NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020237

Metagenome / Metatranscriptome Family F020237

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020237
Family Type Metagenome / Metatranscriptome
Number of Sequences 225
Average Sequence Length 42 residues
Representative Sequence MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAA
Number of Associated Samples 193
Number of Associated Scaffolds 225

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.55 %
% of genes near scaffold ends (potentially truncated) 99.11 %
% of genes from short scaffolds (< 2000 bps) 86.22 %
Associated GOLD sequencing projects 182
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(22.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.889 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.73%    β-sheet: 0.00%    Coil/Unstructured: 46.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 225 Family Scaffolds
PF03544TonB_C 75.56
PF13185GAF_2 10.22
PF13492GAF_3 1.33
PF01590GAF 1.33
PF13426PAS_9 0.89
PF00072Response_reg 0.44
PF08448PAS_4 0.44
PF00158Sigma54_activat 0.44
PF02954HTH_8 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 225 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 75.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.67 %
UnclassifiedrootN/A9.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig18879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis605Open in IMG/M
3300001471|JGI12712J15308_10020293All Organisms → cellular organisms → Bacteria → Acidobacteria1749Open in IMG/M
3300001593|JGI12635J15846_10048855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3240Open in IMG/M
3300001915|JGI24741J21665_1058128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis570Open in IMG/M
3300002245|JGIcombinedJ26739_100335661All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1393Open in IMG/M
3300002908|JGI25382J43887_10115273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1405Open in IMG/M
3300003296|Ga0006840J48914_126497Not Available601Open in IMG/M
3300004080|Ga0062385_10144025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1221Open in IMG/M
3300004091|Ga0062387_100033453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2299Open in IMG/M
3300004091|Ga0062387_100069657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1774Open in IMG/M
3300004092|Ga0062389_104891035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter505Open in IMG/M
3300004612|Ga0068961_1268825Not Available622Open in IMG/M
3300004635|Ga0062388_100098916All Organisms → cellular organisms → Bacteria → Acidobacteria2084Open in IMG/M
3300005434|Ga0070709_11793824All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter502Open in IMG/M
3300005538|Ga0070731_10072339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2288Open in IMG/M
3300005543|Ga0070672_100684638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter897Open in IMG/M
3300005553|Ga0066695_10280588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1052Open in IMG/M
3300005554|Ga0066661_10005333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5982Open in IMG/M
3300005554|Ga0066661_10416433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter823Open in IMG/M
3300005564|Ga0070664_101981464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter553Open in IMG/M
3300005577|Ga0068857_101500586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter657Open in IMG/M
3300005591|Ga0070761_10711047All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300005602|Ga0070762_10442111All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300005616|Ga0068852_101153961Not Available795Open in IMG/M
3300005617|Ga0068859_100496172All Organisms → cellular organisms → Bacteria → Acidobacteria1316Open in IMG/M
3300005712|Ga0070764_10387076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium824Open in IMG/M
3300005764|Ga0066903_106309910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter619Open in IMG/M
3300005842|Ga0068858_102004082Not Available572Open in IMG/M
3300005891|Ga0075283_1025765All Organisms → cellular organisms → Bacteria → Acidobacteria942Open in IMG/M
3300005903|Ga0075279_10019451All Organisms → cellular organisms → Bacteria → Acidobacteria969Open in IMG/M
3300005944|Ga0066788_10041641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1068Open in IMG/M
3300006052|Ga0075029_100471711All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300006059|Ga0075017_100343977All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300006059|Ga0075017_100613447All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300006173|Ga0070716_100269329All Organisms → cellular organisms → Bacteria → Acidobacteria1169Open in IMG/M
3300006175|Ga0070712_100113696All Organisms → cellular organisms → Bacteria → Acidobacteria2025Open in IMG/M
3300006175|Ga0070712_101184003All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300006176|Ga0070765_100850542All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300006755|Ga0079222_10911287All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300006800|Ga0066660_10669005All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300006854|Ga0075425_101816897All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300007258|Ga0099793_10203178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium950Open in IMG/M
3300007788|Ga0099795_10387151All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300009088|Ga0099830_10234841All Organisms → cellular organisms → Bacteria → Acidobacteria1446Open in IMG/M
