| Basic Information | |
|---|---|
| Family ID | F020246 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 225 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSAMKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 225 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.89 % |
| % of genes near scaffold ends (potentially truncated) | 94.67 % |
| % of genes from short scaffolds (< 2000 bps) | 87.11 % |
| Associated GOLD sequencing projects | 169 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.778 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 225 Family Scaffolds |
|---|---|---|
| PF00389 | 2-Hacid_dh | 15.56 |
| PF02826 | 2-Hacid_dh_C | 6.22 |
| PF00456 | Transketolase_N | 5.78 |
| PF06537 | DHOR | 4.89 |
| PF00109 | ketoacyl-synt | 3.11 |
| PF13336 | AcetylCoA_hyd_C | 2.22 |
| PF01243 | Putative_PNPOx | 2.22 |
| PF02801 | Ketoacyl-synt_C | 1.78 |
| PF00753 | Lactamase_B | 0.89 |
| PF03061 | 4HBT | 0.89 |
| PF05592 | Bac_rhamnosid | 0.89 |
| PF02780 | Transketolase_C | 0.89 |
| PF14559 | TPR_19 | 0.89 |
| PF05163 | DinB | 0.89 |
| PF01828 | Peptidase_A4 | 0.89 |
| PF01436 | NHL | 0.89 |
| PF07676 | PD40 | 0.44 |
| PF00574 | CLP_protease | 0.44 |
| PF02779 | Transket_pyr | 0.44 |
| PF13649 | Methyltransf_25 | 0.44 |
| PF02518 | HATPase_c | 0.44 |
| PF00069 | Pkinase | 0.44 |
| PF04239 | DUF421 | 0.44 |
| PF07883 | Cupin_2 | 0.44 |
| PF07690 | MFS_1 | 0.44 |
| PF13618 | Gluconate_2-dh3 | 0.44 |
| PF02838 | Glyco_hydro_20b | 0.44 |
| PF00326 | Peptidase_S9 | 0.44 |
| PF00561 | Abhydrolase_1 | 0.44 |
| PF04909 | Amidohydro_2 | 0.44 |
| PF00144 | Beta-lactamase | 0.44 |
| PF02954 | HTH_8 | 0.44 |
| PF13521 | AAA_28 | 0.44 |
| PF13714 | PEP_mutase | 0.44 |
| PF01435 | Peptidase_M48 | 0.44 |
| PF13620 | CarboxypepD_reg | 0.44 |
| PF04226 | Transgly_assoc | 0.44 |
| PF00535 | Glycos_transf_2 | 0.44 |
| PF03572 | Peptidase_S41 | 0.44 |
| PF01546 | Peptidase_M20 | 0.44 |
| PF00155 | Aminotran_1_2 | 0.44 |
| PF13432 | TPR_16 | 0.44 |
| PF17191 | RecG_wedge | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
|---|---|---|---|
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 5.78 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 5.78 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 4.89 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.78 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.89 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.89 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.44 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.44 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 0.44 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.44 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.33 % |
| Unclassified | root | N/A | 2.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_13552817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10266376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300004082|Ga0062384_100349761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300004092|Ga0062389_100384022 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300004092|Ga0062389_102732255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300004152|Ga0062386_101513899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005093|Ga0062594_101723032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300005167|Ga0066672_10580535 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005176|Ga0066679_10745789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300005177|Ga0066690_10788552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300005355|Ga0070671_100422855 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300005437|Ga0070710_11059142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300005444|Ga0070694_100481783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300005459|Ga0068867_101947923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300005530|Ga0070679_100375066 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300005530|Ga0070679_101509021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 619 | Open in IMG/M |
| 3300005537|Ga0070730_10877094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 563 | Open in IMG/M |
| 3300005538|Ga0070731_11056794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005541|Ga0070733_10309128 | All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium HGW-Atribacteria-1 | 1045 | Open in IMG/M |
| 3300005542|Ga0070732_10176494 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300005542|Ga0070732_10477095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 755 | Open in IMG/M |
| 3300005542|Ga0070732_10859257 | Not Available | 554 | Open in IMG/M |
| 3300005546|Ga0070696_100033711 | All Organisms → cellular organisms → Bacteria | 3520 | Open in IMG/M |
| 3300005546|Ga0070696_101061397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300005563|Ga0068855_101335307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300005575|Ga0066702_10162615 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005575|Ga0066702_10190777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300005712|Ga0070764_10118419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1431 | Open in IMG/M |
| 3300005921|Ga0070766_10370893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300005921|Ga0070766_11217543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005995|Ga0066790_10025066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2609 | Open in IMG/M |
| 3300006028|Ga0070717_10870751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300006050|Ga0075028_100687668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300006052|Ga0075029_100243771 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300006052|Ga0075029_100763454 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 656 | Open in IMG/M |
