| Basic Information | |
|---|---|
| Family ID | F020187 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 225 |
| Average Sequence Length | 39 residues |
| Representative Sequence | DKTSLVTTLSSNPELKISDQDLKFLKSLRIKIDEDAA |
| Number of Associated Samples | 194 |
| Number of Associated Scaffolds | 225 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.45 % |
| % of genes near scaffold ends (potentially truncated) | 98.22 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 185 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.111 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.69% β-sheet: 6.15% Coil/Unstructured: 66.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 225 Family Scaffolds |
|---|---|---|
| PF00483 | NTP_transferase | 25.33 |
| PF03631 | Virul_fac_BrkB | 5.33 |
| PF03544 | TonB_C | 1.78 |
| PF00491 | Arginase | 1.33 |
| PF08308 | PEGA | 1.33 |
| PF13520 | AA_permease_2 | 1.33 |
| PF13450 | NAD_binding_8 | 1.33 |
| PF00920 | ILVD_EDD | 1.33 |
| PF00133 | tRNA-synt_1 | 0.89 |
| PF00139 | Lectin_legB | 0.89 |
| PF07610 | DUF1573 | 0.89 |
| PF02927 | CelD_N | 0.89 |
| PF01642 | MM_CoA_mutase | 0.89 |
| PF00072 | Response_reg | 0.89 |
| PF12833 | HTH_18 | 0.44 |
| PF00112 | Peptidase_C1 | 0.44 |
| PF07366 | SnoaL | 0.44 |
| PF01797 | Y1_Tnp | 0.44 |
| PF07690 | MFS_1 | 0.44 |
| PF00905 | Transpeptidase | 0.44 |
| PF00069 | Pkinase | 0.44 |
| PF12762 | DDE_Tnp_IS1595 | 0.44 |
| PF00999 | Na_H_Exchanger | 0.44 |
| PF01799 | Fer2_2 | 0.44 |
| PF01551 | Peptidase_M23 | 0.44 |
| PF13185 | GAF_2 | 0.44 |
| PF02537 | CRCB | 0.44 |
| PF00563 | EAL | 0.44 |
| PF08327 | AHSA1 | 0.44 |
| PF09335 | SNARE_assoc | 0.44 |
| PF13360 | PQQ_2 | 0.44 |
| PF00848 | Ring_hydroxyl_A | 0.44 |
| PF01435 | Peptidase_M48 | 0.44 |
| PF01924 | HypD | 0.44 |
| PF00293 | NUDIX | 0.44 |
| PF17164 | DUF5122 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 5.33 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 2.67 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.78 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.78 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.33 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.89 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.89 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.89 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.44 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.44 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.44 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.44 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.44 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.44 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.44 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.44 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.44 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.44 |
| COG0409 | Hydrogenase maturation factor HypD | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.44 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.44 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.11 % |
| Unclassified | root | N/A | 32.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1029292 | Not Available | 735 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100132923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2349 | Open in IMG/M |
| 3300003267|soilL1_10193202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1676 | Open in IMG/M |
| 3300004092|Ga0062389_100487585 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300004092|Ga0062389_102733419 | Not Available | 658 | Open in IMG/M |
| 3300004138|Ga0058905_1314778 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300004152|Ga0062386_101415950 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300004152|Ga0062386_101581328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 547 | Open in IMG/M |
| 3300004633|Ga0066395_10802119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 565 | Open in IMG/M |
| 3300004635|Ga0062388_102665603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 526 | Open in IMG/M |
| 3300005176|Ga0066679_10007387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5240 | Open in IMG/M |
| 3300005331|Ga0070670_102125144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300005332|Ga0066388_108156416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300005335|Ga0070666_11038018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 608 | Open in IMG/M |
| 3300005435|Ga0070714_102229419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 533 | Open in IMG/M |
| 3300005439|Ga0070711_100196152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1555 | Open in IMG/M |