3300009088|Ga0099830_11707281All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300009137|Ga0066709_100556217All Organisms → cellular organisms → Bacteria → Acidobacteria1626Open in IMG/M
3300009174|Ga0105241_11328866All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300009521|Ga0116222_1162346All Organisms → cellular organisms → Bacteria → Acidobacteria962Open in IMG/M
3300009523|Ga0116221_1511928All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300009525|Ga0116220_10425329All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300009545|Ga0105237_10499368All Organisms → cellular organisms → Bacteria → Acidobacteria1223Open in IMG/M
3300009545|Ga0105237_12431971Not Available534Open in IMG/M
3300009638|Ga0116113_1046166All Organisms → cellular organisms → Bacteria → Acidobacteria1001Open in IMG/M
3300010043|Ga0126380_11112115All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300010048|Ga0126373_11100669All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300010339|Ga0074046_10057802All Organisms → cellular organisms → Bacteria → Acidobacteria2558Open in IMG/M
3300010358|Ga0126370_10540482All Organisms → cellular organisms → Bacteria → Acidobacteria993Open in IMG/M
3300010360|Ga0126372_11386747Not Available735Open in IMG/M
3300010361|Ga0126378_12706677All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300010375|Ga0105239_10331378All Organisms → cellular organisms → Bacteria → Acidobacteria1717Open in IMG/M
3300010376|Ga0126381_100402974All Organisms → cellular organisms → Bacteria → Acidobacteria1906Open in IMG/M
3300010376|Ga0126381_100528132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1669Open in IMG/M
3300010398|Ga0126383_12546170All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300010403|Ga0134123_12982179All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300010937|Ga0137776_1044812Not Available814Open in IMG/M
3300011069|Ga0138592_1005845Not Available640Open in IMG/M
3300011119|Ga0105246_10466151All Organisms → cellular organisms → Bacteria → Acidobacteria1065Open in IMG/M
3300012189|Ga0137388_10875132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300012189|Ga0137388_11109779All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300012201|Ga0137365_11230707All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300012203|Ga0137399_10234814All Organisms → cellular organisms → Bacteria → Acidobacteria1500Open in IMG/M
3300012206|Ga0137380_10287669All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1474Open in IMG/M
3300012207|Ga0137381_10758782All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300012208|Ga0137376_10502627All Organisms → cellular organisms → Bacteria → Acidobacteria1052Open in IMG/M
3300012210|Ga0137378_10758185All Organisms → cellular organisms → Bacteria → Acidobacteria882Open in IMG/M
3300012211|Ga0137377_10610949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1027Open in IMG/M
3300012285|Ga0137370_10044591All Organisms → cellular organisms → Bacteria → Acidobacteria2360Open in IMG/M
3300012349|Ga0137387_11080194All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300012359|Ga0137385_10250698All Organisms → cellular organisms → Bacteria → Acidobacteria1533Open in IMG/M
3300012363|Ga0137390_10752226All Organisms → cellular organisms → Bacteria → Acidobacteria934Open in IMG/M
3300012363|Ga0137390_10929052All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300012469|Ga0150984_106308955All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300012918|Ga0137396_10311720All Organisms → cellular organisms → Bacteria → Acidobacteria1164Open in IMG/M
3300012927|Ga0137416_10555047All Organisms → cellular organisms → Bacteria → Acidobacteria995Open in IMG/M
3300012927|Ga0137416_10738949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300012929|Ga0137404_12097031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300012930|Ga0137407_10369114All Organisms → cellular organisms → Bacteria → Acidobacteria1324Open in IMG/M
3300012930|Ga0137407_12093072All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300012971|Ga0126369_10456825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1327Open in IMG/M
3300012988|Ga0164306_10863287Not Available734Open in IMG/M
3300013306|Ga0163162_12438797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300013306|Ga0163162_13303466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis516Open in IMG/M
3300013772|Ga0120158_10487499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300014166|Ga0134079_10129715All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300014168|Ga0181534_10402675All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300014493|Ga0182016_10389189All Organisms → cellular organisms → Bacteria → Acidobacteria828Open in IMG/M
3300014654|Ga0181525_10630155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300014968|Ga0157379_11503061All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300015373|Ga0132257_101469880All Organisms → cellular organisms → Bacteria → Acidobacteria869Open in IMG/M
3300015373|Ga0132257_101656419All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300015374|Ga0132255_100100407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3929Open in IMG/M
3300016357|Ga0182032_11762870All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300016404|Ga0182037_10280263All Organisms → cellular organisms → Bacteria → Acidobacteria1331Open in IMG/M
3300017822|Ga0187802_10044407All Organisms → cellular organisms → Bacteria → Acidobacteria1613Open in IMG/M
