga0311355_10622348 | Not Available | 1015 | Open in IMG/M |
| 3300030659|Ga0316363_10386933 | Not Available | 545 | Open in IMG/M |
| 3300030677|Ga0302317_10470205 | Not Available | 549 | Open in IMG/M |
| 3300030706|Ga0310039_10091490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1282 | Open in IMG/M |
| 3300031234|Ga0302325_10414057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2091 | Open in IMG/M |
| 3300031234|Ga0302325_11079874 | Not Available | 1084 | Open in IMG/M |
| 3300031543|Ga0318516_10894872 | Not Available | 500 | Open in IMG/M |
| 3300031544|Ga0318534_10282884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 955 | Open in IMG/M |
| 3300031546|Ga0318538_10006591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 4531 | Open in IMG/M |
| 3300031549|Ga0318571_10037571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1385 | Open in IMG/M |
| 3300031561|Ga0318528_10273695 | Not Available | 906 | Open in IMG/M |
| 3300031564|Ga0318573_10501810 | Not Available | 653 | Open in IMG/M |
| 3300031564|Ga0318573_10676290 | Not Available | 555 | Open in IMG/M |
| 3300031573|Ga0310915_10851476 | Not Available | 640 | Open in IMG/M |
| 3300031640|Ga0318555_10383712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
| 3300031640|Ga0318555_10572574 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031680|Ga0318574_10958431 | Not Available | 501 | Open in IMG/M |
| 3300031681|Ga0318572_10320975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
| 3300031713|Ga0318496_10143456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1301 | Open in IMG/M |
| 3300031713|Ga0318496_10402862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
| 3300031723|Ga0318493_10386472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300031747|Ga0318502_10913100 | Not Available | 534 | Open in IMG/M |
| 3300031748|Ga0318492_10248020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 919 | Open in IMG/M |
| 3300031751|Ga0318494_10835974 | Not Available | 539 | Open in IMG/M |
| 3300031753|Ga0307477_10647856 | Not Available | 710 | Open in IMG/M |
| 3300031754|Ga0307475_10621928 | Not Available | 864 | Open in IMG/M |
| 3300031764|Ga0318535_10176191 | Not Available | 956 | Open in IMG/M |
| 3300031765|Ga0318554_10010738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4553 | Open in IMG/M |
| 3300031765|Ga0318554_10181669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1197 | Open in IMG/M |
| 3300031770|Ga0318521_10099350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1599 | Open in IMG/M |
| 3300031771|Ga0318546_10754264 | Not Available | 685 | Open in IMG/M |
| 3300031777|Ga0318543_10121246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
| 3300031777|Ga0318543_10148738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1028 | Open in IMG/M |
| 3300031777|Ga0318543_10217101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300031778|Ga0318498_10224249 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031779|Ga0318566_10059059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1836 | Open in IMG/M |
| 3300031779|Ga0318566_10538084 | Not Available | 571 | Open in IMG/M |
| 3300031781|Ga0318547_10674962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300031782|Ga0318552_10513929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300031792|Ga0318529_10445024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300031797|Ga0318550_10288912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
| 3300031797|Ga0318550_10473306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300031797|Ga0318550_10621088 | Not Available | 519 | Open in IMG/M |
| 3300031799|Ga0318565_10492441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300031805|Ga0318497_10859041 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031819|Ga0318568_10262297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1071 | Open in IMG/M |
| 3300031819|Ga0318568_10631238 | Not Available | 667 | Open in IMG/M |