| 3300006059|Ga0075017_100087705 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300006059|Ga0075017_100170446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1560 | Open in IMG/M |
| 3300006059|Ga0075017_100869053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300006172|Ga0075018_10609660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300006176|Ga0070765_101360945 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006797|Ga0066659_10292594 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300007982|Ga0102924_1031458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3490 | Open in IMG/M |
| 3300009038|Ga0099829_11369057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300009143|Ga0099792_11072266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300009176|Ga0105242_11239234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300009624|Ga0116105_1003721 | Not Available | 3194 | Open in IMG/M |
| 3300009665|Ga0116135_1109754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300009759|Ga0116101_1072684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300009824|Ga0116219_10414797 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 750 | Open in IMG/M |
| 3300009839|Ga0116223_10306425 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 947 | Open in IMG/M |
| 3300010043|Ga0126380_10349862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
| 3300010048|Ga0126373_11132096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300010343|Ga0074044_10006197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9619 | Open in IMG/M |
| 3300010343|Ga0074044_10028559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3953 | Open in IMG/M |
| 3300010359|Ga0126376_10077733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2454 | Open in IMG/M |
| 3300010360|Ga0126372_11629721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300010376|Ga0126381_100879911 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300010376|Ga0126381_103988643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010379|Ga0136449_103793133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300011120|Ga0150983_13247432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300011120|Ga0150983_15337939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300011269|Ga0137392_10260116 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300012096|Ga0137389_11076678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300012096|Ga0137389_11814240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012199|Ga0137383_10873484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300012203|Ga0137399_10275344 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300012203|Ga0137399_11348165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300012205|Ga0137362_10461996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300012917|Ga0137395_10706125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300012918|Ga0137396_10951352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012960|Ga0164301_10939093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300012971|Ga0126369_10408724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300012986|Ga0164304_10160375 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300012989|Ga0164305_11817599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300013100|Ga0157373_10189283 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300014169|Ga0181531_10160868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1359 | Open in IMG/M |
| 3300014169|Ga0181531_10599381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300014489|Ga0182018_10283984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300014495|Ga0182015_10442436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300014501|Ga0182024_10166864 | All Organisms → cellular organisms → Bacteria | 3064 | Open in IMG/M |
| 3300014658|Ga0181519_10291967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300015242|Ga0137412_10686509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300015264|Ga0137403_11089220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300015373|Ga0132257_103554720 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300016422|Ga0182039_10457492 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300016445|Ga0182038_11789308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300016702|Ga0181511_1529530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300017822|Ga0187802_10334047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300017823|Ga0187818_10061341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
| 3300017823|Ga0187818_10383188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 623 | Open in IMG/M |
| 3300017933|Ga0187801_10155009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 894 | Open in IMG/M |
| 3300017936|Ga0187821_10072742 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300017940|Ga0187853_10154505 | Not Available | 1096 | Open in IMG/M |
| 3300017940|Ga0187853_10479255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300017943|Ga0187819_10244537 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 1051 | Open in IMG/M |
| 3300017943|Ga0187819_10536105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300017943|Ga0187819_10594597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300017946|Ga0187879_10711290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300017955|Ga0187817_10427008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 845 | Open in IMG/M |