| 3300005538|Ga0070731_10517265 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005542|Ga0070732_10233872 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005557|Ga0066704_10824713 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005569|Ga0066705_10516124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 746 | Open in IMG/M |
| 3300005578|Ga0068854_100297551 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300005587|Ga0066654_10881116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300005614|Ga0068856_101179128 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005764|Ga0066903_107607973 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005993|Ga0080027_10031365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1896 | Open in IMG/M |
| 3300006032|Ga0066696_10757050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300006102|Ga0075015_100327091 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006354|Ga0075021_10586480 | Not Available | 711 | Open in IMG/M |
| 3300006358|Ga0068871_101500644 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300006854|Ga0075425_102240656 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006903|Ga0075426_10493957 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300009089|Ga0099828_10105192 | All Organisms → cellular organisms → Bacteria | 2447 | Open in IMG/M |
| 3300009089|Ga0099828_11665409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300009090|Ga0099827_11280702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300009090|Ga0099827_11666793 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009092|Ga0105250_10009907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3998 | Open in IMG/M |
| 3300009137|Ga0066709_103314338 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009521|Ga0116222_1165804 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300009523|Ga0116221_1263703 | Not Available | 745 | Open in IMG/M |
| 3300009552|Ga0116138_1102909 | Not Available | 792 | Open in IMG/M |
| 3300009623|Ga0116133_1170935 | Not Available | 576 | Open in IMG/M |
| 3300009624|Ga0116105_1172980 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009631|Ga0116115_1197581 | Not Available | 508 | Open in IMG/M |
| 3300009759|Ga0116101_1121601 | Not Available | 621 | Open in IMG/M |
| 3300010048|Ga0126373_10606688 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300010048|Ga0126373_11502878 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010048|Ga0126373_12478870 | Not Available | 578 | Open in IMG/M |
| 3300010048|Ga0126373_12899011 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010337|Ga0134062_10384777 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010343|Ga0074044_10091406 | Not Available | 2051 | Open in IMG/M |
| 3300010358|Ga0126370_10795091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 843 | Open in IMG/M |
| 3300010358|Ga0126370_12463990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia steynii | 518 | Open in IMG/M |
| 3300010360|Ga0126372_10957925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300010360|Ga0126372_12393861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300010361|Ga0126378_10532617 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300010373|Ga0134128_10549340 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300010376|Ga0126381_101186781 | Not Available | 1103 | Open in IMG/M |
| 3300010376|Ga0126381_104091317 | Not Available | 567 | Open in IMG/M |
| 3300010379|Ga0136449_101045198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300010397|Ga0134124_11679612 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010400|Ga0134122_10121154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2096 | Open in IMG/M |
| 3300011269|Ga0137392_10542573 | Not Available | 966 | Open in IMG/M |
| 3300012189|Ga0137388_11535074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012189|Ga0137388_11763741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300012199|Ga0137383_10955580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300012203|Ga0137399_10261382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300012203|Ga0137399_10722382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300012206|Ga0137380_10462466 | Not Available | 1121 | Open in IMG/M |
| 3300012207|Ga0137381_10709661 | Not Available | 874 | Open in IMG/M |
| 3300012359|Ga0137385_10677111 | Not Available | 862 | Open in IMG/M |
| 3300012362|Ga0137361_11748117 | Not Available | 541 | Open in IMG/M |
| 3300012532|Ga0137373_10656725 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012925|Ga0137419_10778404 | Not Available | 781 | Open in IMG/M |
| 3300012929|Ga0137404_10443001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300012944|Ga0137410_11824382 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012984|Ga0164309_10719617 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012987|Ga0164307_11175869 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300013104|Ga0157370_10815836 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 849 | Open in IMG/M |