| 3300031819|Ga0318568_11037820 | Not Available | 506 | Open in IMG/M |
| 3300031821|Ga0318567_10526501 | Not Available | 671 | Open in IMG/M |
| 3300031832|Ga0318499_10138362 | Not Available | 949 | Open in IMG/M |
| 3300031833|Ga0310917_10385246 | Not Available | 953 | Open in IMG/M |
| 3300031845|Ga0318511_10041247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1815 | Open in IMG/M |
| 3300031845|Ga0318511_10552254 | Not Available | 535 | Open in IMG/M |
| 3300031846|Ga0318512_10243180 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031846|Ga0318512_10593977 | Not Available | 564 | Open in IMG/M |
| 3300031859|Ga0318527_10175666 | Not Available | 903 | Open in IMG/M |
| 3300031860|Ga0318495_10550463 | Not Available | 501 | Open in IMG/M |
| 3300031879|Ga0306919_10191444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1515 | Open in IMG/M |
| 3300031896|Ga0318551_10652890 | Not Available | 608 | Open in IMG/M |
| 3300031910|Ga0306923_10135554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2803 | Open in IMG/M |
| 3300031910|Ga0306923_11871185 | Not Available | 614 | Open in IMG/M |
| 3300031912|Ga0306921_10314257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1833 | Open in IMG/M |
| 3300031941|Ga0310912_10098932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2146 | Open in IMG/M |
| 3300031946|Ga0310910_11428639 | Not Available | 532 | Open in IMG/M |
| 3300031954|Ga0306926_10761041 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300031981|Ga0318531_10536834 | Not Available | 530 | Open in IMG/M |
| 3300032002|Ga0307416_103077960 | Not Available | 558 | Open in IMG/M |
| 3300032008|Ga0318562_10081874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1813 | Open in IMG/M |
| 3300032009|Ga0318563_10398907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300032042|Ga0318545_10171753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
| 3300032043|Ga0318556_10352989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
| 3300032043|Ga0318556_10447329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
| 3300032043|Ga0318556_10526504 | Not Available | 618 | Open in IMG/M |
| 3300032044|Ga0318558_10383164 | Not Available | 699 | Open in IMG/M |
| 3300032054|Ga0318570_10568884 | Not Available | 517 | Open in IMG/M |
| 3300032055|Ga0318575_10267594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
| 3300032055|Ga0318575_10318282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 787 | Open in IMG/M |
| 3300032060|Ga0318505_10478288 | Not Available | 588 | Open in IMG/M |
| 3300032065|Ga0318513_10058641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1738 | Open in IMG/M |
| 3300032068|Ga0318553_10122149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1339 | Open in IMG/M |
| 3300032089|Ga0318525_10140394 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300032089|Ga0318525_10517985 | Not Available | 610 | Open in IMG/M |
| 3300032089|Ga0318525_10651577 | Not Available | 536 | Open in IMG/M |
| 3300032090|Ga0318518_10343972 | Not Available | 765 | Open in IMG/M |
| 3300032094|Ga0318540_10267708 | Not Available | 825 | Open in IMG/M |
| 3300032094|Ga0318540_10431867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix | 636 | Open in IMG/M |
| 3300032126|Ga0307415_100984724 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300032160|Ga0311301_11547003 | Not Available | 812 | Open in IMG/M |
| 3300032261|Ga0306920_101768412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300032261|Ga0306920_101817629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 859 | Open in IMG/M |
| 3300032782|Ga0335082_10124288 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
| 3300032782|Ga0335082_11104546 | Not Available | 659 | Open in IMG/M |
| 3300032805|Ga0335078_11030027 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300032805|Ga0335078_11280829 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300032828|Ga0335080_12340879 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032829|Ga0335070_10506882 | Not Available | 1143 | Open in IMG/M |