| 3300017955|Ga0187817_10854658 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 581 | Open in IMG/M |
| 3300017959|Ga0187779_10694066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300017972|Ga0187781_11394212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300017975|Ga0187782_10516615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300017988|Ga0181520_10878841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 599 | Open in IMG/M |
| 3300017995|Ga0187816_10211973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 843 | Open in IMG/M |
| 3300018006|Ga0187804_10438871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300018019|Ga0187874_10344343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300018047|Ga0187859_10445483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300018085|Ga0187772_10046524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2649 | Open in IMG/M |
| 3300018085|Ga0187772_10592202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300018085|Ga0187772_11390863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300018090|Ga0187770_10005287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7723 | Open in IMG/M |
| 3300019278|Ga0187800_1479682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300020022|Ga0193733_1002360 | All Organisms → cellular organisms → Bacteria | 5498 | Open in IMG/M |
| 3300020579|Ga0210407_10016218 | All Organisms → cellular organisms → Bacteria | 5528 | Open in IMG/M |
| 3300020580|Ga0210403_10364322 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300020580|Ga0210403_11497459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300020582|Ga0210395_10992281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300020583|Ga0210401_11008754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300021168|Ga0210406_10761697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300021170|Ga0210400_11212884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300021171|Ga0210405_10990650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300021178|Ga0210408_11230493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021178|Ga0210408_11255073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300021180|Ga0210396_10551886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300021180|Ga0210396_10833602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300021401|Ga0210393_10337861 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300021401|Ga0210393_11680794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021402|Ga0210385_10274493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300021403|Ga0210397_11078984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300021406|Ga0210386_10123475 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300021406|Ga0210386_11065698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Neorhizobium → unclassified Neorhizobium → Neorhizobium sp. SHOUNA12A | 687 | Open in IMG/M |
| 3300021420|Ga0210394_10108519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2402 | Open in IMG/M |
| 3300021420|Ga0210394_10632553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300021420|Ga0210394_11400338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300021432|Ga0210384_10113128 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300021432|Ga0210384_10293233 | Not Available | 1464 | Open in IMG/M |
| 3300021433|Ga0210391_10068907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2800 | Open in IMG/M |
| 3300021476|Ga0187846_10425283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300021478|Ga0210402_11970424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300021559|Ga0210409_11151343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300021560|Ga0126371_12043377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300021858|Ga0213852_1483815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300021861|Ga0213853_11341565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300022522|Ga0242659_1014077 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300022522|Ga0242659_1039673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300022522|Ga0242659_1062254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300022722|Ga0242657_1156597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300023090|Ga0224558_1120165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 885 | Open in IMG/M |
| 3300024295|Ga0224556_1128912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300025134|Ga0207416_1131625 | Not Available | 855 | Open in IMG/M |
| 3300025414|Ga0208935_1023503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300025473|Ga0208190_1065386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 741 | Open in IMG/M |
| 3300025906|Ga0207699_10128095 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300025920|Ga0207649_10146285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1622 | Open in IMG/M |
| 3300025929|Ga0207664_11418471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300025929|Ga0207664_11538681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300025934|Ga0207686_10413845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300025941|Ga0207711_10395982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
| 3300025949|Ga0207667_11174604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300026078|Ga0207702_10581751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
| 3300026078|Ga0207702_11900054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300026089|Ga0207648_11776294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300026959|Ga0207852_1030978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300027080|Ga0208237_1010360 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300027109|Ga0208603_1004768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2251 | Open in IMG/M |