| 3300013104|Ga0157370_11313331 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300014153|Ga0181527_1431259 | Not Available | 501 | Open in IMG/M |
| 3300014166|Ga0134079_10502846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300014200|Ga0181526_10254466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300014200|Ga0181526_10726034 | Not Available | 626 | Open in IMG/M |
| 3300014301|Ga0075323_1163504 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300014502|Ga0182021_12010193 | Not Available | 696 | Open in IMG/M |
| 3300014657|Ga0181522_10628092 | Not Available | 653 | Open in IMG/M |
| 3300014658|Ga0181519_10227935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
| 3300014658|Ga0181519_10239855 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300014838|Ga0182030_10401495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300014968|Ga0157379_10075278 | Not Available | 3022 | Open in IMG/M |
| 3300015053|Ga0137405_1405032 | Not Available | 4299 | Open in IMG/M |
| 3300015245|Ga0137409_11430612 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300015358|Ga0134089_10034762 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300015372|Ga0132256_100307513 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300016371|Ga0182034_10669251 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300017823|Ga0187818_10384015 | Not Available | 622 | Open in IMG/M |
| 3300017932|Ga0187814_10375311 | Not Available | 551 | Open in IMG/M |
| 3300017933|Ga0187801_10046739 | Not Available | 1563 | Open in IMG/M |
| 3300017936|Ga0187821_10119566 | Not Available | 981 | Open in IMG/M |
| 3300017940|Ga0187853_10154524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300017948|Ga0187847_10304019 | Not Available | 872 | Open in IMG/M |
| 3300017955|Ga0187817_11063377 | Not Available | 519 | Open in IMG/M |
| 3300017966|Ga0187776_11102593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300017972|Ga0187781_10669302 | Not Available | 750 | Open in IMG/M |
| 3300017975|Ga0187782_10841340 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300017994|Ga0187822_10263720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300017995|Ga0187816_10474426 | Not Available | 561 | Open in IMG/M |
| 3300018023|Ga0187889_10166080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300018037|Ga0187883_10050186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2211 | Open in IMG/M |
| 3300018037|Ga0187883_10527164 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300018038|Ga0187855_10672082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300018040|Ga0187862_10577968 | Not Available | 668 | Open in IMG/M |
| 3300018043|Ga0187887_10109059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1666 | Open in IMG/M |
| 3300018047|Ga0187859_10760183 | Not Available | 554 | Open in IMG/M |
| 3300018058|Ga0187766_10483079 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300018085|Ga0187772_10375464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300018085|Ga0187772_10414968 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300018086|Ga0187769_11042929 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018088|Ga0187771_11023166 | Not Available | 701 | Open in IMG/M |
| 3300018090|Ga0187770_10350039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300018090|Ga0187770_10447744 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300018431|Ga0066655_10310813 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300019278|Ga0187800_1025831 | Not Available | 1596 | Open in IMG/M |
| 3300019870|Ga0193746_1014370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300019882|Ga0193713_1175290 | Not Available | 561 | Open in IMG/M |
| 3300019890|Ga0193728_1077634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1568 | Open in IMG/M |
| 3300020199|Ga0179592_10419268 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300020580|Ga0210403_10708322 | Not Available | 806 | Open in IMG/M |
| 3300020580|Ga0210403_11031441 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300020581|Ga0210399_10395896 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300020581|Ga0210399_11130285 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021086|Ga0179596_10352892 | Not Available | 739 | Open in IMG/M |
| 3300021088|Ga0210404_10461118 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300021170|Ga0210400_10377187 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300021181|Ga0210388_10510990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 1054 | Open in IMG/M |