| 3300032892|Ga0335081_12481051 | Not Available | 536 | Open in IMG/M |
| 3300032893|Ga0335069_10502770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1405 | Open in IMG/M |
| 3300032893|Ga0335069_11443676 | Not Available | 743 | Open in IMG/M |
| 3300032895|Ga0335074_10749607 | Not Available | 926 | Open in IMG/M |
| 3300033134|Ga0335073_10489858 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300033290|Ga0318519_10742420 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300033475|Ga0310811_10988958 | Not Available | 739 | Open in IMG/M |
| 3300034819|Ga0373958_0059423 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.22% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.44% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.44% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26340J50214_101669101 | 3300003368 | Bog Forest Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQEAR |
| Ga0066673_108823831 | 3300005175 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARTLAADEVAARIR |
| Ga0070682_1016175891 | 3300005337 | Corn Rhizosphere | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALAADEVAAQIRAEVSRQ |
| Ga0070671_1009573421 | 3300005355 | Switchgrass Rhizosphere | MSEGDTVSDIDRLEAAAGECREMIREAHAATKDLRAAVREAKTEL |
| Ga0070714_1019152622 | 3300005435 | Agricultural Soil | VSDLDRLEAAAGECREMIREAHAATKDLRAAVREAKTELHALT |
| Ga0070713_1007733732 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAVSECREMIREAHAATKDLRAAVREARQEARAL |
| Ga0070710_102796271 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARAL |
| Ga0070711_1003276232 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAVSECREVIRDAHAATKDLRAAVREAKRELQDLA |
| Ga0070706_1011909711 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAALSECREMIREAHAATKDLRAAVREARQELRAMARDEVAAQIQLE |
| Ga0070686_1004370982 | 3300005544 | Switchgrass Rhizosphere | VSDIDRLEAAAGECREMIREAHAATKDLRAAVREAKTELHA |
| Ga0070665_1003459562 | 3300005548 | Switchgrass Rhizosphere | VSELDRLEAAMSECREMIRAAHAATKDLRAAVREARQEARTLAADEVAAQIRA* |
| Ga0068856_1004085321 | 3300005614 | Corn Rhizosphere | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALAADEVA |
| Ga0068856_1007476143 | 3300005614 | Corn Rhizosphere | VSELDRLEAAASECREMIREAHAATKDLRAAVREAKRELQE |
| Ga0066903_1042044412 | 3300005764 | Tropical Forest Soil | MSEEAAVSEADRLEAAVAECREMIREAHAATKDLRTAV |
| Ga0066903_1051210302 | 3300005764 | Tropical Forest Soil | MSEEAAVSELDRLEAAVGECREMIREAHAATKDLRTA |
| Ga0066903_1064179521 | 3300005764 | Tropical Forest Soil | VSELDRLEAAAGECREMIREAHAATKDLRAAVREAKRELQDLTKDEVAAHIQ |
| Ga0066903_1085835352 | 3300005764 | Tropical Forest Soil | MSDLDRLEAAAGECREMIREAHAATKDLRAAVREAKTELH |
| Ga0068863_1007690882 | 3300005841 | Switchgrass Rhizosphere | MSEVDRLEAAISECREMIREAHAATKDLRTAVREAKKELRELAKDEVA |
| Ga0070717_110461462 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARA |
| Ga0070717_117143872 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDIDRLEAAAGECREMIREAHAATKDLRAAVREAKTELHALT |
| Ga0075017_1009743061 | 3300006059 | Watersheds | VSEMDRLEAAMAECREMIREAHAATKDLRAAVREARQESRTLA |
| Ga0075019_110276152 | 3300006086 | Watersheds | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQEARALAADEVAAHTHPRCPGSWRSWAS |
| Ga0070715_100371681 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEEAAVSELDRLEAATGECREMIREAHAATKDLRAAVRDAKRELQDLAKDEVAA |
| Ga0070712_1006794931 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAVSECREMIREAHAATKDLRAAVREARQEARALAADEVA |
| Ga0070712_1009708761 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEAR |
| Ga0070712_1015180712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDLDRLEAAAGECREMIREAHAATKDLRAAVREAKTELHALTRD |
| Ga0070765_1014951952 | 3300006176 | Soil | VSELDRLEAALGECREMIREAHAATKDLRAAVREA |
| Ga0079221_112931701 | 3300006804 | Agricultural Soil | VSELDRLEAAVSECREVIREAHAATKDLRAAVREAKRELQDLAK |