| 3300027313|Ga0207780_1059353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 650 | Open in IMG/M |
| 3300027537|Ga0209419_1071982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300027567|Ga0209115_1145916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300027591|Ga0209733_1046914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300027633|Ga0208988_1035255 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300027641|Ga0208827_1161673 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300027645|Ga0209117_1188402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300027826|Ga0209060_10569835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300027842|Ga0209580_10508948 | Not Available | 599 | Open in IMG/M |
| 3300027884|Ga0209275_10451468 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027889|Ga0209380_10471659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300027908|Ga0209006_10096716 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 2620 | Open in IMG/M |
| 3300028013|Ga0265350_103724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300028572|Ga0302152_10235406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300028795|Ga0302227_10237497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300028871|Ga0302230_10210072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300028871|Ga0302230_10371377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300028906|Ga0308309_10066517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2668 | Open in IMG/M |
| 3300028906|Ga0308309_11740177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300029911|Ga0311361_10941746 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300029914|Ga0311359_10566521 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300029917|Ga0311326_10035490 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
| 3300029945|Ga0311330_10060301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4034 | Open in IMG/M |
| 3300029945|Ga0311330_10097736 | All Organisms → cellular organisms → Bacteria | 2949 | Open in IMG/M |
| 3300030007|Ga0311338_10017485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10493 | Open in IMG/M |
| 3300030020|Ga0311344_10623237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300030049|Ga0302191_10269893 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300030503|Ga0311370_10127075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3552 | Open in IMG/M |
| 3300030524|Ga0311357_11159697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300030617|Ga0311356_11574360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300030737|Ga0302310_10318773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300030746|Ga0302312_10105124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300030879|Ga0265765_1039705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300031231|Ga0170824_103409837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300031238|Ga0265332_10260845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300031247|Ga0265340_10305664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300031258|Ga0302318_10558367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300031525|Ga0302326_10043698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8681 | Open in IMG/M |
| 3300031708|Ga0310686_102917950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300031708|Ga0310686_103533034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300031708|Ga0310686_105444310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300031708|Ga0310686_107380476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1976 | Open in IMG/M |
| 3300031708|Ga0310686_108642043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2006 | Open in IMG/M |
| 3300031708|Ga0310686_113562618 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031715|Ga0307476_10211929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1409 | Open in IMG/M |
| 3300031720|Ga0307469_12028916 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031753|Ga0307477_10286401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300031890|Ga0306925_10607488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300031996|Ga0308176_10807209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 981 | Open in IMG/M |
| 3300032174|Ga0307470_10357636 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300032770|Ga0335085_10801719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300032783|Ga0335079_10450375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1380 | Open in IMG/M |
| 3300032783|Ga0335079_11685834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300032892|Ga0335081_10026637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9319 | Open in IMG/M |
| 3300032892|Ga0335081_12141180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300032955|Ga0335076_10045863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4349 | Open in IMG/M |
| 3300033158|Ga0335077_10558140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 1202 | Open in IMG/M |
| 3300033290|Ga0318519_10964912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300034163|Ga0370515_0071766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.44% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.11% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.44% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.44% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.44% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_135528171 | 3300000891 | Soil | DMAGMEKNILAMKEPVFAVRPRVAFGLYEKNFMGSATRWMFKG* |