| 3300021181|Ga0210388_10765370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300021388|Ga0213875_10656380 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300021404|Ga0210389_10520768 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300021405|Ga0210387_10743573 | Not Available | 868 | Open in IMG/M |
| 3300021405|Ga0210387_11084596 | Not Available | 699 | Open in IMG/M |
| 3300021406|Ga0210386_10474535 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300021407|Ga0210383_10035081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 4189 | Open in IMG/M |
| 3300021407|Ga0210383_11505448 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021420|Ga0210394_10844644 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300021420|Ga0210394_11419312 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021432|Ga0210384_11244560 | Not Available | 649 | Open in IMG/M |
| 3300021478|Ga0210402_10394567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 1285 | Open in IMG/M |
| 3300021479|Ga0210410_11490529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300021560|Ga0126371_13557895 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300023255|Ga0224547_1009564 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300024330|Ga0137417_1463584 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300025454|Ga0208039_1044492 | Not Available | 834 | Open in IMG/M |
| 3300025901|Ga0207688_10032898 | Not Available | 2866 | Open in IMG/M |
| 3300025911|Ga0207654_10376787 | Not Available | 982 | Open in IMG/M |
| 3300025917|Ga0207660_10816457 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300025924|Ga0207694_10197746 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300025992|Ga0208775_1012347 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300026291|Ga0209890_10057722 | Not Available | 1418 | Open in IMG/M |
| 3300026308|Ga0209265_1156345 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300026313|Ga0209761_1100303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1449 | Open in IMG/M |
| 3300026376|Ga0257167_1068830 | Not Available | 553 | Open in IMG/M |
| 3300026480|Ga0257177_1001192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2476 | Open in IMG/M |
| 3300026551|Ga0209648_10455096 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300026551|Ga0209648_10536562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300026555|Ga0179593_1041322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2072 | Open in IMG/M |
| 3300027568|Ga0208042_1011208 | Not Available | 2371 | Open in IMG/M |
| 3300027591|Ga0209733_1046532 | Not Available | 1153 | Open in IMG/M |
| 3300027604|Ga0208324_1002084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7667 | Open in IMG/M |
| 3300027609|Ga0209221_1075886 | Not Available | 878 | Open in IMG/M |
| 3300027667|Ga0209009_1115891 | Not Available | 680 | Open in IMG/M |
| 3300027676|Ga0209333_1193119 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027783|Ga0209448_10159815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300027783|Ga0209448_10241261 | Not Available | 597 | Open in IMG/M |
| 3300027875|Ga0209283_10265769 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300027884|Ga0209275_10402521 | Not Available | 772 | Open in IMG/M |
| 3300027894|Ga0209068_10421961 | Not Available | 763 | Open in IMG/M |
| 3300027898|Ga0209067_10907026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300027910|Ga0209583_10594884 | Not Available | 562 | Open in IMG/M |
| 3300027911|Ga0209698_10512568 | Not Available | 928 | Open in IMG/M |
| 3300027986|Ga0209168_10029834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3020 | Open in IMG/M |
| 3300028036|Ga0265355_1022292 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300028047|Ga0209526_10912702 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300028381|Ga0268264_10366802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
| 3300028560|Ga0302144_10195764 | Not Available | 654 | Open in IMG/M |
| 3300028780|Ga0302225_10244948 | Not Available | 856 | Open in IMG/M |
| 3300029910|Ga0311369_10824907 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300029984|Ga0311332_11586267 | Not Available | 531 | Open in IMG/M |
| 3300030007|Ga0311338_11213094 | Not Available | 715 | Open in IMG/M |
| 3300030520|Ga0311372_11884757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 708 | Open in IMG/M |
| 3300030618|Ga0311354_11937537 | Not Available | 508 | Open in IMG/M |
| 3300030687|Ga0302309_10493665 | Not Available | 585 | Open in IMG/M |
| 3300031128|Ga0170823_11112073 | Not Available | 741 | Open in IMG/M |
| 3300031236|Ga0302324_100505461 | Not Available | 1763 | Open in IMG/M |
| 3300031236|Ga0302324_102966962 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031247|Ga0265340_10247777 | Not Available | 794 | Open in IMG/M |