3300017933|Ga0187801_10349720All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300017943|Ga0187819_10019437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3940Open in IMG/M
3300017943|Ga0187819_10205126All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300017943|Ga0187819_10274252All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300017959|Ga0187779_10435980All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300017961|Ga0187778_11261504Not Available519Open in IMG/M
3300017970|Ga0187783_10978812All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300017972|Ga0187781_10158999All Organisms → cellular organisms → Bacteria1588Open in IMG/M
3300017975|Ga0187782_10086012All Organisms → cellular organisms → Bacteria2306Open in IMG/M
3300018019|Ga0187874_10428914All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300018026|Ga0187857_10073761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1696Open in IMG/M
3300018030|Ga0187869_10053064All Organisms → cellular organisms → Bacteria → Acidobacteria2134Open in IMG/M
3300018038|Ga0187855_10094001All Organisms → cellular organisms → Bacteria → Acidobacteria1816Open in IMG/M
3300018043|Ga0187887_10602332All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300018044|Ga0187890_10038238All Organisms → cellular organisms → Bacteria → Acidobacteria2893Open in IMG/M
3300018085|Ga0187772_10127496All Organisms → cellular organisms → Bacteria → Acidobacteria1665Open in IMG/M
3300018086|Ga0187769_11551243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300018088|Ga0187771_11163275Not Available654Open in IMG/M
3300018090|Ga0187770_10281978All Organisms → cellular organisms → Bacteria → Acidobacteria1291Open in IMG/M
3300018468|Ga0066662_11283447All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300019789|Ga0137408_1083049All Organisms → cellular organisms → Bacteria → Acidobacteria1784Open in IMG/M
3300019870|Ga0193746_1031706All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300019881|Ga0193707_1147548All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300019887|Ga0193729_1094236Not Available1149Open in IMG/M
3300020000|Ga0193692_1049248All Organisms → cellular organisms → Bacteria → Acidobacteria958Open in IMG/M
3300020021|Ga0193726_1300266All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300020580|Ga0210403_11073670All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300020582|Ga0210395_10677451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300020583|Ga0210401_10024148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5823Open in IMG/M
3300020583|Ga0210401_10128149All Organisms → cellular organisms → Bacteria → Acidobacteria2379Open in IMG/M
3300020583|Ga0210401_10362452All Organisms → cellular organisms → Bacteria → Acidobacteria1311Open in IMG/M
3300021170|Ga0210400_11174552All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300021181|Ga0210388_10370816All Organisms → cellular organisms → Bacteria → Acidobacteria1259Open in IMG/M
3300021181|Ga0210388_11137330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300021401|Ga0210393_10072438All Organisms → cellular organisms → Bacteria → Acidobacteria2721Open in IMG/M
3300021402|Ga0210385_10089672All Organisms → cellular organisms → Bacteria → Acidobacteria2126Open in IMG/M
3300021403|Ga0210397_10407205Not Available1018Open in IMG/M
3300021405|Ga0210387_10980097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300021406|Ga0210386_11274450All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300021406|Ga0210386_11342488All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300021420|Ga0210394_10611320All Organisms → cellular organisms → Bacteria → Acidobacteria958Open in IMG/M
3300021432|Ga0210384_10001842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis27258Open in IMG/M
3300021432|Ga0210384_10463481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1141Open in IMG/M
3300021432|Ga0210384_11833369All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300021433|Ga0210391_10605054All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300021478|Ga0210402_10899041All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300021478|Ga0210402_12003822Not Available505Open in IMG/M
3300021559|Ga0210409_10310419All Organisms → cellular organisms → Bacteria → Acidobacteria1420Open in IMG/M
3300021560|Ga0126371_11811065All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300022730|Ga0224570_100731All Organisms → cellular organisms → Bacteria → Acidobacteria2623Open in IMG/M
3300024186|Ga0247688_1082636All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300025223|Ga0207672_1002467All Organisms → cellular organisms → Bacteria → Acidobacteria1117Open in IMG/M
3300025906|Ga0207699_11103510All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300025910|Ga0207684_10547749Not Available990Open in IMG/M
3300025917|Ga0207660_10700986All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300025921|Ga0207652_11376233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300025928|Ga0207700_10491700All Organisms → cellular organisms → Bacteria → Acidobacteria1085Open in IMG/M
3300025929|Ga0207664_11482431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300025929|Ga0207664_11615849All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300025939|Ga0207665_11195146All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300025949|Ga0207667_10626830All Organisms → cellular organisms → Bacteria → Acidobacteria1083Open in IMG/M