| JGIcombinedJ51221_102663762 | 3300003505 | Forest Soil | MSSMKDDILSLKEPVFAVRPRVVFGFWEKHFQSKSTRWKFA* |
| Ga0062384_1003497612 | 3300004082 | Bog Forest Soil | DMGNMKEDILSMKEPVFAVRPRVVFGLWEKHFQSKSTRWTFE* |
| Ga0062389_1003840223 | 3300004092 | Bog Forest Soil | MGKMKEDILSMKEPIFAVRPKVVFALWEKYFQSKSTRWIS* |
| Ga0062389_1027322551 | 3300004092 | Bog Forest Soil | MIPAYERKYKYDLSKMKDDMLSMKEPVFFVRPKVVFALWEKHFPTKSTRWKF* |
| Ga0062386_1015138992 | 3300004152 | Bog Forest Soil | GKMKDDILSMREPIFAVRPRVVFALWEKHFQGKSTRWKFR* |
| Ga0062594_1017230321 | 3300005093 | Soil | KYHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS* |
| Ga0066672_105805352 | 3300005167 | Soil | MGTIVNEKDDILSMKEPVFAVRPRVVFGLYEKKFIHAASRWRFE* |
| Ga0066679_107457892 | 3300005176 | Soil | YEKKYKWDLSTMKDDMLSMKEPVFAVRPRVVFGLWEKEFMGKSTRWQFE* |
| Ga0066690_107885521 | 3300005177 | Soil | KFISPYEKKYKFDMASMKDDLLSMKEPVFAVRPRVVFGLWEKHFQTKSTRWKFK* |
| Ga0070671_1004228551 | 3300005355 | Switchgrass Rhizosphere | MEKDILSMKEPVFAVRPKVAFGLYEKKFMSSATRWTFKG* |
| Ga0070710_110591422 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | KFLAPYERKYKWDMSSMEEGILSMKEPVFAVRPKIVFALWEKYFQNRSTRWQFE* |
| Ga0070694_1004817831 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KYQPKYHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS* |
| Ga0068867_1019479231 | 3300005459 | Miscanthus Rhizosphere | DMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWMFKG* |
| Ga0070679_1003750662 | 3300005530 | Corn Rhizosphere | RKYQPKYHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS* |
| Ga0070679_1015090212 | 3300005530 | Corn Rhizosphere | KFLAPYERKYKWDMSSMEDGILSMKEPVFAVRPRIVFALWEKYFQNRSTRWQFE* |
| Ga0070730_108770942 | 3300005537 | Surface Soil | SMKDDILSMKEPVFAVRPKVVFALWEKYFQSKSTRWKFE* |
| Ga0070731_110567942 | 3300005538 | Surface Soil | DLSKMKDDMLSMKEPVFSVRPKVVFALWEKYFQTKSTRWRFE* |
| Ga0070733_103091281 | 3300005541 | Surface Soil | YQRKYDWDLSSMQDDLLSMKEPVFAVRPKVVFALWEKYFQTKSTRWQFK* |
| Ga0070732_101764942 | 3300005542 | Surface Soil | KDDILSMKEPVFAVRPLVVFGLWEKYFQSKSTRWKFA* |
| Ga0070732_104770952 | 3300005542 | Surface Soil | KLIPVYERKYKWDLSSMKDDMLSMKEPVFAVRPRIVFALWEKHFQTKSTRWTFE* |
| Ga0070732_108592571 | 3300005542 | Surface Soil | ILSMKEPVFAVRPRVVFGLWEKYFVEKSTRWTFE* |
| Ga0070696_1000337111 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KYQPKYHFDMAGMEKDILAMKEPVFALRPRVVFGLYEKNFMGSATRWKFKP* |
| Ga0070696_1010613972 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FLKKYEPKYNFDMGQMKGDILSMKEPVFAVRPQRVFGLFEKKFMSSATRWIFTK* |
| Ga0068855_1013353072 | 3300005563 | Corn Rhizosphere | SSMKDDILSMKEPVFAVLPRVVFALWEKHFQSKSTRWEFG* |
| Ga0066702_101626151 | 3300005575 | Soil | VYERKYKFDMSSMKADILSMKEPVFAVRPRLVFAMWEKHFQSKSTRWKFE* |
| Ga0066702_101907771 | 3300005575 | Soil | DMGKMKDDILSMKEPIFAVRPQVVFGFWEKYFQSKSTRWKFE* |
| Ga0070764_101184191 | 3300005712 | Soil | KYKYSLASMRDDILSMKEPVYAVRPTMAFALPEKSFQTKSTRWKFR* |
| Ga0070766_103708932 | 3300005921 | Soil | TYERKYKFDMKGMEQDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKFE* |
| Ga0070766_112175431 | 3300005921 | Soil | KYNFDMSKMKPDILSMKEPIFAVRPRVVFGLWEKEFIEKSTRWTFERQ* |
| Ga0066790_100250662 | 3300005995 | Soil | MKDDILSMKEPVFAVRPRVVFGLPEKHFQSKSTRWMFV* |
| Ga0070717_108707511 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAMKEPVFTVRPRVVFGLYEKKFVSSATRWKFTG* |
| Ga0075028_1006876681 | 3300006050 | Watersheds | LYDRKYKFDMGAMKDDLLAMKEPVFAVRPRVVFALPEKQFQSKSTRWKFA* |
| Ga0075029_1002437711 | 3300006052 | Watersheds | KFDMSSMERDILSMKEPVFAVRPRVVFGMYEKKFMSSATRWKFEN* |
| Ga0075029_1007634541 | 3300006052 | Watersheds | WDMSKMKDDILSLKEPVFAVKPRVVFALWEEHFQNRSTRWKFD* |
| Ga0075017_1000877053 | 3300006059 | Watersheds | AMKADILSMKEPVFAVCPLTVFALWEEYFQEKSTRWKFE* |
| Ga0075017_1001704463 | 3300006059 | Watersheds | LLSMKEPVFAIRPRVVFGLWEKHFQSKSTRWKFE* |
| Ga0075017_1008690531 | 3300006059 | Watersheds | DILSKKEPVFAVRPLVVFGLYEKNFVGSATRWKFSA* |
| Ga0075018_106096602 | 3300006172 | Watersheds | DILSMKEPVFAVRPKIAFGLYEKKFLSSATRWTFTG* |
| Ga0070765_1013609452 | 3300006176 | Soil | DFDMKAMEKDILAMKEPVFAVRPRLVFGLYEKKFMSSATRWNFTS* |
| Ga0066659_102925942 | 3300006797 | Soil | MKRDILSQKEPVFVVRPHVAFGLYEKKYMESATRWKFLR* |
| Ga0102924_10314583 | 3300007982 | Iron-Sulfur Acid Spring | PAYERKYKFSLATMKDDILSMKEPVYSVRPRVVFGLWEKHFQDKSTRWKFES* |
| Ga0099829_113690572 | 3300009038 | Vadose Zone Soil | LSMKEPVFAVRPRLVFGLYEKKFIESATRWRFKG* |
| Ga0099792_110722661 | 3300009143 | Vadose Zone Soil | YKFDMGGMKQDILSMKEPVFAVRPRLVFGLWEKDFVGKSTRWRF* |
| Ga0105242_112392341 | 3300009176 | Miscanthus Rhizosphere | ILAMKEPVFAVRPRVAFGLYEKNFMGSATRWMFKG* |
| Ga0116105_10037211 | 3300009624 | Peatland | KYKFDMKAMKQDILAMKEPVFAVRPRVVFGLWEKEFVDRSTRWKFAST* |
| Ga0116135_11097542 | 3300009665 | Peatland | KFLPPYEKKYKFDMSKMKDDILSMKEPVFAVRPRVVFGLWEKHFQSKSTRWKFE* |
| Ga0116101_10726841 | 3300009759 | Peatland | MKEDVLSMKEPVFAVRPRVAFALWEKYFVGRSTRWKFE* |
| Ga0116219_104147971 | 3300009824 | Peatlands Soil | ARYKPKYNFDLSSMKDDILSMKEPVFAVRPKVVFALWEKYFQTKSTRWKFN* |
| Ga0116223_103064251 | 3300009839 | Peatlands Soil | RRKFIARYKPKYNFDLSSMKDDILSMKEPVFAVRPKVVFALWEKYFQTKSTRWKFN* |
| Ga0126380_103498622 | 3300010043 | Tropical Forest Soil | KFLAQYTRKYHWDMSAMKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE* |
| Ga0126373_111320962 | 3300010048 | Tropical Forest Soil | KYKFDMSKMKDDILSMKEPVFAVRPRLVFALWEKHFQGKSTRWKFD* |
| Ga0074044_100061977 | 3300010343 | Bog Forest Soil | MKGMKQDILSMKEPVLAVRPQVVFGLWEKKFVGKSTRWKFA* |
| Ga0074044_100285591 | 3300010343 | Bog Forest Soil | DILSLKEPVFSVRPRVVFALWEKHFVGKSTRWKFE* |
| Ga0126376_100777332 | 3300010359 | Tropical Forest Soil | MSAMKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE* |