| 3300031261|Ga0302140_10992838 | Not Available | 578 | Open in IMG/M |
| 3300031708|Ga0310686_117400775 | Not Available | 588 | Open in IMG/M |
| 3300031712|Ga0265342_10353553 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031716|Ga0310813_10977471 | Not Available | 771 | Open in IMG/M |
| 3300031718|Ga0307474_10174610 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300031720|Ga0307469_11167360 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031753|Ga0307477_10246000 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300031753|Ga0307477_10533094 | Not Available | 796 | Open in IMG/M |
| 3300031754|Ga0307475_10998978 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031754|Ga0307475_11553848 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031769|Ga0318526_10388256 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031771|Ga0318546_10471160 | Not Available | 880 | Open in IMG/M |
| 3300031823|Ga0307478_10216251 | Not Available | 1546 | Open in IMG/M |
| 3300031823|Ga0307478_10256642 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300031897|Ga0318520_10530626 | Not Available | 728 | Open in IMG/M |
| 3300031910|Ga0306923_10758941 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300031962|Ga0307479_10257357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1724 | Open in IMG/M |
| 3300031996|Ga0308176_10862445 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 949 | Open in IMG/M |
| 3300032160|Ga0311301_10246271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2957 | Open in IMG/M |
| 3300032261|Ga0306920_103140563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300032805|Ga0335078_10496516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
| 3300032893|Ga0335069_10864537 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300032897|Ga0335071_10447633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300032897|Ga0335071_10678997 | Not Available | 980 | Open in IMG/M |
| 3300032955|Ga0335076_10935593 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300033289|Ga0310914_11817118 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300033402|Ga0326728_10333703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1351 | Open in IMG/M |
| 3300033806|Ga0314865_201367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300034282|Ga0370492_0472289 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.11% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.33% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.44% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.44% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.44% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.44% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.44% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.44% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.44% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004138 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF246 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10292921 | 3300001154 | Forest Soil | ERNTDKESLVSTLSTNADLKISDQDLKFLKSLRIKLDEEEED* |
| JGIcombinedJ26739_1001329231 | 3300002245 | Forest Soil | KTSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIEEEK* |
| soilL1_101932021 | 3300003267 | Sugarcane Root And Bulk Soil | NPDKTSLVTTLTSNPELKVSEQDLKFLKSLRIKIEDDAA* |
| Ga0062389_1004875851 | 3300004092 | Bog Forest Soil | KSSDKTSLVTTLSTNPEFKISDQDLKFLKSLRIKIEEEK* |
| Ga0062389_1027334192 | 3300004092 | Bog Forest Soil | EKSSDKTSLVTTLSTNPEFKISDQDLKFLKSLRIKIDEEKD* |
| Ga0058905_13147781 | 3300004138 | Forest Soil | EKSGDKTSLVTTLSSNPTFKVNDQDLKFLKSLRIKIDEDVA* |
| Ga0062386_1014159501 | 3300004152 | Bog Forest Soil | TTLSTNPEFKVSDQDLKFLKSLRIKIDEEKQDKNKGNDK* |
| Ga0062386_1015813281 | 3300004152 | Bog Forest Soil | EHTTDKTSLVSTLSANAELKINDQDVKFLKSLRIKIEELEDE* |
| Ga0066395_108021192 | 3300004633 | Tropical Forest Soil | PDKTSLVTTMSSNPELKVSDQDLKFLKSLRIKIDEDKQEK* |
| Ga0062388_1026656031 | 3300004635 | Bog Forest Soil | SPDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIDEEKHEKGE* |
| Ga0066679_100073876 | 3300005176 | Soil | HSTDKTSLVSTLSTNSELKISDQDLKFLKSLRIKIEDEEDEE* |
| Ga0070670_1021251442 | 3300005331 | Switchgrass Rhizosphere | TPDKASLVTTLTSNPELKVSEQDLKFLKSLRIKIEDDAA* |
| Ga0066388_1081564161 | 3300005332 | Tropical Forest Soil | GEKSGDKTSLVTTLTTNPEFKINDQDLKFLKSLRIKIEDEKH* |
| Ga0070666_110380181 | 3300005335 | Switchgrass Rhizosphere | STEKTSLVTTLSSNADLKISEQDLKFLKSLRIKLDEEEKKP* |
| Ga0070714_1022294191 | 3300005435 | Agricultural Soil | DKTSLVSTLSTNSELKISDQDLKFLKSLRIKIEDEEDEE* |
| Ga0070711_1001961521 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | KNPDKTSLVTTLTSNPELKVSEQDLKFLKSLRIKIEDDAA* |