3300026121|Ga0207683_10205209All Organisms → cellular organisms → Bacteria → Acidobacteria1792Open in IMG/M
3300026294|Ga0209839_10084306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1101Open in IMG/M
3300026325|Ga0209152_10006337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4263Open in IMG/M
3300026467|Ga0257154_1002889All Organisms → cellular organisms → Bacteria → Acidobacteria2118Open in IMG/M
3300026552|Ga0209577_10021740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5667Open in IMG/M
3300027587|Ga0209220_1063777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium980Open in IMG/M
3300027641|Ga0208827_1059193All Organisms → cellular organisms → Bacteria → Acidobacteria1250Open in IMG/M
3300027648|Ga0209420_1057894All Organisms → cellular organisms → Bacteria → Acidobacteria1151Open in IMG/M
3300027681|Ga0208991_1042474All Organisms → cellular organisms → Bacteria → Acidobacteria1374Open in IMG/M
3300027696|Ga0208696_1158299Not Available731Open in IMG/M
3300027729|Ga0209248_10016267All Organisms → cellular organisms → Bacteria → Acidobacteria2330Open in IMG/M
3300027842|Ga0209580_10513741All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300027855|Ga0209693_10387598All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300027855|Ga0209693_10524152All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300027867|Ga0209167_10156933All Organisms → cellular organisms → Bacteria → Acidobacteria1196Open in IMG/M
3300027879|Ga0209169_10189834All Organisms → cellular organisms → Bacteria → Acidobacteria1073Open in IMG/M
3300027894|Ga0209068_10136545All Organisms → cellular organisms → Bacteria → Acidobacteria1318Open in IMG/M
3300027895|Ga0209624_10091173All Organisms → cellular organisms → Bacteria → Acidobacteria1983Open in IMG/M
3300027898|Ga0209067_10893835All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300027986|Ga0209168_10046414All Organisms → cellular organisms → Bacteria → Acidobacteria2336Open in IMG/M
3300027986|Ga0209168_10415190All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300028013|Ga0265350_104193All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300028047|Ga0209526_10317206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1051Open in IMG/M
3300028047|Ga0209526_10979307Not Available507Open in IMG/M
3300028651|Ga0302171_10099925Not Available698Open in IMG/M
3300028906|Ga0308309_10158801All Organisms → cellular organisms → Bacteria → Acidobacteria1827Open in IMG/M
3300029636|Ga0222749_10100293All Organisms → cellular organisms → Bacteria → Acidobacteria1359Open in IMG/M
3300030051|Ga0302195_10336368All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300030058|Ga0302179_10009058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5224Open in IMG/M
3300030617|Ga0311356_11810836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300030706|Ga0310039_10105401All Organisms → cellular organisms → Bacteria → Acidobacteria1175Open in IMG/M
3300030706|Ga0310039_10187982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300030760|Ga0265762_1050609All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300030862|Ga0265753_1104445All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300031057|Ga0170834_112740630All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300031128|Ga0170823_16410741All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300031231|Ga0170824_124320605All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300031234|Ga0302325_10255940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2907Open in IMG/M
3300031446|Ga0170820_11358339All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300031446|Ga0170820_15705080All Organisms → cellular organisms → Bacteria → Acidobacteria1206Open in IMG/M
3300031753|Ga0307477_10868875All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300031754|Ga0307475_11076059All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300031823|Ga0307478_10424786All Organisms → cellular organisms → Bacteria → Acidobacteria1103Open in IMG/M
3300031879|Ga0306919_10847604All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300031962|Ga0307479_10413215All Organisms → cellular organisms → Bacteria → Acidobacteria1334Open in IMG/M
3300031962|Ga0307479_11645545All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300032160|Ga0311301_11130849All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300032180|Ga0307471_100149916All Organisms → cellular organisms → Bacteria → Acidobacteria2241Open in IMG/M
3300032180|Ga0307471_101489131All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300032180|Ga0307471_102531693Not Available649Open in IMG/M
3300032783|Ga0335079_10791522All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300032828|Ga0335080_11803460Not Available597Open in IMG/M
3300032829|Ga0335070_10186550All Organisms → cellular organisms → Bacteria → Acidobacteria2076Open in IMG/M
3300033134|Ga0335073_10138627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3096Open in IMG/M
3300033158|Ga0335077_10079689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3891Open in IMG/M
3300033158|Ga0335077_10933574All Organisms → cellular organisms → Bacteria → Acidobacteria871Open in IMG/M
3300033433|Ga0326726_11860564All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300034065|Ga0334827_057212All Organisms → cellular organisms → Bacteria → Acidobacteria1411Open in IMG/M