| Ga0126372_116297211 | 3300010360 | Tropical Forest Soil | FDMSTMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKF* |
| Ga0126381_1008799111 | 3300010376 | Tropical Forest Soil | KYKFDMSTMKDDILSMKEPVYAVRPRVVFAMWEKHFQNKSTRWKFE* |
| Ga0126381_1039886432 | 3300010376 | Tropical Forest Soil | ATMKDDILSMKEPVYAVRPRVVFAMWEKHFQDKSTRWKFD* |
| Ga0136449_1037931331 | 3300010379 | Peatlands Soil | ILSMKEPVFAVRPKVVFALWEKHFQTKSTRWKLD* |
| Ga0150983_132474322 | 3300011120 | Forest Soil | PTYERKYKFDMKGMEQDILSMKEPVFAVRPRLAFALWEKHFVGKSTRWRFE* |
| Ga0150983_153379391 | 3300011120 | Forest Soil | LYERKYKFDMGAMKKDILSMKEPVFTVRPRVAFGLWEKYFQGKSTRWRFV* |
| Ga0137392_102601161 | 3300011269 | Vadose Zone Soil | NYGRKYKWDMSTMKEDILSMKEPVFAVRPRVVFGLWEKEFMERSTRWKFE* |
| Ga0137389_110766781 | 3300012096 | Vadose Zone Soil | RKLLPKYERKYKFDMGTMKDDILSMKEPVFAVRPRVVFGLWEKDFIGKSTRWKFE* |
| Ga0137389_118142401 | 3300012096 | Vadose Zone Soil | RKYKFDMKDMKDDLLSMKEPVFAVRPRVVFGLWEKEFIGKSTRWQFE* |
| Ga0137383_108734841 | 3300012199 | Vadose Zone Soil | KFDLSNMKDDLLSMKEPVLAVRPRVVFGLWEKYFQSKSTRWKFE* |
| Ga0137399_102753441 | 3300012203 | Vadose Zone Soil | EFLKKCQRKYNFDMAGMEKDILSMKEPVFAVRPRVVFGLYEKKFVGSATRWKFTG* |
| Ga0137399_113481651 | 3300012203 | Vadose Zone Soil | YERKYKFDMKGMTQDILGMKEPVFAVRPRVVFGLWEKHFIGKSTRWKFK* |
| Ga0137362_104619961 | 3300012205 | Vadose Zone Soil | DILSMKEPVFAVRPRVVFGLWEKKFMEKTTRWMF* |
| Ga0137395_107061252 | 3300012917 | Vadose Zone Soil | AKYSGKYDWDMASMENDILSMKEPVFAVRPRVVFGLWEKKFMETTTRWMFP* |
| Ga0137396_109513522 | 3300012918 | Vadose Zone Soil | KKYKPKYNFDMSGMEQDILSMKEPVFAVRPRLVFGLYEKKFMESATRWRFKG* |
| Ga0164301_109390931 | 3300012960 | Soil | MKDDILSMKEPVFAVRPRVVFGMWEKYFQSKSTRWKFE* |
| Ga0126369_104087241 | 3300012971 | Tropical Forest Soil | MKDDILSMKEPVYAVRPRVVFAMWEKHFQDKSTRWKFD* |
| Ga0164304_101603753 | 3300012986 | Soil | YHFDMAGMEKNILAMKEPVFAVRPRVAFGLYEKNFMGSATRWMFKG* |
| Ga0164305_118175992 | 3300012989 | Soil | YHFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFIGSATRWKFKA* |
| Ga0157373_101892831 | 3300013100 | Corn Rhizosphere | LKKYQPKYHFDMAGMEKDILAMKEPVFALRPRVVFGLYEKNFMGSATRWKFKS* |
| Ga0181531_101608681 | 3300014169 | Bog | KGILSMKEPVFAVRPRVAFGLWEKHFVGKSTRWTFD* |
| Ga0181531_105993811 | 3300014169 | Bog | MLPVYERKYKFDMGAMKKDILAMKEPVFAVRPRVAFGLWEKHFVGKSTRWVFE* |
| Ga0182018_102839841 | 3300014489 | Palsa | DILSMKEPVFAVRPRVVFGLWEKDFVGKATRWSFE* |
| Ga0182015_104424362 | 3300014495 | Palsa | ERKYKFDMKGMEQDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKFE* |
| Ga0182024_101668645 | 3300014501 | Permafrost | GMEQDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKFE* |
| Ga0181519_102919671 | 3300014658 | Bog | DGILSMKEPVFSVRPRVAFALWEKYFQSKSTRWKFE* |
| Ga0137412_106865091 | 3300015242 | Vadose Zone Soil | KFLATYERKYKFDMGGMKQDILSMKEPVFAVRPRLVFGLWEKDFVGKSTRWTF* |
| Ga0137403_110892201 | 3300015264 | Vadose Zone Soil | MKDDILAMKEPVFAVRPRIAFGLWEKEFIGKTTRWKFE* |
| Ga0132257_1035547201 | 3300015373 | Arabidopsis Rhizosphere | DMSTMKDDILSMKEPVYAVRPYVVFAMWEKHFQSKSTRWKFE* |
| Ga0182039_104574923 | 3300016422 | Soil | MLPLYERKYNFDMASMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKFA |
| Ga0182038_117893081 | 3300016445 | Soil | MKDDILSMKEPVFAVRPRVVFAMWEKHFLSKSTRWKLE |
| Ga0181511_15295301 | 3300016702 | Peatland | EKKYKFDMSSMKDGILSMKEPVFSVRPRVAFALWEKYFQSKSTRWKF |
| Ga0187802_103340472 | 3300017822 | Freshwater Sediment | RKFLPAYEKKYKFDMSKMKDDILSVKEPVFAVRPRVVFGLWEKYFQSKSTRWKFE |
| Ga0187818_100613411 | 3300017823 | Freshwater Sediment | AYQRKYKFDLSSMKDDMLSMKEPVFAVRPRVVFGLWEKHFQNKSTRWKLE |
| Ga0187818_103831881 | 3300017823 | Freshwater Sediment | AYQRKYKFDLSSMKDDMLSMKEPVFAVRPRVVFGLWEKHFQGKSTRWKFE |
| Ga0187801_101550091 | 3300017933 | Freshwater Sediment | KYKFDMSTMKDDILSMKEPVFAVRPRVVFGFWEKHFQSKSTRWKFE |
| Ga0187821_100727421 | 3300017936 | Freshwater Sediment | ILSMKEPVFSVRPRLAFGLYEKKFMASATRWKFGE |
| Ga0187853_101545051 | 3300017940 | Peatland | MEPDILSMKEPVFAVRPRVVFGLWEKEFVGKSTRWKFE |
| Ga0187853_104792552 | 3300017940 | Peatland | DMKAMKEDVLSMKEPVFAVRPRVAFALWEKYFVGRSTRWKFE |
| Ga0187819_102445372 | 3300017943 | Freshwater Sediment | ARRKMIPTYERKYKFSLSTMKDDLLSMKEPVFAVRPRVVFGLWEKHFQGKSTRWKFD |
| Ga0187819_105361052 | 3300017943 | Freshwater Sediment | AYERKYKFDMSTMKDDILSMKEPVFAVRPRLVFGFWEKHFQSKSTRWKFE |
| Ga0187819_105945971 | 3300017943 | Freshwater Sediment | MKDDMLSMQEPVFAVRPRVVFALWEKHFQSKSTRWKFE |
| Ga0187879_107112902 | 3300017946 | Peatland | TYERKYKFNMKGMKDDILSMKEPVFAVRPRVVFGFWEEHFAEKSTRWKFN |
| Ga0187817_104270082 | 3300017955 | Freshwater Sediment | YDRKYDWDMSKMKDDILSNKEPVFAVRPLVVFGLWEKYFQSKSTRWIFD |
| Ga0187817_108546581 | 3300017955 | Freshwater Sediment | MKDDILSMKEPVFAVRPRLVFGLWERHFQSKSTRWKFE |
| Ga0187779_106940661 | 3300017959 | Tropical Peatland | WDMSTMKNDILSMKEPVFAVRPRVVFGLWEKYFQQKSTRWMFD |
| Ga0187781_113942121 | 3300017972 | Tropical Peatland | WDLSKMKNDMLSMKEPVFAIRPRVVFALWEEHFQTKSTRWTFE |
| Ga0187782_105166152 | 3300017975 | Tropical Peatland | VYEKKYEWDLSTMKDDMLSMKEPVFAVRSRVVFALWEKHFQSKSTRWKFE |
| Ga0181520_108788412 | 3300017988 | Bog | ERKYKFDMKGMKDDILSMKEPVFAVRPRVVFGLWEKYFQEKSTRWIF |
| Ga0187816_102119731 | 3300017995 | Freshwater Sediment | AYERKYKFDMSSMKDDILSMKEPVIAVRPRVVFAMWEKYFQSKSTRWKFE |
| Ga0187804_104388712 | 3300018006 | Freshwater Sediment | RKFMARYKPKYNFDMSSMKDDILSMKEPVFAVRPKVVFAMWEKYFQTKSTRWKFE |
| Ga0187874_103443432 | 3300018019 | Peatland | SMKDSIMSMKEPVFAVRPKLVFGLWEKYFQSKSTRWKFE |
| Ga0187859_104454832 | 3300018047 | Peatland | FDMGAMKKDILAMKEPVFAVRPRVAFGLWEKHFVGKSTRWVFE |
| Ga0187772_100465242 | 3300018085 | Tropical Peatland | LSSMKDDMLSMKEPVYAVRPRVVFGLWEKHFQNKSTRWEFTS |
| Ga0187772_105922021 | 3300018085 | Tropical Peatland | WDLSNMKEDMLSMKEPVFAVRPRVVFALWEEHFQGRSTRWKFD |