| Ga0070731_105172651 | 3300005538 | Surface Soil | TSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIEEESK* |
| Ga0070732_102338724 | 3300005542 | Surface Soil | KTSLVTTLSTNPEFKINDQDLKFLKSLRIKIDEDKHGTDKSDKDKGK* |
| Ga0066704_108247132 | 3300005557 | Soil | TSLVSTMSTNPDFKMNDQDMKFLKSLRIKIEEDKHDKDK* |
| Ga0066705_105161241 | 3300005569 | Soil | DKTSLVTTLSSNPEFKINEQDLKFLKSLRIKIDEDAA* |
| Ga0068854_1002975511 | 3300005578 | Corn Rhizosphere | KSTEKTSLVTTLSSNADLKISEQDLKFLKSLRIKLDEEEKKP* |
| Ga0066654_108811161 | 3300005587 | Soil | KSTDKTSMVTTLSSNPELKVSDQDLKFLKSLRIKIENDAA* |
| Ga0068856_1011791281 | 3300005614 | Corn Rhizosphere | TSMVTTLSSNPELKVSDQDLKFLKSLRIKIENDAA* |
| Ga0066903_1076079731 | 3300005764 | Tropical Forest Soil | KTSLVTTLTSNPTFKVNDQDLKFLKSLRIKIDEDVA* |
| Ga0080027_100313651 | 3300005993 | Prmafrost Soil | TLSTNPEFKINDQDLKFLKSLRIKIDEEKRSEEK* |
| Ga0066696_107570502 | 3300006032 | Soil | SMVTTLTSNPELKVSDQDLKFLKSLRIKIEDDAA* |
| Ga0075015_1003270913 | 3300006102 | Watersheds | SLVTTLTTNPEFKISDQDLKFLKSLRIKIENDAA* |
| Ga0075021_105864801 | 3300006354 | Watersheds | SLVSTLSTNAELKISDQDLKFLKSLRIKIDEAEDEE* |
| Ga0068871_1015006441 | 3300006358 | Miscanthus Rhizosphere | SSDKTSLVTTLTSNPEFKISDQDLKFLKSLRIKIDEDVT* |
| Ga0075425_1022406562 | 3300006854 | Populus Rhizosphere | DKTSLVTTMSSNPELKVSDQDLKFLKSLRIKIDEEKHDK* |
| Ga0075426_104939572 | 3300006903 | Populus Rhizosphere | SLVTTLTSSPDFKVNEQDLKFLKSLRIKLETDDDAA* |
| Ga0099828_101051921 | 3300009089 | Vadose Zone Soil | SSDKTSLVTTLTSNPEFKISDQDLKFLKSLRIKIEEDAA* |
| Ga0099828_116654092 | 3300009089 | Vadose Zone Soil | DKTSLVTTLSSNPELKISDQDLKFLKSLRIKIDEDAA* |
| Ga0099827_112807021 | 3300009090 | Vadose Zone Soil | GEKPSDKASLVTTLSTNPEFKVNDQDLKFLKSLRIKIEEK* |
| Ga0099827_116667932 | 3300009090 | Vadose Zone Soil | DKTSLVTTLTSNPEFKISEQDLKFLKSLRIKIEDDAA* |
| Ga0105250_100099073 | 3300009092 | Switchgrass Rhizosphere | VTTLSSNADLKISEQDLKFLKSLRIKLDEEEKKP* |
| Ga0066709_1033143381 | 3300009137 | Grasslands Soil | KSPDKTSLITTMSSNPELKVSDQDLKFLKSLRIKIDEEHQDKGK* |
| Ga0116222_11658041 | 3300009521 | Peatlands Soil | PGEKNDKTSLVTTLTSNPEFKISDQDLKFLKSLRIKIEDDAA* |
| Ga0116221_12637031 | 3300009523 | Peatlands Soil | KTSLVTTLSTQPEFKINDQDLKFLKSLRIKIDEEKLEKDKPDKDKQP* |
| Ga0116138_11029092 | 3300009552 | Peatland | GEHTTDKTSLVSTLSTNAELKISDQDMKFLKSLRIKLDDEDD* |
| Ga0116133_11709351 | 3300009623 | Peatland | QGENTTDKTSLVSTLSTNAELKISDQDLKFLKSLRIKIDDED* |
| Ga0116105_11729801 | 3300009624 | Peatland | SLVSTLSANPEFKVNDQDVKFLKSLRIKIEEEKQDKDR* |
| Ga0116115_11975811 | 3300009631 | Peatland | DKASLVSTLSTNAELKISDQDLKFLKSLRIKIEDEED* |
| Ga0116101_11216011 | 3300009759 | Peatland | KTSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIEEEKEK* |
| Ga0126373_106066881 | 3300010048 | Tropical Forest Soil | TSLVSTISSNPELKVSDQDLKFLKSLRIKIEEEKHDKEK* |
| Ga0126373_115028781 | 3300010048 | Tropical Forest Soil | HHPDQAALVSALSTNPEFKISDQDLKFLKSLRIKIDEDEE* |
| Ga0126373_124788701 | 3300010048 | Tropical Forest Soil | KTDKSSMVTTLTSNPELKVSDQDVKFLKSLRIKIEDDAA* |
| Ga0126373_128990111 | 3300010048 | Tropical Forest Soil | GEKTDKSSMVTTLTSNPELKVSDQDVKFLKSLRIKIEDDAA* |
| Ga0134062_103847771 | 3300010337 | Grasslands Soil | DKTSLVSTMSTNPDFKMNDQDMKFLKSLRIKIEEDKHDKDK* |
| Ga0074044_100914061 | 3300010343 | Bog Forest Soil | TLSTNPELKISDQDMKFLKSLRIKISEEAEEAEEDED* |
| Ga0126370_107950912 | 3300010358 | Tropical Forest Soil | EDKTSMVTTLSSNPELKVSDQDLKFLKSLRIKIEDDAA* |
| Ga0126370_124639901 | 3300010358 | Tropical Forest Soil | KSSDKTSLVTTLTSNPTFKVNDQDLKFLKSLRIKIDEDVA* |
| Ga0126372_109579251 | 3300010360 | Tropical Forest Soil | NVADKTSLVSTLTTNPELKISDQDLKFLKSLRIKLDEEEEE* |
| Ga0126372_123938611 | 3300010360 | Tropical Forest Soil | SPDKASMVTTLTSNPELKVSDQDMKFLKSLRIKIEDDAA* |
| Ga0126378_105326171 | 3300010361 | Tropical Forest Soil | TDKSSMVTTLTSNPELQVSDQDVKFLKSLRIKIEDDAA* |
| Ga0134128_105493402 | 3300010373 | Terrestrial Soil | SDDKTSLVTTLTTNPEFKISDQDLKFLKSLRIKIENDAA* |
| Ga0126381_1011867812 | 3300010376 | Tropical Forest Soil | STDKASLVTTLTSNPELKVSDQDLKFLKSLKIKIEDDAA* |
| Ga0126381_1040913172 | 3300010376 | Tropical Forest Soil | GEKPTDKTSLVTTLTSNPEFKISDQDLKFLKSLRIKLDDDAA* |
| Ga0136449_1010451981 | 3300010379 | Peatlands Soil | KTSLVTTLTSNPEFKISDQDLKFLKSLRIKIEDNEAA* |
| Ga0134124_116796122 | 3300010397 | Terrestrial Soil | DKSSLVTTLTSNPELKISDQDLKFLKSLRIKIEDDAA* |
| Ga0134122_101211541 | 3300010400 | Terrestrial Soil | SLVTTLSSNADLKISEQDLKFLKSLRIKLDEEEKKP* |
| Ga0137392_105425731 | 3300011269 | Vadose Zone Soil | KTSLVTTLSTNPEFKINDADLKFLKSLRIKIEEEK* |
| Ga0137388_115350741 | 3300012189 | Vadose Zone Soil | SLVTTLTSNPEFKISDQDLKFLKSLRIKIEDDAA* |
| Ga0137388_117637411 | 3300012189 | Vadose Zone Soil | STLSTNPELKISDQDMKFLKSLRIKISEEEEDDF* |
| Ga0137383_109555801 | 3300012199 | Vadose Zone Soil | KSPDKTSMVTTLTSNPEFKVSDQDMKFLKSLRIKIEDDAA* |