3300034163|Ga0370515_0049541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1854Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.11%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.22%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.22%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.22%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.22%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.33%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.33%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.33%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.44%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.44%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.44%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.44%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.44%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.44%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.44%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.44%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.44%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.44%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.44%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.44%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001915Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003296Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004612Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011069Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022730Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2Host-AssociatedOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300025223Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026006Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028013Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028651Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_011531202124908043SoilMTIAKKLYISFGAVLAMVLVLFLVNYLAVQREHSA
JGI12712J15308_1002029313300001471Forest SoilMTIGKKLYGSFGIILTMVVVLFGVNWFAVQREHAAKSAAA
JGI12635J15846_1004885533300001593Forest SoilMTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMAETTD
JGI24741J21665_105812823300001915Corn RhizosphereMTIGKKLYVNFGAVLAMVVVLFLVNFFAVQREHVAKAAAAASLDMAEAT
JGIcombinedJ26739_10033566133300002245Forest SoilMTIGKKLYLNFGIILSMVVVLFLVNLLAVQREHAAKA
JGI25382J43887_1011527333300002908Grasslands SoilMTIGRKLYSSFGAVLAMVLVLFLVNLTAVYREHSAKAAAGKALQLADAS
Ga0006840J48914_12649723300003296Peatlands SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQALQMAETTD
Ga0062385_1014402533300004080Bog Forest SoilMTISKKLYMNFGAVLAMVIVLFLVNLIAVEREHAAKAAASQ
Ga0062387_10003345333300004091Bog Forest SoilMTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAAS
Ga0062387_10006965733300004091Bog Forest SoilMTIGKKLYLNFGIILTTVMVLFLVNWSAVQREHSAKAAAAA
Ga0062389_10489103523300004092Bog Forest SoilMTISKKLYMNFGAVLAMVIVLFLVNLIAVEREHAAKAAASQALQ
Ga0068961_126882513300004612Peatlands SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQALQMAET
Ga0062388_10009891613300004635Bog Forest SoilMTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAASQ
Ga0070709_1179382423300005434Corn, Switchgrass And Miscanthus RhizosphereMKIGKKLYLNFGAVLAMVVVLFLVNLIAVQREHSAKAAASQ
Ga0070731_1007233943300005538Surface SoilMTIGKKLYVNFGAVLAMVVVLFLVIMVAVQREHSAKAS
Ga0070672_10068463813300005543Miscanthus RhizosphereMTIGKKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQ
Ga0066695_1028058833300005553SoilMTIGKKLYMNFGAILAMVLVLFLINLVAVQREHSAKAAASQAL
Ga0066661_1000533313300005554SoilMTIGKKLYVNFGAILAMVLVLFLINLVAVQSEHSAKAAASQALALADAT
Ga0066661_1041643323300005554SoilMTIGRKLYANFGAVLAMVLVLFLVNYFAVQREHSAKAAA
Ga0070664_10198146413300005564Corn RhizosphereMTLGKKLYLNFGFILGMVLLLFLVNYLAVEREHSAKEAA
Ga0068857_10150058613300005577Corn RhizosphereMTIGRKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQ
Ga0070761_1071104713300005591SoilMTIGKKLYRGFAYVLSMVLVLFIVNLLAVQREHAAKAAATASL
Ga0070762_1044211123300005602SoilMTIAKQLYLSFGIILIMVVLLFVVNWSAVQREQDAKA
Ga0068852_10115396123300005616Corn RhizosphereMTIAKKLYISFGAVLAMVLVLFLVNYLAVRREHSAK
Ga0068859_10049617213300005617Switchgrass RhizosphereMSLSKKLYLNFGFVLAMVIVLFLVIVVAVQREHSAKAAAAQALQVTEGTDK
Ga0070764_1038707613300005712SoilMTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAA
Ga0066903_10630991023300005764Tropical Forest SoilMSMSKKLYLNFGFILAMVVVLFLVIVVAVQREHSAKAAAAQALQVTEGTDKVR
Ga0068858_10200408213300005842Switchgrass RhizosphereMTIAKKLYISFGAVLAMVLVLFLVNYLAVRREHSAKAA
Ga0075283_102576533300005891Rice Paddy SoilMTIGRRLYTNFGAILAMVVMLFLVNMIAVQREHAAKTAAAQSLAMAEATD
Ga0075279_1001945113300005903Rice Paddy SoilMTIGRRLYTNFGAILAMVVMLFLVNMIAVQREHAAKTAAAQSLAMAE
Ga0066788_1004164133300005944SoilMTIGKKLYLNFGIILTMVVVLFLVNLVAVQREHAAKAA
Ga0075029_10047171123300006052WatershedsMKIGKKLYLNFGAVLAMVVVLFLVNLVAVQREHSAKAAASQ
Ga0075017_10034397733300006059WatershedsMTIGRKLYVSFGAVLAMVVVLFAVNLAAVYREHSAKAAASQALQLADATD
Ga0075017_10061344713300006059WatershedsMTIGKKLYVNFGIILTMVLALFLANWLAVRREHDARKASQQSQD
Ga0070716_10026932933300006173Corn, Switchgrass And Miscanthus RhizosphereMTLGKKLYLNFGFILGMVLLLFLVNYLAVEREHSAKEAAAKSLKL
Ga0070712_10011369613300006175Corn, Switchgrass And Miscanthus RhizosphereMTIGRKLYMSFGAVLVMVVVLFAVNLVAVYREHSAK
Ga0070712_10118400333300006175Corn, Switchgrass And Miscanthus RhizosphereMSMSKKLYLNFGIILAMVVMLFLVTWYAVHREHDTKATA
Ga0070765_10085054223300006176SoilMGMTIGKKLYMNFGIILAMVVVLFLVNIIAVQREHAAKAAATASLELED
Ga0079222_1091128723300006755Agricultural SoilMSMSKKLYMNFGIILAMVLVLFLVTWYAVHREHDTKAAASQAM
Ga0066660_1066900513300006800SoilMTIGKKLYMNFGAILAMVLVLFLINLVAVQREHSAKAAASQALSLADATD