| Ga0187772_113908631 | 3300018085 | Tropical Peatland | DDLLSMKEPVFAVRPRVVFALWEKYFQEKSTRWTFQ |
| Ga0187770_100052877 | 3300018090 | Tropical Peatland | MKQDILSMKEPVFAVRPRTAFGRWEKEFIGKSMRWTFE |
| Ga0187800_14796821 | 3300019278 | Peatland | EKKYDWDLSNMKDDMLSMKEPVFAVRPRVVFGLWEEHFQSKSTRWKFE |
| Ga0193733_10023601 | 3300020022 | Soil | DMAGLEKDILAMKEPVFAVRPSVVFGLYEKKFMSSATRWKFEG |
| Ga0210407_100162181 | 3300020579 | Soil | YKFDMKGMKNDILSMKEPVFAVLPRVVFGLWEKHFVGKSTRWKF |
| Ga0210403_103643221 | 3300020580 | Soil | YERKYKFDMKGMAQDILSMKEPVYAVSPRVVFGLWEEYFIGKSTRWEF |
| Ga0210403_114974591 | 3300020580 | Soil | YKFDMSTMKDDILSMKEPVFAVRPLVVFAMWEKHFQSMSTRWKFE |
| Ga0210395_109922811 | 3300020582 | Soil | KWDMSSMKDDILSMKEPVYTVRPRAVFGLWEKKFMGSATRWKFE |
| Ga0210401_110087542 | 3300020583 | Soil | DLSTMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKFE |
| Ga0210406_107616971 | 3300021168 | Soil | MAQDILSMKEPVYAVSPRVVFGLWEKYFIGKSTRWEF |
| Ga0210400_112128841 | 3300021170 | Soil | WDMASMENDILSMKEPVFAVRPRVVFGLWEKRFMETTTRWLFH |
| Ga0210405_109906502 | 3300021171 | Soil | FDMSKMKPDILSMKEPIFTVRPRVVFGLWEKEFVEKSTRWTFERQ |
| Ga0210408_112304931 | 3300021178 | Soil | DMSSMEKDILSMKEPVFAVHPRVAFGLSEKKFIGSATRWKFVT |
| Ga0210408_112550731 | 3300021178 | Soil | SMKVDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE |
| Ga0210396_105518861 | 3300021180 | Soil | LAQYERKYKFDMSSMKADILAMKEPVFAVRPQLVFGLWEKYFQSKSTRWKFE |
| Ga0210396_108336021 | 3300021180 | Soil | AHERKYKFDMSTMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKFE |
| Ga0210393_103378611 | 3300021401 | Soil | ERKYKFDMSKMKQDILSMKEPIFAVRPRVVFALWEKHFAGTSTRWTFAEK |
| Ga0210393_116807941 | 3300021401 | Soil | KGDILSMKEPVFAVRPRVVFALWEKHFQNKSTRWEFL |
| Ga0210385_102744931 | 3300021402 | Soil | RKCLPACEKKYKFDLSSMRDGILSMKEPVFAVRPRVVFGLWEKYFQSKSTRWKFE |
| Ga0210397_110789841 | 3300021403 | Soil | SKMKEDMLSMKEPVFAVRPKTVFALWEKYFQSKSTRWRFE |
| Ga0210386_101234751 | 3300021406 | Soil | SRRKFLSTYQRKYKFDMSSMKDDILSLKEPVFAVRPRVVFGFWEKHFQSKSTRWKFA |
| Ga0210386_110656982 | 3300021406 | Soil | MEGMKDDILSMKEPVFSVRPRVVFGLWEKHFQSKSTRWKLE |
| Ga0210394_101085191 | 3300021420 | Soil | ERKYKFDMSKMKDDILSMKEPIFTVRPRVVFGLWEKEFIGKSTRWKFA |
| Ga0210394_106325532 | 3300021420 | Soil | FLAKYKPKYNFDMSSMKDDILSMKEPVFAVRPRVVFALWEKFFQTKSTRWKFE |
| Ga0210394_114003382 | 3300021420 | Soil | LSSFDMSSMEKDILSMKEPVFAVHPRVAFGLSEKKFIGSATRWKFVT |
| Ga0210384_101131283 | 3300021432 | Soil | MSTMKDDILSMKEPVFAVRPHTVFGFWEKYFVEKSTRWVFE |
| Ga0210384_102932332 | 3300021432 | Soil | FNMDSMKQDILSMKEPVFVVRPRLAFGLYEKKFMSSATRWKFSS |
| Ga0210391_100689072 | 3300021433 | Soil | MEQDILSMKEPVFAVHPRVVFGLWEKEFVGKSTRWKFEPQQPD |
| Ga0187846_104252832 | 3300021476 | Biofilm | YKFDLSSMKDDLLSMKEPVYAVRPKVVFAFWEKYFQSKSTRWKFE |
| Ga0210402_119704241 | 3300021478 | Soil | PVYERKYKFDMGAMKADILSMKEPVFAVRPRVVFGLWEKYFVGKSTRWEF |
| Ga0210409_111513432 | 3300021559 | Soil | YQGKYSFDMSSMKQDILSMKEPVFAVRPRVVFGLWEKHFPSKSTRWKFE |
| Ga0126371_120433772 | 3300021560 | Tropical Forest Soil | MKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE |
| Ga0213852_14838151 | 3300021858 | Watersheds | KEDLLSMKEPVFAIRPRMVFGLWEKHFQNKSTRWKFE |
| Ga0213853_113415651 | 3300021861 | Watersheds | RRKLIPAYEKKYTFDLSTMKDDLLSMKEPVFAIRPRVVFGLWEKHFQSKSTRWKFE |
| Ga0242659_10140772 | 3300022522 | Soil | PCERKYSFDLSKMKSDILSMKEPVFAVRPRVVFGLWEKEFIGKSTRWTFEEQ |
| Ga0242659_10396731 | 3300022522 | Soil | KMKPDILSMKEPIFTVRPRVVFGLWEKEFVEKSTRWTFERQ |
| Ga0242659_10622542 | 3300022522 | Soil | KYKFDMGAMKKDILSMKEPVFTVRPRVAFGLWEKYFQGKSTRWRFV |
| Ga0242657_11565971 | 3300022722 | Soil | NFDMSKMKPDILSMKEPIFAVRPRVVFGLWEKEFVDKSTRWTFERQ |
| Ga0224558_11201652 | 3300023090 | Soil | GMEQDILSMKEPVFAVRPRVVFGLWEKEFVGKSTRWKFE |
| Ga0224556_11289121 | 3300024295 | Soil | KFDMKGMEQDILSMKEPVFAVRPNTVFGLWEKHFVSKSTRWKF |
| Ga0207416_11316251 | 3300025134 | Iron-Sulfur Acid Spring | YKFSLATMKDDILSMKEPVYSVRPRVVFGLWEKHFQDKSTRWKFES |
| Ga0208935_10235031 | 3300025414 | Peatland | KQDILAMKEPVFAVRPRVVFGLWEKEFVDRSTRWKFAST |
| Ga0208190_10653862 | 3300025473 | Peatland | LPKYERKYKFDMKGMEPDILSMKEPVFAVRPRVVFGLWEKEFVGKSTRWKFE |
| Ga0207699_101280951 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DMAGMEKDILSMKEPVFAVRPRIVFGLYEKKFVNSATRWKFAG |
| Ga0207649_101462851 | 3300025920 | Corn Rhizosphere | YHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS |
| Ga0207664_114184712 | 3300025929 | Agricultural Soil | SKMKDDLLSMKEPVFAVRPKVVFALWEKYFQTKSTRWRFE |
| Ga0207664_115386811 | 3300025929 | Agricultural Soil | GMKKDIRSMKEPVFAVRPRLVFGLWEKHFIGKSTRWTF |
| Ga0207686_104138452 | 3300025934 | Miscanthus Rhizosphere | SMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWKFKG |
| Ga0207711_103959822 | 3300025941 | Switchgrass Rhizosphere | DMSGMAQDILSMKEPVFAVRPNLVFGLYEKKFMESATRWRFKG |
| Ga0207667_111746042 | 3300025949 | Corn Rhizosphere | SSMKDDILSMKEPVFAVLPRVVFALWEKHFQSKSTRWEFG |
| Ga0207702_105817512 | 3300026078 | Corn Rhizosphere | DFDMSTMAKDILEMKEPVFAVRPKVVFGLYEKKFMSSATRWTFKG |
| Ga0207702_119000541 | 3300026078 | Corn Rhizosphere | EFLKKYQPKYHFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWKFKP |
| Ga0207648_117762942 | 3300026089 | Miscanthus Rhizosphere | HFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWMFKG |
| Ga0207852_10309782 | 3300026959 | Tropical Forest Soil | RKYKWDLSTMKEGMLSMKEPVFAVRPKVVFGLWEEHFQSKSTRWKFE |
| Ga0208237_10103602 | 3300027080 | Forest Soil | AMKDDILSMKEPVFAVRPRVVFGLWEKHFVGKTTRWVFK |
| Ga0208603_10047683 | 3300027109 | Forest Soil | MKQDILSMKEPVFAVRPRVVFGLWEKDFVGKSTRWKIE |
| Ga0207780_10593531 | 3300027313 | Tropical Forest Soil | KMLPLYERKYKFDMSTMKADILSMKEPVYAVRPRLVFAMWEKHFQSKSTRWKFE |