| Ga0079220_114017282 | 3300006806 | Agricultural Soil | MSEVDRLEAAMNECREMVREAHAATKDLRAAVREAKQELRALARDEVAAQI |
| Ga0075433_112694381 | 3300006852 | Populus Rhizosphere | MSELDRLEAAVGECREMVREAHAATKDLRAAVREAKKEVQ |
| Ga0075425_1017136011 | 3300006854 | Populus Rhizosphere | MSEVDRLEAAMNECREMVREAHAATKDLRAAVREAKQELRALARDEV |
| Ga0066710_1025506622 | 3300009012 | Grasslands Soil | MSELDRLEAAVGECREMVREAHAATKDLRAAVREAKKEVQA |
| Ga0105240_101759024 | 3300009093 | Corn Rhizosphere | MSEVDRLEAAISECREMIREAHAATKDLRTAVREAKKELRELAKDEVAG |
| Ga0111538_128522392 | 3300009156 | Populus Rhizosphere | MSDLDRLEAAISECREMIREAHAATKDLRTAVREAKKELRELTKDEVAG |
| Ga0116218_12114462 | 3300009522 | Peatlands Soil | VSELDRLEAAMAECREMIREAHAATKDLRAAVREARQESRTLA |
| Ga0105237_110152992 | 3300009545 | Corn Rhizosphere | MSDLDRLEAAISECREMIREAHAATKDLRTRCARQR |
| Ga0105249_126053911 | 3300009553 | Switchgrass Rhizosphere | VSKPDRLEAAASDCRGMIREAHAATKDLRAAVREAKRE |
| Ga0116215_10417933 | 3300009672 | Peatlands Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREAKQ |
| Ga0126380_100433041 | 3300010043 | Tropical Forest Soil | VSELDRLEAAAGECREMIREAHAATKDLRAAVREAKAELHA |
| Ga0126384_101039713 | 3300010046 | Tropical Forest Soil | MSEGDAVSDLDRLEAAAGECREMIREAHAATKDLRAAV |
| Ga0126373_100797506 | 3300010048 | Tropical Forest Soil | VSELDRLEVAVGECREMIREAHAATKDLRSAVREAKGELRALAKD |
| Ga0126373_103184343 | 3300010048 | Tropical Forest Soil | VSELERLEVAVGECREMIREAHAATKDLRSAVREAKGELRALTKDEVAAQ |
| Ga0126370_105848742 | 3300010358 | Tropical Forest Soil | MSEEAAVSELDRLEAAVGECREMIREAHAATKDLRTAVREAKRELHELAKD |
| Ga0126379_134059642 | 3300010366 | Tropical Forest Soil | MSEEAAVSELDRLEAAVGECREMIREAHAATKDLRAAVRDAKREMQDLAK |
| Ga0134125_106374333 | 3300010371 | Terrestrial Soil | VSELDRLEEAVSECREMIREAHAATKDLRAAVREAKRELQDLAKDEVA |
| Ga0134125_121588261 | 3300010371 | Terrestrial Soil | VPVREEDAVSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEMRVLAAAEVA |
| Ga0134125_127820112 | 3300010371 | Terrestrial Soil | MSEGDTVSDIDRLEAAAGECREMIREAHAATKDLRAAVR |
| Ga0126381_1025195121 | 3300010376 | Tropical Forest Soil | VSDVDRLEAAVSECREMIREAHAATKDLRAAVREARQ |
| Ga0126381_1034583301 | 3300010376 | Tropical Forest Soil | VSEEAAVSELDRLEAAVGECREMIREAHAATKDLRAAVRDAKRELQDLARDEV |
| Ga0134126_106501221 | 3300010396 | Terrestrial Soil | MSEVDRLEAAMNECREMVREAHAATKDLRAAVREAKQEL |
| Ga0134124_100570251 | 3300010397 | Terrestrial Soil | VSDIDRLEAAAGECREMIREAHAATKDLRAAVREAKTELHALTRDEV |
| Ga0126383_121675052 | 3300010398 | Tropical Forest Soil | MSEGDAMSDLDRLEAAAGECREMIREAHAATKDLRAAVR |
| Ga0134121_120913642 | 3300010401 | Terrestrial Soil | VSELDRLEAAASECREMIREAHAATKDLRAAVREAKRELQELGKDE |
| Ga0126361_102646491 | 3300010876 | Boreal Forest Soil | VSEVDRLEAAVGECREMIREAHAATKDLRTAVREAKKEMSALARDEV |
| Ga0137382_113031111 | 3300012200 | Vadose Zone Soil | MSELDRLEAAVGECREMVREAHAATKDLRAAVREAKKEVQALAKDEVAAHIQ |
| Ga0150985_1156720622 | 3300012212 | Avena Fatua Rhizosphere | MSDLDRLEAAMSECREMIREAHAATKDLRTAVREAKKELRELTKD |
| Ga0150984_1071386231 | 3300012469 | Avena Fatua Rhizosphere | MSDLDRLEAAMSECREMIREAHAATKDLRTAVREAKKELRELTKDEV |
| Ga0157345_10537712 | 3300012498 | Arabidopsis Rhizosphere | MSDLDRLEAAISECREMIREAHAATKDLRTAVREAK* |
| Ga0126375_104647433 | 3300012948 | Tropical Forest Soil | MSEGDAVSELDRLEAAAGECREMIREAHAATKDLRAAV |
| Ga0157372_112534122 | 3300013307 | Corn Rhizosphere | VSELDRLEAAAGECRELIREAHAATKDLRAAVREA |
| Ga0181532_102384171 | 3300014164 | Bog | VSELDRLEAAMAECREMIREAHAATKDLRTAVREAKQELRGLAHDEVAAHIQVE |
| Ga0132256_1007092991 | 3300015372 | Arabidopsis Rhizosphere | MSDLDRLEAAISECREMIREAHAATKDLRTAVREAKKE |
| Ga0132255_1013278942 | 3300015374 | Arabidopsis Rhizosphere | MSEVGRLEAAISECREMIREAHAATKDLRTAVREAK |
| Ga0182041_104896412 | 3300016294 | Soil | VSELDRLEAAMSECRAMIREAHAATKDLRAAVREARQEARALAADEVA |
| Ga0182041_122682861 | 3300016294 | Soil | MSEEAAVSELDRLEAAAGECREMIREAHAATKDLRAA |