Ga0075425_10181689723300006854Populus RhizosphereMSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSAKAAAAQALQVTEGTDKVRS
Ga0099793_1020317813300007258Vadose Zone SoilMTIGKKLYANFGIILTMVIVLFLVNWFAVQREHAATAA
Ga0099795_1038715123300007788Vadose Zone SoilMTIGKKLYMNFGIILVMVVVLFGVNWLAVQREHQAKAAAATSL
Ga0099830_1023484133300009088Vadose Zone SoilMTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSA
Ga0099830_1170728113300009088Vadose Zone SoilMTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAKKAAQQ
Ga0066709_10055621713300009137Grasslands SoilMSIRKNLYLNFGAILVMVIVLLLVNLIAVQREHSAKTAAAQALE
Ga0105241_1132886613300009174Corn RhizosphereMTLGKRLYLNFGFILGMVLLLYVVNYLAVRREHAAKDA
Ga0116222_116234633300009521Peatlands SoilMTIERKLYTNFGIILIMVLVLFLVNWTAVQREHSAK
Ga0116221_151192823300009523Peatlands SoilMTIGKKLYTNFGIILTMVVVLFLVNWFAVQREHAAKAAAA
Ga0116220_1042532923300009525Peatlands SoilMTIGKKLYMNFGVILTMVLVLFLVNWSAVQREHEAKKAAQQSLDLA
Ga0105237_1049936813300009545Corn RhizosphereMSLSKKLYLNFGFVLAMVIVLFLVIVVAVQREHSAKAAAAQALQVT
Ga0105237_1243197113300009545Corn RhizosphereMTIRNKLYRSFGIVLAMVLVLFLVNYFAVQREHSAKTAYTQA
Ga0116113_104616623300009638PeatlandMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQMAATTDK
Ga0126380_1111211513300010043Tropical Forest SoilMTIGKKLYMNFGFILLMVVALFLVTYVAVQREHDAKEAAKKS
Ga0126373_1110066913300010048Tropical Forest SoilMTISKKLYVNFGAVLAMVVVLFLVNMIAVQREHAAKQ
Ga0074046_1005780233300010339Bog Forest SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHNAKAAASQAMQMAE
Ga0126370_1054048233300010358Tropical Forest SoilMTIRRKLYFNFGAILLMVVVLFLVNYLAVRREHGAKA
Ga0126372_1138674733300010360Tropical Forest SoilMSMSKKLYLNFGIILAMVVILFVVTWVTVQREQRA
Ga0126378_1270667713300010361Tropical Forest SoilMTIGRKLYVNFGAILLMVVVLFLVNFVAVQREHGAKTSASQALELADA
Ga0105239_1033137813300010375Corn RhizosphereMSLSKKLYLNFGFVLAMVIVLFLVIVVAVQREHSAKAAAAQALQV
Ga0126381_10040297413300010376Tropical Forest SoilMTIGRKLYVNFGAILLMVVVLFLVNFVAVQREHGAKTSA
Ga0126381_10052813233300010376Tropical Forest SoilMSMSKKLYVNFGCILAMVLILFLVNYFAVQREQTAKSTAAQ
Ga0126383_1254617023300010398Tropical Forest SoilMTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHAAKAAAQSSLELADT
Ga0134123_1298217923300010403Terrestrial SoilMSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSAKAAAA
Ga0137776_104481223300010937SedimentMTISKRLYINFGIILAGLVVLCLVNILAVEREHSARNST
Ga0138592_100584513300011069Peatlands SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQALQMAETT
Ga0105246_1046615113300011119Miscanthus RhizosphereMTIGKKLYVNFGSVLAMVVVLFLVNLVAVQREHAA
Ga0137388_1087513223300012189Vadose Zone SoilMSFGAVLVMVVVLFAVNLAAVYREHSAKASASQALQLADAT
Ga0137388_1110977923300012189Vadose Zone SoilMSISKQLYKNFGYVLSTVIVLLAVNLIAVQREHSAKAAAAQALEMAAT
Ga0137365_1123070713300012201Vadose Zone SoilMTIGKKLYVNFGAILAMVLVLFLINLVAVQREHSAKAAASQA
Ga0137399_1023481413300012203Vadose Zone SoilMTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSAKT
Ga0137380_1028766933300012206Vadose Zone SoilMSISKQLYKNFGYVLFMVLVLLGVNLIAVQREHSAKSAAAQALQMADNT
Ga0137381_1075878223300012207Vadose Zone SoilMTIGKKLYTNCGIILTMVLVLFLVNWSAVQREHAAKAAAAQSLEL
Ga0137376_1050262733300012208Vadose Zone SoilMSIRNKLYINFGAVLAMVIVLFLVNLIAVQREHSAKASAAQALQMA
Ga0137378_1075818533300012210Vadose Zone SoilMTIGKKLYTNFGIILTMVLVLFLVNWSAVQREHAAK
Ga0137377_1061094913300012211Vadose Zone SoilMSISKQLYKNFGYVLSTVIVLLAVNLIAVQREHSAKAAAAQALE
Ga0137370_1004459123300012285Vadose Zone SoilMTIGKKLYVNFGAILAMVLVLFLINLVAVQREHSAKAAA
Ga0137387_1108019423300012349Vadose Zone SoilMSISKQLYKNFGYVLCMVLVLLGVNLIAVQREHSAKSAA
Ga0137385_1025069813300012359Vadose Zone SoilMTIGKKLYTNFGIILTMVVVLFLVNWSAVRRERAAKELAD
Ga0137390_1075222623300012363Vadose Zone SoilMTISKKLYVNFGAVLAMVIVLFLVNLIVVQREHSAKAAASQAL
Ga0137390_1092905223300012363Vadose Zone SoilMSIGKKLYMNFGAVLAMVIVLFLVNLVAVNREHNAKAAAAQA
Ga0150984_10630895533300012469Avena Fatua RhizosphereMTIGKKLYVNFGAVLAMVVVLFLVNLIAVQREHSAK
Ga0137396_1031172013300012918Vadose Zone SoilMTIGKKLYLNFGAVLAMVVVLFLVNLTAVQREHSAKA
Ga0137416_1055504713300012927Vadose Zone SoilMTIGKKLYVNFGIILTMVVVLFMVNWFAVQREHSAKAAAAASV
Ga0137416_1073894923300012927Vadose Zone SoilMSISKKLYMNFGAVLAMVIVLFLVNLVAVQREHSAKA
Ga0137404_1209703113300012929Vadose Zone SoilMTIGKKLYVNFGAILTMVLVLFLINLVAVQREHSAKAA
Ga0137407_1036911433300012930Vadose Zone SoilMTIGKKLYMNFGIILVMVVVLFGVNWLAVQREHTAKAAAAT
Ga0137407_1209307213300012930Vadose Zone SoilMTIGKKLYMNFGAILAMVLVLFLINLVAVQREHSAKAAASQA
Ga0126369_1045682513300012971Tropical Forest SoilMTIGRKLYVNFGAILLMVVVLFLVNFVAVQREHGAKTSASQALE
Ga0164306_1086328723300012988SoilMTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSAKAAASQALELADAT
Ga0163162_1243879723300013306Switchgrass RhizosphereMTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSAKASASQAL*
Ga0163162_1330346613300013306Switchgrass RhizosphereMTIAKKLYISFGAVLAMVLVLFLVNYLAVRREHSAKAAASQAL
Ga0120158_1048749913300013772PermafrostMSISKKLYLNFGIVLSMVVVLFLVTVVAVQREHSAKAASLQALEMADNTANI
Ga0134079_1012971513300014166Grasslands SoilMTIGKKLYVNFGAILAMVLVLFLINLVAVQREHSAKAAASQ
Ga0181534_1040267513300014168BogMTIGKKLYTNFGIILSMVVVLFLVNWSAVQREHAAKAAASASL
Ga0182016_1038918923300014493BogMNFGAILAMVVVLFLINVTAMYRERTTKAAAAQAL
Ga0181525_1063015513300014654BogMTIGRRLYKNFGIILSMAVVLFVVNLVAVQREHAAKDAARA
Ga0157379_1150306123300014968Switchgrass RhizosphereMTIGKKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQSME
Ga0132257_10146988013300015373Arabidopsis RhizosphereMSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSA
Ga0132257_10165641923300015373Arabidopsis RhizosphereMTIGKKLYVNFGIILTMVLALFLANWLAVRREHDAKKAA