| Ga0209419_10719821 | 3300027537 | Forest Soil | LNCKFLAKYTGKYKFDMSSMQDDILSMKEPVFAVRPRVVFALWVRHFQGKSTGWKFG |
| Ga0209115_11459162 | 3300027567 | Forest Soil | ERKYKFDMKGIEQDILSMKEPVFAVRPRVAFGLWEKEFVGKATRWKFEKVKRRRA |
| Ga0209733_10469142 | 3300027591 | Forest Soil | LPTYERKYKFDMKAMKQDILSMKEPVFQVRPRAVFGLWEKYFVEKSTRWKFE |
| Ga0208988_10352552 | 3300027633 | Forest Soil | KWDMSAMKEDILTLKEPVFAVRPRVVFGFWEKEFMGKSTRWRFE |
| Ga0208827_11616731 | 3300027641 | Peatlands Soil | TYERKYKFDMGSMKDDILSMKEPIFAVRPRLVFGLWEKEFIGKSTRWKFD |
| Ga0209117_11884022 | 3300027645 | Forest Soil | ILSMKEPVFAVRPRVVFGLWEKKFMEQTTRWIFGSSDS |
| Ga0209060_105698352 | 3300027826 | Surface Soil | KLLPLYEKKYKFDMSKMKDDILSMKEPVFAVRPRVVFALWEKHFQGKSTRWIFE |
| Ga0209580_105089482 | 3300027842 | Surface Soil | FNMKGMEDDILSMKEPVFAVRPRVVFGLWEKYFVEKSTRWTFE |
| Ga0209275_104514682 | 3300027884 | Soil | GAMKKDILSMKEPVFTVRPRVAFGLWEKYFQGKSTRWRFV |
| Ga0209380_104716591 | 3300027889 | Soil | DMSTMKQDILSMKEPVFAVRPRVVFGVWEKHFMEKTTRWTFE |
| Ga0209006_100967161 | 3300027908 | Forest Soil | MSSMKDDILSMKEPVFAVRPKVVFALWEKHFQTRSTRWKFE |
| Ga0265350_1037242 | 3300028013 | Soil | KYKFDMGAMKKDILSMKEPVFAVRPRVVFGLWEKHFVGKSTRWTFD |
| Ga0302152_102354062 | 3300028572 | Bog | MSKMKADILSMKEPVFAVRPRVVFGLWEKEFIEKSTRWTFE |
| Ga0302227_102374973 | 3300028795 | Palsa | DMSGMKQGILSMKEPVFAVRPRAVFGLWEKYFVGKSTRWRLK |
| Ga0302230_102100721 | 3300028871 | Palsa | GMKNDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE |
| Ga0302230_103713772 | 3300028871 | Palsa | TYERKYTFDMGGMKQDILSMKEPVFAVRPSVAFGLWEKHFVGKSTRWKFE |
| Ga0308309_100665171 | 3300028906 | Soil | DMGAMKKDILSMKEPVFAVRPRVAFGLWEKHFVGKSTRWRFD |
| Ga0308309_117401772 | 3300028906 | Soil | ILSMKEPIFTVRPRVVFGLWEKEFVEKSTRWTFERQ |
| Ga0311361_109417461 | 3300029911 | Bog | ERKYKFDMKGMKHDILSMKEPVFAVRPRLVFGLWEKEFVGKSTRWKF |
| Ga0311359_105665211 | 3300029914 | Bog | KFLSAYERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPGP |
| Ga0311326_100354901 | 3300029917 | Bog | PARRKFLSAYERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPG |
| Ga0311330_100603011 | 3300029945 | Bog | MKNYILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE |
| Ga0311330_100977363 | 3300029945 | Bog | RFLSAYERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPGP |
| Ga0311338_100174855 | 3300030007 | Palsa | MSGMKQGILSMKEPVFAVRPRAVFGLWEKYFVGKSTRWRLK |
| Ga0311344_106232371 | 3300030020 | Bog | NDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE |
| Ga0302191_102698931 | 3300030049 | Bog | ERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPGP |
| Ga0311370_101270751 | 3300030503 | Palsa | MKGMKDDILSMNEPVFAVRPGLVFGLWEKHFQSKATRWKFESIRFPLRV |
| Ga0311357_111596971 | 3300030524 | Palsa | YKFDMKGMEQEILSMKEPVFAVRPRVVFGFWEKHFAGKSTRWKFE |
| Ga0311356_115743602 | 3300030617 | Palsa | HVKHWLLPPYEKKYKFDMSKMKDDILSMKEPVFVVRPRVVFGLWEKYFQSKSTRWTFE |
| Ga0302310_103187731 | 3300030737 | Palsa | RKFLPVYERKYKFDMSGMKNDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE |
| Ga0302312_101051241 | 3300030746 | Palsa | RRKFLPVYERKYKFDMSGMKNDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE |
| Ga0265765_10397052 | 3300030879 | Soil | IYERKYKFSMKGMEQDILSMKEPVFAVRPRVVFGLWEKEFVGKATRWKFEKAK |
| Ga0170824_1034098372 | 3300031231 | Forest Soil | EKDILAMKEPVFAIRPRVVFGLYEKKFVSSATRWKFTK |
| Ga0265332_102608452 | 3300031238 | Rhizosphere | GSMKDGILSMKEPVFAVRPRVVFGLSEKHFQSKSTRWKFE |
| Ga0265340_103056641 | 3300031247 | Rhizosphere | DMSSMKDDILAMKEPVFAVRPRVVFGLSEKYFQSKSTRWKFE |
| Ga0302318_105583671 | 3300031258 | Bog | DMSKMKADILSMKEPVFAVRPRVVFGLWEKEFIEKSTRWTFE |
| Ga0302326_100436989 | 3300031525 | Palsa | QEILSMKEPVFAVRPRVVFGFWEKHFAGKSTRWKFE |
| Ga0310686_1029179502 | 3300031708 | Soil | LSMKEPVFAVRPRVVFGLWEKEFVGKATRWKFEKAKRRRA |
| Ga0310686_1035330341 | 3300031708 | Soil | MKKDILSMKEPVFTLRPRVAFGLWEKYFQGKSTRWRFV |
| Ga0310686_1054443102 | 3300031708 | Soil | EDILSMKEPVFAVRPRVVFGLWEKQFIGKSTRWTFERQ |
| Ga0310686_1073804761 | 3300031708 | Soil | EGMKDDILSMKEPVFAVRPRVVFGLWEKHFQSKSTRWKFEV |
| Ga0310686_1086420431 | 3300031708 | Soil | LSQYQRKYKFDMSSMKLDILSMKEPVFQIRPRVVFGLWEKHFQSKSTRWKFA |
| Ga0310686_1135626181 | 3300031708 | Soil | RKYSFDMSKMKADILSMKEPIFAVRPRVVFGLWEKQFIEKSTRWTFEGK |
| Ga0307476_102119291 | 3300031715 | Hardwood Forest Soil | ERKYKFDMGAMKDDILSMKEPVFAVRPRLVFAMWEKHFQSKSTRWKFE |
| Ga0307469_120289161 | 3300031720 | Hardwood Forest Soil | QPKYHFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWKFRR |
| Ga0307477_102864011 | 3300031753 | Hardwood Forest Soil | KHKFDMKGMKEDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKF |
| Ga0306925_106074881 | 3300031890 | Soil | KDDILSMKEPVFAVRPRLVFAMWEKHFQSRSTRWKFE |
| Ga0308176_108072091 | 3300031996 | Soil | MQEGILSMKEPVFSVRPQVVFALWEKYFQDRSTRWQFE |
| Ga0307470_103576361 | 3300032174 | Hardwood Forest Soil | PAYERKYKFDMSTMKDDILSMKEPVIAVRPRVVFAMWEKYFQSKSTRWKFE |
| Ga0335085_108017191 | 3300032770 | Soil | DMSTMKEDILSMKEPVFAVRPRVVFAMWEKHFQTKSTRWKFN |
| Ga0335079_104503751 | 3300032783 | Soil | RKYKFDMSLMKDDILSMKEPVFTVRPRVVFALWEKHFQNKSTRWKF |
| Ga0335079_116858342 | 3300032783 | Soil | KFDLSKMKDDMLAMKEPVFAVRPRVVFAMWEKHFQSRSTRWKFE |
| Ga0335081_1002663712 | 3300032892 | Soil | LASMQADLLSMKEPVFAVRPRVVFGLWEENFQSKSTRWKFE |
| Ga0335081_121411802 | 3300032892 | Soil | KFDMSSMKDGILSMKEPVFTVRPRVVFALWEKHFQKNSTRWKFEQ |
| Ga0335076_100458633 | 3300032955 | Soil | TMRADILSMKEPVFAVRPRVVFALWEKHFQGKSTRWKFE |
| Ga0335077_105581402 | 3300033158 | Soil | ARKKMLPVYERKYKFDMSTMKDDILSMKEPVFSLRPQTVFAMYEKHFQTKSTRWKFE |
| Ga0318519_109649121 | 3300033290 | Soil | YERKYKFDMSKMKDDILSMKEPVFAVRPRLVFAMWEKHFQSRSTRWKFE |
| Ga0370515_0071766_16_141 | 3300034163 | Untreated Peat Soil | MSKMKNDILSMKEPVFAVRPRVVFGLWEKYFAGKSTRWKFE |
| ⦗Top⦘ |