| Ga0182035_102250631 | 3300016341 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEVRALTKDEV |
| Ga0182035_121373891 | 3300016341 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALAADEVATQIQAEVSRQ |
| Ga0182039_104481152 | 3300016422 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVRDAKREL |
| Ga0182038_107672352 | 3300016445 | Soil | MSEADRLEAAISECREMIREAHAATKDLRSAVREAKSEMHALAKDEVAAQV |
| Ga0182038_111684192 | 3300016445 | Soil | VSELDRLAAAADECREMIREAHAATKDLRAAVREAKRELQDLAKDEVG |
| Ga0187807_10425111 | 3300017926 | Freshwater Sediment | VSELDRLEAALGECREMIREAHAATKDLRAAVREAKQEVRALATDEVA |
| Ga0187807_10558842 | 3300017926 | Freshwater Sediment | VLESEEDAVSELDRLEAAMTECREMIREAHAATKDLRAAVREAKQEVRALATDE |
| Ga0187808_104710093 | 3300017942 | Freshwater Sediment | VSDLDRLEAAVGECREMIREAHAATKDLRAAVREAKQELRTLAND |
| Ga0187879_103778322 | 3300017946 | Peatland | VSELDRLEAAMAECREMIREAHAATKDLRAAVREAK |
| Ga0187779_102700783 | 3300017959 | Tropical Peatland | VSELDRLEAAVSECREMIREAHAATKDLRVAVREAKQEVRALTQDE |
| Ga0187779_104901161 | 3300017959 | Tropical Peatland | VSEVDRLEAAISECREVIREAHAATKDLRAAVREAKQEMRALATDEVAATIRAEVS |
| Ga0187780_103240121 | 3300017973 | Tropical Peatland | MSELDRLEAALGECREMIREAHAATKDLRAAVREAKQEVRALATDE |
| Ga0187777_109536972 | 3300017974 | Tropical Peatland | MTGTLTSEEDAVSERDRLEAAIAECREMMREAHAATKDLRTAVREAKSTATT |
| Ga0187782_106203921 | 3300017975 | Tropical Peatland | VSELDRLEAAVAECREMIREAHAATKDLRTAVREAKQEIRTLTQDEVAAQV |
| Ga0187823_100564932 | 3300017993 | Freshwater Sediment | VSELDRLEAAMSECREMIREAHAATKDLRAAVREA |
| Ga0187805_101526852 | 3300018007 | Freshwater Sediment | VSELDRLEAALGECREMIREAHAATKDLRAAVREAKQEV |
| Ga0187883_106492472 | 3300018037 | Peatland | VSDIDRLEEAVSECREMIREAHAATKDLRAAVREAKKELSVMAKDEVAARIQLE |
| Ga0190271_110925872 | 3300018481 | Soil | MSDLDRLEAAISECREMIREAHAATKDLRTAVREAK |
| Ga0184644_13327811 | 3300019269 | Groundwater Sediment | MSDLDRLEAAISECREMIREAHAATKDLRIAVREAKKELQELTKEEV |
| Ga0210399_106271141 | 3300020581 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEA |
| Ga0210401_107243643 | 3300020583 | Soil | MSELDRLEAAMNECREMVREAHAATKDLRAAVREARQELRAL |
| Ga0213881_102448451 | 3300021374 | Exposed Rock | VSELDRLQAAMSECREMIREAHAATKDLRAAVREA |
| Ga0210397_115858451 | 3300021403 | Soil | MAWPASEEGAVSELDRLQAAMNECRETIREAHAATKDLRAAVREARQELRVLARDEVAAQ |
| Ga0210389_109673741 | 3300021404 | Soil | MSELDRMEAAMNECREMVREAHAATKDLRAAVREARQELR |
| Ga0210387_106398603 | 3300021405 | Soil | MSELDRLEAAMNECREMVREAHAATKDLRAAVREA |
| Ga0210392_111009471 | 3300021475 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALAADEVAAQIR |
| Ga0210402_111325061 | 3300021478 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEVRVLAT |
| Ga0126371_104361394 | 3300021560 | Tropical Forest Soil | VSDLDRLEAAISECREMIREAHAATKDLRAAVREARQE |
| Ga0126371_130616331 | 3300021560 | Tropical Forest Soil | VSELDRLEAALGECREMIREAHAATKDLRAAVREARQEVRDLA |
| Ga0207685_104360401 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAATGECREMIREAHAATKDLRAAVRDAKRELQDLAK |
| Ga0207654_107450012 | 3300025911 | Corn Rhizosphere | MSEVDRLEAAISECREMIREAHAATKDLRTAVREA |
| Ga0207693_102552953 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEADRLEAAVAECREMIREAHAATKDLRTAVRDAKRELQDL |
| Ga0207693_104004821 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEGDAVSDLDRLEAAVGECREMIREAHAATKDLRTAVREAKS |
| Ga0207693_107471172 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAVSECREIIREAHAATKDLRAAVREAKRELQDLAK |
| Ga0207693_111429341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAIGECREMIREAHAATKDLRAAVREAKRELQDLAKDEVAAHI |
| Ga0207693_113309192 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDLDRLEAAAGECREMIREAHAATKDLRAAVREAK |
| Ga0207693_114071141 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDIDRLEAAAGECREMIREAHAATKDLRAAVREAK |
| Ga0207646_100463051 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEVAVGECREMIREAHAATKDLRSAVREAKGELRALAKDEIAAQ |