Ga0132255_10010040733300015374Arabidopsis RhizosphereMTIGKKLYMNFGFILLMVVALFLVPYVAVQREHDAKEAAKKSL
Ga0182032_1176287013300016357SoilMTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHAAKAAAQ
Ga0182037_1028026333300016404SoilMTIGKKLYVNFGIILSMVVVLFLVNWSAVNREHSAKKAAQKSQDLDEA
Ga0187802_1004440733300017822Freshwater SedimentMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQ
Ga0187801_1034972023300017933Freshwater SedimentMTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMA
Ga0187819_1001943733300017943Freshwater SedimentMTLGKKLYTNFGILLTMVVVLFLVNWSAVQREHTAK
Ga0187819_1020512633300017943Freshwater SedimentMTIGKKLYLNFGVILTMVLVLFLVNWSAVQREHDAKKAAQQSLDLA
Ga0187819_1027425223300017943Freshwater SedimentMTIGKKLYVNFGAVLAMVVVLFLINLIVVQREHSAKAAASQALQMAE
Ga0187779_1043598033300017959Tropical PeatlandMTIGKKLYVNFGIILTMVVALFLASWFAVRREHDAKNSAQQSQNLAKAN
Ga0187778_1126150413300017961Tropical PeatlandMTIGKKLYVRFGAVLATVVVLFLVNYFAVEREHSAKAAASQALKMAET
Ga0187783_1097881223300017970Tropical PeatlandMTIGKKLYVNFGAVLAMVVVLFLVNILAVQREHSAKAAASQALEMAETTD
Ga0187781_1015899923300017972Tropical PeatlandMTIGKKLYVRFGAVLATVVVLFLVNYFAVEREHSA
Ga0187782_1008601223300017975Tropical PeatlandMTIGKKLYVRFGAVLATVVVLFLVNYFAVEREHSAKSAASQ
Ga0187874_1042891423300018019PeatlandMTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAK
Ga0187857_1007376133300018026PeatlandMTIGKKLYKNFGYILSLVVVLFIVNLLAVQREHAAKAAA
Ga0187869_1005306413300018030PeatlandMTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAATA
Ga0187855_1009400143300018038PeatlandMTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAKAAAAASKDL
Ga0187887_1060233223300018043PeatlandMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAAS
Ga0187890_1003823833300018044PeatlandMTIGKKLYMNFGIILAMVVVLFLVNLLAVQREHSAK
Ga0187772_1012749633300018085Tropical PeatlandMTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAAA
Ga0187769_1155124313300018086Tropical PeatlandMSIGKKLYLNFGAILAIVIVLLVINFAAIQREHSGRAATSKALEMA
Ga0187771_1116327513300018088Tropical PeatlandMTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKA
Ga0187770_1028197833300018090Tropical PeatlandMTIRQKLYVNFGAVLAMVVVLLLVNLVAVQREHSAKA
Ga0066662_1128344723300018468Grasslands SoilMTISKKLYINFGAVLAMVVVLFLINIVAVEREHSAKASAQQSLEMAEATDAL
Ga0137408_108304913300019789Vadose Zone SoilMTIGRKLYSSFGAVLAMVLVLFLVNMTAVYREHSA
Ga0193746_103170613300019870SoilMTIGKKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQS
Ga0193707_114754823300019881SoilMTISKKLYMNFGAVLAMVIVLFLINMIAVEREHAAKTAASLALK
Ga0193729_109423613300019887SoilVTIGKKLYLAFGTVLAMVVVLFAVNLWSVHREHSAKAAASQALELADAT
Ga0193692_104924833300020000SoilMSIRKKLYVSFGAVLAMVIVLLLVNLVAVQREHSAKSAAE
Ga0193726_130026623300020021SoilMTISKKLYMNFGAVLAMVIVLFLVNLIAMEREHAANAAA
Ga0210403_1107367023300020580SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKA
Ga0210395_1067745113300020582SoilMTIGKKLYKNFGIILSTVVVLFIVNLLAVQREHAAKAAATASLQ
Ga0210401_1002414853300020583SoilMTIGRKLYVSFGAVLAMVVVLFAVNLAAVYREHSAKAAASQALQLAD
Ga0210401_1012814933300020583SoilMTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAK
Ga0210401_1036245213300020583SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQMAA
Ga0210400_1117455223300021170SoilMTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAKA
Ga0210388_1037081633300021181SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVEREHNAKAAASQALQMASTTDK
Ga0210388_1113733023300021181SoilMTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAATSSLQLAET
Ga0210393_1007243813300021401SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSA
Ga0210385_1008967213300021402SoilMTIGKKLYTNFGIILSMVVVLFLVNWFAVQREHSAKAAAASS
Ga0210397_1040720513300021403SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAK
Ga0210387_1098009723300021405SoilMTIGKKLYKNFGIILIMVVMLFIVNLVAVLREHAAKDA
Ga0210386_1127445013300021406SoilMTIGKKLYRGFAYVLSMVLVLFIVNLLAVQREHAAKAAATA
Ga0210386_1134248823300021406SoilMTIGKKLYMNFGIILAMVVVLFLVNIIAVQREHAAKAAATASLELEDAT
Ga0210394_1061132013300021420SoilMTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAK
Ga0210384_1000184213300021432SoilMTIGKKLYLNFGAVLAMVVVLFLINLTAVQREHSAKAAASQALQMAAT
Ga0210384_1046348133300021432SoilMTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAATASLELAD
Ga0210384_1183336923300021432SoilMTIGRKLYWNFGAILLMVVVLFFVNIVAMYRERSAKA
Ga0210391_1060505423300021433SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAA
Ga0210402_1089904113300021478SoilMTIGRKLYMNFGIILTMVVILFLVNWFAVQREHAAK
Ga0210402_1200382223300021478SoilMTIGKKLYLNFGAVLAMVVVLFLVNLIAVQREHSAKAAASQAM
Ga0210409_1031041933300021559SoilMKIGKKLYVNFGAVLAMVLVLFLVNLIAVRREHSAKAAASQALGLADATD
Ga0126371_1181106513300021560Tropical Forest SoilMTIGKKLYVNFGIILTMVVVLFLVNWSAVRREHAAKELA
Ga0224570_10073133300022730RhizosphereMTIGKKLYMNFGIILTMVVVLFLVNLLAVQREHSAKAAAA
Ga0247688_108263623300024186SoilMTIGKKLYVNFGIILTMVLALFLANWLAVRREHDAKKAAQQSQELA
Ga0207672_100246713300025223Corn, Switchgrass And Miscanthus RhizosphereMTIGKKLYVNFGAVLAMVVVLFLVNFFAVQREHVAKAAAAASLDMAEA
Ga0207699_1110351023300025906Corn, Switchgrass And Miscanthus RhizosphereMTIGKKLYMNFGIILLMVVALFVANWFAVRREHDAKKAAQQSQDL
Ga0207684_1054774933300025910Corn, Switchgrass And Miscanthus RhizosphereMTIGKKLYVNFGAVLAMVLVLFLVNLIAVQREHSAKAAASQA
Ga0207660_1070098613300025917Corn RhizosphereMSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSAKAAAAQALQV
Ga0207652_1137623313300025921Corn RhizosphereMTIGRRLYTNFGAILAMVVMLFLVNMIAVQREHAAKTAAAQSLA
Ga0207700_1049170033300025928Corn, Switchgrass And Miscanthus RhizosphereMTIGKKLYLNFGIILTMVVVLFLVNWSAVRREHAATDLADT