| Ga0137399_102613821 | 3300012203 | Vadose Zone Soil | QGVPGSDKTSLVSTLSTNPELKVSDQDLKFLKSLRIKIEEKEEEID* |
| Ga0137399_107223821 | 3300012203 | Vadose Zone Soil | TDKTSLVSTLSTNAELKVSDQDLKFLKSLRIKIDDADDE* |
| Ga0137380_104624662 | 3300012206 | Vadose Zone Soil | SDKTSLVTTLTSNPEFKISEQDLKFLKSLRIKIEGDAA* |
| Ga0137381_107096611 | 3300012207 | Vadose Zone Soil | STLSTNPELKISDQDLKFLKSLRIKIEEEEEEVE* |
| Ga0137385_106771111 | 3300012359 | Vadose Zone Soil | KSSDKTSLVTTLTSNPEFKISEQDLKFLKSLRIKIEGDAA* |
| Ga0137361_117481171 | 3300012362 | Vadose Zone Soil | TDKTSLVSTLSTNAELKISDQDLKFLKSLRIKIDEAEDD* |
| Ga0137373_106567252 | 3300012532 | Vadose Zone Soil | STLSSNPELKVSDQDLKFLKSLRIKIEEEKHEKEK* |
| Ga0137419_107784041 | 3300012925 | Vadose Zone Soil | KSDDKTSMVTTLTTNPEFKISDQDLKFLKSLRIKIENDAA* |
| Ga0137404_104430011 | 3300012929 | Vadose Zone Soil | QGVPGSDKTSLVSTLSTNPELKISDQDLKFLKSLRIKIEEEEEEVE* |
| Ga0137410_118243821 | 3300012944 | Vadose Zone Soil | KTSLVTTLTTNPEFKISDQDLKFLKSLRIKIENDAA* |
| Ga0164309_107196171 | 3300012984 | Soil | TSLVTTMSSNPELKVSDQDLKFLKSLRIKIEEDKHDKEK* |
| Ga0164307_111758691 | 3300012987 | Soil | TMSTNPDFKMNDQDMKFLKSLRIKIEEDKHDKDK* |
| Ga0157370_108158362 | 3300013104 | Corn Rhizosphere | EKNPDKTSLVTTLTSNPELKVSEQDLKFLKSLRIKIEDDAA* |
| Ga0157370_113133311 | 3300013104 | Corn Rhizosphere | KTSLVSTMSTNPDFKMNDQDMKFLKSLRIKIEEDKHDKDK* |
| Ga0181527_14312591 | 3300014153 | Bog | DKTSLVSTLSTNAELKISDQDLKFLKSLRIKIDEEEDE* |
| Ga0134079_105028462 | 3300014166 | Grasslands Soil | SSLVTTLTSNPELKISDQDLKFLKSLRIKIENDAA* |
| Ga0181526_102544661 | 3300014200 | Bog | DKTSLVSTLSTNPELKISDQDMKFLKSLRIKINEEAEEDD* |
| Ga0181526_107260341 | 3300014200 | Bog | KTSLVTTLSTNPEFKVNDSDLKFLKSLRIKIEEDKHDKEHDKDK* |
| Ga0075323_11635042 | 3300014301 | Natural And Restored Wetlands | ADKTSLVTTLSSNPELKVNDQDLKFLKSLRIKVEDDAA* |
| Ga0182021_120101931 | 3300014502 | Fen | EAGDKTSLVTTLTSNPEFKINEQDLKFLKSLRIKIEDGKS* |
| Ga0181522_106280921 | 3300014657 | Bog | TSLVSARSLSTNTELKISDQDLKFLKSLRIKLDEEEDE* |
| Ga0181519_102279351 | 3300014658 | Bog | TSMVTTLTSNPEFKVSDQDMKFLKSLRIKLDDTAA* |
| Ga0181519_102398551 | 3300014658 | Bog | KTSLVSTLSTNPEFKINDQDLKFLKSLRIKIDEEKK* |
| Ga0182030_104014951 | 3300014838 | Bog | DHTSLVSARSLSTNAELKISDQDLKFLKSLRIKLDEEED* |
| Ga0157379_100752783 | 3300014968 | Switchgrass Rhizosphere | TEKTSLVTTLSSNADLKISEQDLKFLKSLRIKLDEEEKKP* |
| Ga0137405_14050321 | 3300015053 | Vadose Zone Soil | VPGSDKTSLVSTLSTNPELKVSDQDLKFLKSLRIKIQEEEEEVE* |
| Ga0137409_114306121 | 3300015245 | Vadose Zone Soil | SDKTSLVTTLTSNPEFKINEQDLKFLKSLRIKIEDDAA* |
| Ga0134089_100347623 | 3300015358 | Grasslands Soil | PDKTSMVTTLTSNPEFKVSDQDMKFLKSLRIKIEDDAA* |
| Ga0132256_1003075131 | 3300015372 | Arabidopsis Rhizosphere | EKNADKTSLVTTLTSNSELKVSEQDLKFLKSLRIKIEDDAA* |
| Ga0182034_106692511 | 3300016371 | Soil | DKTSLVTTMSSNPELKVSDQDLKFLKSLRIKIDEDHHEKGK |
| Ga0187818_103840152 | 3300017823 | Freshwater Sediment | TDKTSLVSTLSTNAELKISDQDLKFLKSLRIKLDDEEE |
| Ga0187814_103753111 | 3300017932 | Freshwater Sediment | ENTTDKTSLVSTLSTNAELKISDQDLKFLKSLRIKIDEAEDEE |
| Ga0187801_100467391 | 3300017933 | Freshwater Sediment | LVSTLSTNAELKISDQDLKFLKSLRIKIDEAEDEE |
| Ga0187821_101195661 | 3300017936 | Freshwater Sediment | TSLITTLSTNPEFKVNDQDLKFLKSLRIKIDEEKRDKEK |
| Ga0187853_101545242 | 3300017940 | Peatland | TSLVSARSLSTNAELKISDQDLKFLKSLRIKIEEEEED |
| Ga0187847_103040191 | 3300017948 | Peatland | GEKPADKTSLVTTLSTNPEFKISDQDLKFLKSLRIKIDEEKD |
| Ga0187817_110633771 | 3300017955 | Freshwater Sediment | PDKTSLVATMSTNPELKVSDQDLKFLKSLRIRLDEDKDKKDK |
| Ga0187776_111025932 | 3300017966 | Tropical Peatland | DKTSLVTTLTSNPEFKISDQDLKFLKSLRIKIEDDAA |
| Ga0187781_106693021 | 3300017972 | Tropical Peatland | STDKTSLVSTLSTNPEFKVSDQDLKFLKSLRIKIDDQDEE |
| Ga0187782_108413401 | 3300017975 | Tropical Peatland | KSQDKASLVSTMSTNPEFKMNDQDLKFLKSLRIKIDEEKHDKK |
| Ga0187822_102637202 | 3300017994 | Freshwater Sediment | DKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIDEDKHDADKSDKDKGK |
| Ga0187816_104744261 | 3300017995 | Freshwater Sediment | DKTSLVSTLSTNPELKISDQDLKFLKSLRIKLDEEEEE |
| Ga0187889_101660801 | 3300018023 | Peatland | QTTDKTSLVSARSLSSNAELKISDQDLKFLKSLRIKIEEEGEED |
| Ga0187883_100501861 | 3300018037 | Peatland | EKSSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIEEEKEK |
| Ga0187883_105271642 | 3300018037 | Peatland | SLVNTLSTNPEFKINDQDLKFLKSLRIKIEEEKEK |
| Ga0187855_106720821 | 3300018038 | Peatland | TSLVTTLSSNPEFKISDQDLKFLKSLRIKIEEDAA |
| Ga0187862_105779681 | 3300018040 | Peatland | DKTSLVSARSLSTNAELKISDQDLKFLKSLRIKIEEEEED |
| Ga0187887_101090591 | 3300018043 | Peatland | GENTTDNTSLVSARSLSNNAELKISDQDLKFLKSLRIKLDEEED |
| Ga0187859_107601831 | 3300018047 | Peatland | TDKTSLVSTLSTNAELKISDQDLKFLKSLRIKIEDEED |