| Ga0207700_119604161 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSELDRLEAAVSECREMIREAHAATKDLRAAVREARQEARA |
| Ga0207664_101003431 | 3300025929 | Agricultural Soil | MSKGDAVSDLDRLEAAAGECREMIREAHAATKDLRAAVREAKTELHALT |
| Ga0207679_103351642 | 3300025945 | Corn Rhizosphere | VSELDRLEAAMSECREMIRDAHAATKDLRAAVREAR |
| Ga0207679_119186511 | 3300025945 | Corn Rhizosphere | MSEVDRLEAAMNECREMVREAHAATKDLRAAVREAKQEVRTLGRDEVAA |
| Ga0207667_114498681 | 3300025949 | Corn Rhizosphere | MSELDRLEAAVGECREMVREAHAATKDLRAAVREAKKEVQALAKDE |
| Ga0207683_114231561 | 3300026121 | Miscanthus Rhizosphere | LRGEEAAVSELDRLEAAAGECREMIRDAHAATKDLR |
| Ga0257171_10782491 | 3300026377 | Soil | VSELDRLEAAIGECREMIREAHAATKDLRAAVREAKRETQDL |
| Ga0207726_10432291 | 3300027045 | Tropical Forest Soil | VSEQDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALATDEVAA |
| Ga0207983_10366772 | 3300027310 | Soil | MSEVDRLEAAISECREMIREAHAATKDLRTAVREAKKELRELATD |
| Ga0209040_100945541 | 3300027824 | Bog Forest Soil | VSELDRLEAALGECREMIREAHAATKDLRAAVREAKQEVRA |
| Ga0209814_101539403 | 3300027873 | Populus Rhizosphere | MSELDRLEAAVGECREMVREAHAATKDLRAAVREAKKEVQALAKDEVAT |
| Ga0209067_104784371 | 3300027898 | Watersheds | VSEMDRLEAAMAECREMIREAHAATKDLRAAVREARQESRTLAQDEVA |
| Ga0209006_104429371 | 3300027908 | Forest Soil | MSELDRLEAAMNECREMIREAHAATKDLRAAAREARQELRALARDE |
| Ga0307311_100510952 | 3300028716 | Soil | VTEADRLEAAIGECREMLREAHAATKDLRAAVREAKRELQ |
| Ga0302276_104242542 | 3300029992 | Bog | VSDLDKLEAAVSECREMIREAHAATKDLRASVREARQEVRALAKDEVTAQVQ |
| Ga0311338_106602983 | 3300030007 | Palsa | VSDLDKLEAAVSECREMIREAHAATKDLRAAVREAR |
| Ga0302181_101578503 | 3300030056 | Palsa | VSDLDRLEAAVSECREMIREAHAATKDLRAAVREARQE |
| Ga0310037_100719222 | 3300030494 | Peatlands Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREAKQE |
| Ga0311355_106223483 | 3300030580 | Palsa | VSDLDKLEAAVSECREMIREAHAATKDLRAAVREARQE |
| Ga0316363_103869332 | 3300030659 | Peatlands Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREARQESRALAQEEV |
| Ga0302317_104702052 | 3300030677 | Palsa | VSDLDKLEAAVSECREMIREAHAATKDLRAAVREARQEVRALAKD |
| Ga0310039_100914902 | 3300030706 | Peatlands Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREA |
| Ga0302325_104140573 | 3300031234 | Palsa | VSDLDKLEAAVSECREMIREAHAATKDLRAAVREARQEVRALAKDEVT |
| Ga0302325_110798741 | 3300031234 | Palsa | VSDLDRLEAAVSECREMIREAHAATKDLRAAVREARQEVR |
| Ga0318516_108948721 | 3300031543 | Soil | VSEMDRLEAAMSECREMIREAHAATKDLRAAVREAK |
| Ga0318534_102828843 | 3300031544 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRVAVREAKQELRALTQDEVAAHIQ |
| Ga0318538_100065918 | 3300031546 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVREAKRELQDLATG |
| Ga0318571_100375711 | 3300031549 | Soil | VSELERLEAAVSECREMIREAHAATKDLRAAVREARQELRGLA |
| Ga0318528_102736953 | 3300031561 | Soil | VSELDRLEAAVGECREMIREAHAATKDLRTAVREAKKEL |
| Ga0318573_105018101 | 3300031564 | Soil | VSELDRLEVAMSECREMIREAHAATKDLRAAVREARQEARALAADEVAA |
| Ga0318573_106762901 | 3300031564 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQELR |
| Ga0310915_108514762 | 3300031573 | Soil | MSDLDRLEAAAGECREMIREAHAATKDLRAAVREAKSELHAL |
| Ga0318555_103837121 | 3300031640 | Soil | VSELDRLEAAASECREMIREAHAATKDLRAAVREAKREMQDLAK |
| Ga0318555_105725742 | 3300031640 | Soil | VSELDRLEAAVGECREMIREAHAATKDLRTAVREAKRE |
| Ga0318574_109584311 | 3300031680 | Soil | VNELDRLEAAMSECREMIREAHAATKDLRAAVREARQE |
| Ga0318572_103209751 | 3300031681 | Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREAKQEARTLAADEVAAHIQ |
| Ga0318496_101434562 | 3300031713 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAKQEMRTLARDEVAAQVH |
| Ga0318496_104028621 | 3300031713 | Soil | VSELDRLEAAMSECRAMIREAHAATKDLRAAVREARQEARALAAD |
| Ga0318493_103864722 | 3300031723 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAKQEMRTLARDEVAAQVHLE |
| Ga0318502_109131002 | 3300031747 | Soil | VSELDRLEAAVSECREMIREAHAATKDLRAAVREAKQELRGLARDEVAAQIR |