Ga0207664_1148243113300025929Agricultural SoilVSIGKKLYMNFGAVLAMVVLLLLINMAVVRREHLAKAAAANSLA
Ga0207664_1161584913300025929Agricultural SoilMTIGKKLYLNFGFILGMVLLLFIVNWLAVRREHAAK
Ga0207665_1119514623300025939Corn, Switchgrass And Miscanthus RhizosphereMTIGKKLYMNFGAVLAMVVVLFLVNMVAVQREHAAKAAAAGSLAM
Ga0207667_1062683023300025949Corn RhizosphereMSMSKKLYLNFGIILAMVGVLFFVTLFAVQREHSAKTAASQALQMAD
Ga0208533_10324913300026006Rice Paddy SoilMTLGKRLYLNFGFILGMVLLLFVVNYLAVRREHAAKDAAAASLK
Ga0207683_1020520933300026121Miscanthus RhizosphereMSMSKRLYLNFSFILGMVIVLFVVTWAAVQREHSAKAAATQ
Ga0209839_1008430613300026294SoilMSIKKKLYMNFGAVLAMVIVLFLVNLVAVQREHSAKAAASQALDMADNTNN
Ga0209152_1000633743300026325SoilMTISKKLYLNFGAVLAMVVVLLLVNLVAVEREHSAKTAAQQSMEMSDA
Ga0257154_100288913300026467SoilMTIGKKLYLNFGIILSMVVVLFLVNLLAVQREHAAKAAATAS
Ga0209577_1002174013300026552SoilMTISKKLYANFGAVLAMVVVLLLVNLVAVQREHSTKAAAQQSMEMSDAT
Ga0209220_106377713300027587Forest SoilMTIGKRLYVNFGIILTMVVVLFLVNLVAVHREHAAKAAAA
Ga0208827_105919313300027641Peatlands SoilMTIGKKLYFNFGAILAMVVVLFLINLIAVQREHSAKAAASQAL
Ga0209420_105789433300027648Forest SoilMTIGKKLYGSFGIILTMVVVLFCVNWFAVQREHAAKS
Ga0208991_104247413300027681Forest SoilMTIGKKLYVSFGIILATVVFLFVVNWYAVHREHDAKSAAAA
Ga0208696_115829913300027696Peatlands SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQAL
Ga0209248_1001626733300027729Bog Forest SoilMTIGKKLYKNFGIILSMVVVLFIVNLVAVLREHAA
Ga0209580_1051374123300027842Surface SoilMTIGKKLYTNFGIILSMVVVLFLVNWSAVQREHAAK
Ga0209693_1038759823300027855SoilMTIGKKLYKNFGIILSTVVVLFIVNLLAVQREHAAK
Ga0209693_1052415213300027855SoilMTIGKKLYMNFGIVLTMVLALFLVNWRAVQREHDAKNAA
Ga0209167_1015693333300027867Surface SoilMTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMAETTDK
Ga0209169_1018983433300027879SoilMTIGKKLYMNFGIVLTMVLALFLVNWRAVQREHDAK
Ga0209068_1013654513300027894WatershedsMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQA
Ga0209624_1009117333300027895Forest SoilMTIGKKLYTNFGIILSMVVVLFLVNWSAVLREHAAKAAAS
Ga0209067_1089383513300027898WatershedsMTIGKKLYVNFGIILTMVLALFLANWLAVRREHDARKASQQSQDLAE
Ga0209168_1004641433300027986Surface SoilMTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHRA
Ga0209168_1041519013300027986Surface SoilMTIGKRLYTNFGAVLAMVVVLFLINMIAVQREHAA
Ga0265350_10419313300028013SoilMTIGKKLYMNFGIILAMVVVLFLVNLLAVQREHSAKAAAAA
Ga0209526_1031720613300028047Forest SoilMSISKKLYWNFGSVLAMVIVLFLVNLIAVQREHSAKAAASQ
Ga0209526_1097930723300028047Forest SoilMTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMAET
Ga0302171_1009992513300028651FenMTIGRKLYINFGAVLAMVVVLFLVNLIAVQREHSAKAAAAKSLELADATDR
Ga0308309_1015880133300028906SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQM
Ga0222749_1010029333300029636SoilMKIGKKLYVNFGAVLAMVLVLFLVNLIAVRREHSAKAAASQALGLADA
Ga0302195_1033636823300030051BogMTIGKKLYVNFGIILSMVGVLFLVNLLAVQREHAAKAAAT
Ga0302179_1000905843300030058PalsaMTIGKKLYKNFGYILSMVVVLFLVNLLAVQREHAAKAAAT
Ga0311356_1181083613300030617PalsaMTIGKKLYKNFGIILSMVAVLFIVNLVAVQREHAAK
Ga0310039_1010540113300030706Peatlands SoilMTIGKKLYFNFGAVLAMVVVLFLVNLVAVQREHSAKAAA
Ga0310039_1018798223300030706Peatlands SoilMTIGKKLYMNFGIILSMVVVLFLVNLLAVQREHAAKAA
Ga0265762_105060923300030760SoilMTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQMAATTD
Ga0265753_110444513300030862SoilMTIGKKLYMNFGIILAMVVVLFLVNLLAVQREHSAKAGAAA
Ga0170834_11274063023300031057Forest SoilMTIGKKLYMNFGIILLMVVVLFGVNWLAVQREHTAK
Ga0170823_1641074123300031128Forest SoilMTIGKKLYVNFGIILTTVLVLFLVNWTAVQREHAAKKAAEAS
Ga0170824_12432060523300031231Forest SoilMTIGKKLYTNFGIILTMVLVLFLVNWSAVQREHSAKQLAD
Ga0302325_1025594013300031234PalsaMTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAKAAAAAS
Ga0170820_1135833923300031446Forest SoilMTISKKLYMNFGAVLAMVIVLFLINMIAVEREHAAKAAASQALKMAET
Ga0170820_1570508033300031446Forest SoilMSMSKKLYSNFGFVLAMVLVLFGVTWFAVQREQSAKTAAAQAL
Ga0307477_1086887523300031753Hardwood Forest SoilMTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAKKAA
Ga0307475_1107605923300031754Hardwood Forest SoilMTIGKKLYMNFGIILVMVVVLFGVNWLAVQREHTAKAAA
Ga0307478_1042478613300031823Hardwood Forest SoilMTIGKKLYINFGFILLMVVALFLVTWSAVQREHAAK
Ga0306919_1084760423300031879SoilMTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHAAKA
Ga0307479_1041321513300031962Hardwood Forest SoilMTIGKKLYLNFGIILSMVVVLFLVNLLAVLREHAAKDAAK
Ga0307479_1164554523300031962Hardwood Forest SoilMTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAKK
Ga0311301_1113084913300032160Peatlands SoilMTIGKKLYMNFGVILTMVLVLFLVNWSAVHREHEAKKAAQQS
Ga0307471_10014991613300032180Hardwood Forest SoilMTIGKKLYMNFGAVLAMVVVLFLVNMVAVQREHAAKAAA
Ga0307471_10148913113300032180Hardwood Forest SoilMTIGKKLYTNFGIILTMVVVLFLVNWSAVQREHAAKSA
Ga0307471_10253169313300032180Hardwood Forest SoilVTIGKKLYLAFGTVLATVVVLFAVNLWSVHREHSAKAAASQALELA
Ga0335079_1079152213300032783SoilMSIGKKLYLSFGAVLAMVVVLLLVNMAVVRREHQAKAAAANSLSM
Ga0335080_1180346013300032828SoilMTIGKKLYVNFGFILLMVLVLFLVNYFAVQREHSAKAS
Ga0335070_1018655033300032829SoilMTIGKKLYVNFGIILTMVLVLFLVNWMAVQREHAAKKSA
Ga0335073_1013862733300033134SoilMTIGKKLYLNFGIILTTVLILFLVNWFAVQREHSAKAAAA
Ga0335077_1007968953300033158SoilMTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAA
Ga0335077_1093357413300033158SoilMTIGKKLYLNFGAVLAMVIVLFLVNLIAMQREHAAKAAAAQSLE
Ga0326726_1186056413300033433Peat SoilMTIGKKLYMNFGFILVMVLLLFLANYFAVRREHRAKDSAKQS
Ga0334827_057212_3_1193300034065SoilMTIGKKLYTNFGIILTMVVVLFLVNWFAVQREHSAKAAA
Ga0370515_0049541_1_1293300034163Untreated Peat SoilMTIGKRLYKNFGIILSMVVVLFIVNLVAVLREHAAKDAAKVSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.