| Ga0318492_102480203 | 3300031748 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRVAVREAKQELRALT |
| Ga0318494_108359742 | 3300031751 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQE |
| Ga0307477_106478561 | 3300031753 | Hardwood Forest Soil | VNELDRLEAALSECREMIREAHAATKDLRAAVREAKQEVRALAT |
| Ga0307475_106219281 | 3300031754 | Hardwood Forest Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALAA |
| Ga0318535_101761911 | 3300031764 | Soil | VSELDRLEAAMRECREMIREAHAATKDLRAAVREARQEART |
| Ga0318554_100107381 | 3300031765 | Soil | VSELDRLEAAMSECRAMIREAHAATKDLRAAVREARQE |
| Ga0318554_101816692 | 3300031765 | Soil | LARRAGEEGAVSELDRLEAAMSECREVIRDAHAATKDLRAAVREARQELRALARD |
| Ga0318521_100993503 | 3300031770 | Soil | VSELDRLEAAAGECREMIREAHAATKDLRAAVREAKRELQDLAKDEVAAHI |
| Ga0318546_107542641 | 3300031771 | Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREAKQEAR |
| Ga0318543_101212461 | 3300031777 | Soil | VSEVDRLEAAVGECREMIREAHAATKDLRAAVREAKRELQDLTRDEVAAH |
| Ga0318543_101487381 | 3300031777 | Soil | VSELERLEAAVGECREMIREAHAATKDLRAAVREAKRELQDLTRDE |
| Ga0318543_102171011 | 3300031777 | Soil | VSELDRLEAAMSECRAMIREAHAATKDLRAAVREARQEARALAADEVASQI |
| Ga0318498_102242491 | 3300031778 | Soil | MSEEAAVSEADRLEAAVAECREMIREAHAATKDLRTAVRDAKR |
| Ga0318566_100590594 | 3300031779 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAK |
| Ga0318566_105380842 | 3300031779 | Soil | MSEADRLEAAIGECREMIREAHAATKDLRAAVRDAK |
| Ga0318547_106749621 | 3300031781 | Soil | VSELDRLEAAASECREMIREAHAATKDLRAAVREAKREMQDLAKDEVAANIQ |
| Ga0318552_105139291 | 3300031782 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVRDAKRELQD |
| Ga0318529_104450242 | 3300031792 | Soil | VSELDRLEAAASECREMIREAHAATKDLRAAVREAKRE |
| Ga0318550_102889121 | 3300031797 | Soil | VSELERLEAAVGECREMIREAHAATKDLRAAVREAKRELQDLTR |
| Ga0318550_104733062 | 3300031797 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAKQEMRTLARDEVAGQVH |
| Ga0318550_106210881 | 3300031797 | Soil | VSELERLEAAMSECREMIREAHAATKDLRAAVRAANQEARALAAD |
| Ga0318565_104924412 | 3300031799 | Soil | MSEQDRLEAAMNECREMIREAHAATKDLRAAVREARQEGRALARDE |
| Ga0318497_108590412 | 3300031805 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRVAVREAKQELRALTQDE |
| Ga0318568_102622971 | 3300031819 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQELRVLTTDEVAAHIQA |
| Ga0318568_106312381 | 3300031819 | Soil | VNELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALATDEVAAHIQAE |
| Ga0318568_110378201 | 3300031819 | Soil | VSELERLEAAMSECREMIREAHAATKDLRAAVREAKQE |
| Ga0318567_105265012 | 3300031821 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRTAVREAKQEVRALATD |
| Ga0318499_101383622 | 3300031832 | Soil | MSEEAAVSEADRLEAAVAECREMIREAHAATKDLRTAVRA |
| Ga0310917_103852462 | 3300031833 | Soil | VSELDRLEAAMRECREMIREAHAATKDLRAAVREARQEA |
| Ga0318511_100412471 | 3300031845 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAKQEMRTLAGDE |
| Ga0318511_105522541 | 3300031845 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVRDAKRELQDLATDEVAAQV |
| Ga0318512_102431802 | 3300031846 | Soil | MSEEAAVSEADRLEAAVAECREMIREAHAATKDLRTA |
| Ga0318512_105939771 | 3300031846 | Soil | VSELDRLEAAMRECREMIREAHAATKDLRAAVREARQEARTL |
| Ga0318527_101756661 | 3300031859 | Soil | VSELDRLEAAMRECREMIREAHAATKDLRAAVREARQEARTLAA |
| Ga0318495_105504631 | 3300031860 | Soil | VSELDRLEVAMSECREMIREAHAATKDLRAAVREA |
| Ga0306919_101914441 | 3300031879 | Soil | MSEEAAVSEADRLEAAVAECREMIREAHAATKDLRTAVRDAK |
| Ga0318551_106528902 | 3300031896 | Soil | MSEADRLEAAIGECREMIREAHAATKDLRAAVRDAKGEIHALAKDEVAA |
| Ga0306923_101355545 | 3300031910 | Soil | VSELDRLEAAAGECREMIREAHAATKDLRAAVREAKR |
| Ga0306923_118711851 | 3300031910 | Soil | VNELDRLEAATSECREMIREAHAATKDLRAAVREAKKELGALA |
| Ga0306921_103142571 | 3300031912 | Soil | VSELERLEAAVGECREMIREAHAATKDLRAAVREAKREL |
| Ga0310912_100989322 | 3300031941 | Soil | MSEADRLEAAIGECREMIREAHAATKDLRAAVRDAKGEIHALAKDE |
| Ga0310910_114286391 | 3300031946 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEARALAADEVAAQIQAE |
| Ga0306926_107610411 | 3300031954 | Soil | VGEVERLEAAVGECREMIREAHAATKDLRAAVREAKREMQDLAKDEVGARIQ |
| Ga0318531_105368342 | 3300031981 | Soil | VSELDRLETAVGECREMIREAHAATKDLRAAVRDAKRELQDLSKDEVAAHI |
| Ga0307416_1030779601 | 3300032002 | Rhizosphere | MRDLDRLEAAISECREMIREAHAATKDLRTAVREAKKELRELTKD |
| Ga0318562_100818744 | 3300032008 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQEVRVLATDEVAAHIQAEVSR |
| Ga0318563_103989072 | 3300032009 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVREAKRELQD |
| Ga0318545_101717531 | 3300032042 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVRDAKRELQDLATDEVAAQ |
| Ga0318556_103529892 | 3300032043 | Soil | VSEVDRLEAAVGECREMIREAHAATKDLRAAVREAK |
| Ga0318556_104473292 | 3300032043 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAKQEMRTLARDEVAGQVHL |
| Ga0318556_105265041 | 3300032043 | Soil | VNELDRLEAATSECREMIREAHAATKDLRAAVREAKKELGALAHDEVAAH |
| Ga0318558_103831641 | 3300032044 | Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREAKQEVRVLATDEVAAHIQA |
| Ga0318570_105688841 | 3300032054 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVREAKRELQDLATGEVAA |
| Ga0318575_102675941 | 3300032055 | Soil | VSEADRLEAAVAECREMIREAHAATKDLRTAVRDAKRELQDLAT |
| Ga0318575_103182821 | 3300032055 | Soil | VSELERLEAAVGECREMIREAHAATKDLRAAVREAKRELQDLT |
| Ga0318505_104782881 | 3300032060 | Soil | VSELDRLEAAMSECREVIRDAHAATKDLRAAVREARQEVRALARDQVAAQ |
| Ga0318513_100586412 | 3300032065 | Soil | MSEEAAVSEADRLEAAVAECREMIREAHAATKDLRTAVREAKRELQD |
| Ga0318553_101221491 | 3300032068 | Soil | VSELDRLEAAMGECREMIREAHAATKDLRAAVREAKQEARRS |
| Ga0318525_101403943 | 3300032089 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREARQELRT |
| Ga0318525_105179852 | 3300032089 | Soil | VSELDRLEAAMSECRAMIREAHAATKDLRAAVREARQEARALAADEVASQ |
| Ga0318525_106515772 | 3300032089 | Soil | VSEMDRLEAAMSECREMIREAHAATKDLRAAVREAKQEVRALATDEVAANI |
| Ga0318518_103439721 | 3300032090 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQE |
| Ga0318540_102677082 | 3300032094 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQEVRVLATDEVAAHI |
| Ga0318540_104318671 | 3300032094 | Soil | VSELERLEAAVSECREMIREAHAATKDLRAAVREARQELRG |
| Ga0307415_1009847242 | 3300032126 | Rhizosphere | MSDLDRLEAAISECREMIREAHAATKDLRTAVREAKKEL |
| Ga0311301_115470032 | 3300032160 | Peatlands Soil | VSELDRLEAAMAECREMIREAHAATKDLRAAVREAKQELRGLAHDEVAAH |
| Ga0306920_1017684122 | 3300032261 | Soil | VSEVDRLEAAVGECREMIREAHAATKDLRAAVREAKRELQDLTRDEVAAHIQ |
| Ga0306920_1018176292 | 3300032261 | Soil | VSELERLEAAVSECREMIREAHAATKDLRAAVREAKQ |
| Ga0335082_101242881 | 3300032782 | Soil | VNELDRLEAAMSECREMIREAHAATKDLRAAVREARQEVRALAAGEVAAHIQ |
| Ga0335082_111045462 | 3300032782 | Soil | VREEDAVSELDRLEAAMSECREMIREAHAATKDLRAAVREARQEMRVLAAAEVA |
| Ga0335078_110300272 | 3300032805 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAKQEMRTLA |
| Ga0335078_112808292 | 3300032805 | Soil | VRELDRLEAAVGECREMIREAHAATKDLRVAVREAKAELRDLAKDEV |
| Ga0335080_123408791 | 3300032828 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAKQEMRTLARDEVA |
| Ga0335070_105068822 | 3300032829 | Soil | VSELDRLEAAMSECREMIREAHAATKDLRAAVREAKQ |
| Ga0335081_124810511 | 3300032892 | Soil | VSDLDRLEAAAGECREMIREAHAATKDLRAAVREAKTELHAL |
| Ga0335069_105027701 | 3300032893 | Soil | VSELDRLETAMSECREMIREAHAATKDLRAAVREARQEARTLAAGEVSAQMQAEVSR |
| Ga0335069_114436762 | 3300032893 | Soil | VSELDRLEAAMNECREMIRDAHAATKDLRTAVREARQEVRALASDEVSAQVRLE |
| Ga0335074_107496071 | 3300032895 | Soil | VSERDKLEAAIAECREMIREAHAATKDLRTAVREAKRE |
| Ga0335073_104898583 | 3300033134 | Soil | VSEQDRLEAAVSECREMIREAHAATKDLRAAVREAK |
| Ga0318519_107424202 | 3300033290 | Soil | MTEEAAVSELDRLEAAAGECREMIREAHAATKDLRAAVREAKRELQDLTK |
| Ga0310811_109889581 | 3300033475 | Soil | MSELDRLEAAMDECREMVREAHAATKDLRAAVREARQELRTLARDQVAAQIQP |
| Ga0373958_0059423_669_824 | 3300034819 | Rhizosphere Soil | MSEVDRLEAAISECREMIREAHAATKDLRTAVREAKKELRELAKDEVAGQVH |
| ⦗Top⦘ |