| Ga0187766_104830791 | 3300018058 | Tropical Peatland | KPTDKTSLVTTLSTNPEFKVSEQDLKFLKSLRIKIEEDKEKEKEKE |
| Ga0187772_103754641 | 3300018085 | Tropical Peatland | SLVSALSTNAELKISEQDLKFLKSLRIKLDEEDEE |
| Ga0187772_104149681 | 3300018085 | Tropical Peatland | DKTSLVTTLTSNPELKISDQDLKFLKSLRIKIEDDAA |
| Ga0187769_110429292 | 3300018086 | Tropical Peatland | DKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIDEEKSDKK |
| Ga0187771_110231661 | 3300018088 | Tropical Peatland | ITTLSTNPEFKVSDQDLKFLKSLRIKIDEDKRDKNK |
| Ga0187770_103500391 | 3300018090 | Tropical Peatland | ANDKTSLVTTLTSNPELKVSDQDLKFLKSLRIKIEDDAA |
| Ga0187770_104477441 | 3300018090 | Tropical Peatland | KTSLVTTLSTNPEFKISDQDLKFLKSLRIKIEEEKPGKGS |
| Ga0066655_103108132 | 3300018431 | Grasslands Soil | TDKTSMVTTLSSNPELKVSDQDLKFLKSLRIKIEEDAA |
| Ga0187800_10258312 | 3300019278 | Peatland | TSLVTTLSTNPEFKVSDQDLKFLKSLRIKIDEENQK |
| Ga0193746_10143702 | 3300019870 | Soil | EKTTDKTSMVTTLASNPDLKVSEQDLKFLKSLRIKIEDDAA |
| Ga0193713_11752901 | 3300019882 | Soil | DKTSLVSTLSTNPELKISDQDLKFLKSLRIKIEEEQEEVE |
| Ga0193728_10776342 | 3300019890 | Soil | DDKTSMVTTLTTNPEFKISDQDLKFLKSLRIKIENDAA |
| Ga0179592_104192681 | 3300020199 | Vadose Zone Soil | PSDKTSLVTTLSTNPEFKVNDQDLKFLKSLRIKIEEK |
| Ga0210403_107083221 | 3300020580 | Soil | PDKTSLITTMSSNPELKVSDQDLKFLKSLRIKIDEEHHDKGK |
| Ga0210403_110314411 | 3300020580 | Soil | TTLSTNPEFKINDQDLKFLKSLRIKIDEEKHEKDKHDKDK |
| Ga0210399_103958961 | 3300020581 | Soil | EKSSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIEEEKHDQD |
| Ga0210399_111302852 | 3300020581 | Soil | DKTSLVTTLSTNPEFKISEQDLKFLKSLRIKIDEEK |
| Ga0179596_103528922 | 3300021086 | Vadose Zone Soil | KSSDKTSLVTTLSTNPEFKINDADLKFLKSLRIKIEEEK |
| Ga0210404_104611181 | 3300021088 | Soil | DKTSLVTTLSTNPEFKISDQDLKFLKSLRIKIDEEKHEKDKPDKDK |
| Ga0210400_103771871 | 3300021170 | Soil | SDKTSLVTTLSTNPEFKVSDQDLKFLKSLRIKIDEEKHEKDK |
| Ga0210388_105109902 | 3300021181 | Soil | KSSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIEEEK |
| Ga0210388_107653701 | 3300021181 | Soil | SLVSTLSTNPELKISDQDLKFLKSLRIKLDEEDDE |
| Ga0213875_106563802 | 3300021388 | Plant Roots | TSMVTTLSSNPELKVSDQDLKFLKSLRIKIEDDAA |
| Ga0210389_105207682 | 3300021404 | Soil | EKSSDKTSLVTTLTSNPDFKISDQDLKFLKSLRIKIEDEAA |
| Ga0210387_107435731 | 3300021405 | Soil | TTLSTNPEFKISDQDLKFLKSLRIKIDEEKQDQDKHEQG |
| Ga0210387_110845962 | 3300021405 | Soil | KTSLITTMSSNPELKVSDQALKFLKSLRIKIDEEHHDKGK |
| Ga0210386_104745351 | 3300021406 | Soil | GEKSSDKTSLVTTLSTNPEFKISDQDLKFLKSLRIKIEEEKEK |
| Ga0210383_100350811 | 3300021407 | Soil | TSDKTALVTTLSTNPEFKINDQDLKFLKSLRIKIEEK |
| Ga0210383_115054481 | 3300021407 | Soil | EKAADKTSLVTTINTNPELKVNDQDLKFLKSLRIKIEEK |
| Ga0210394_108446441 | 3300021420 | Soil | SSDKTSLVTTLTSNPDFKISDQDLKFLKSLRIKIEDEAA |
| Ga0210394_114193121 | 3300021420 | Soil | LITTMSSNPELKVSDQDLKFLKSLRIKIDEEHHDKGK |
| Ga0210384_112445601 | 3300021432 | Soil | EKSGDKASLVTTLTSNPTFKVNDQDLKFLKSLRIKIDEDVA |
| Ga0210402_103945671 | 3300021478 | Soil | KTSLVTTLSTNPEFKVNDQDLKFLKSLRIKIEEEK |
| Ga0210410_114905291 | 3300021479 | Soil | GEKSDDKTSMVTTLTTNPEFKISDQDLKFLKSLRIKIENDAA |
| Ga0126371_135578951 | 3300021560 | Tropical Forest Soil | KSTDKASLVTTLTRNPELKVSDQDLKFLKSLKIKIDDDAA |
| Ga0242662_100651792 | 3300022533 | Soil | NPEFKISDQDLKFLKSLRIKIDEEKHEKDKHDKDK |
| Ga0224547_10095642 | 3300023255 | Soil | VTTLSTNPEFKINDQDLKFLKSLRIKIDEEKHDTGKSDKDKNK |
| Ga0137417_14635842 | 3300024330 | Vadose Zone Soil | VSTLSTNPELKVSDQDLKFLKSLRIKIEEKEEEVD |
| Ga0208039_10444921 | 3300025454 | Peatland | TSEKTSLVSTLRDSTEFKISDQDLKFLKSLRIKIEEEENE |
| Ga0207688_100328981 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | SDKSTEKTSLVTTLSSNADLKISEQDLKFLKSLRIKLDEEEKKP |
| Ga0207654_103767871 | 3300025911 | Corn Rhizosphere | KNSLVTTLSTKPELKVSDQDVKFLKSLRIKIENDAA |
| Ga0207660_108164572 | 3300025917 | Corn Rhizosphere | KSDDKTSLVTTLTTNPEFKISDQDLKFLKSLRIKIENDAA |
| Ga0207694_101977462 | 3300025924 | Corn Rhizosphere | KSQDKTSLVSTMSTNPDFKMNDQDMKFLKSLRIKIEEDKHDKDK |
| Ga0208775_10123471 | 3300025992 | Rice Paddy Soil | LVSTMSTNPEFRMNDQDMKFLKSLRIKIEEDKHDKDKRDKDV |
| Ga0209890_100577221 | 3300026291 | Soil | KTSLVTTLSTNPEFKINDQDLKFLKSLRIKIDEEKRSEEK |
| Ga0209265_11563451 | 3300026308 | Soil | LVSTMSTNPDFKMNDQDMKFLKSLRIKIEEDKHDKDK |
| Ga0209761_11003033 | 3300026313 | Grasslands Soil | EKPTDKTSLVTTLSSNPELKISDQDLKFLKSLRIKIDDAA |
| Ga0257167_10688301 | 3300026376 | Soil | DKTSLVSTLSTNPELKISDQDLKFLKSLRIKIEEAEEEVE |
| Ga0257177_10011923 | 3300026480 | Soil | TDKTSLVSTLSTNAELKISDQDLKFLKSLRIKIDEAEED |
| Ga0209648_104550961 | 3300026551 | Grasslands Soil | VTTLSTNPEFKINDQDLKFLKSLRIKIDEEKLEKDKPDKDK |
| Ga0209648_105365622 | 3300026551 | Grasslands Soil | KTSLVTTLTSNPELKISDQDLKFLKSLRIKIENDAA |
| Ga0179593_10413221 | 3300026555 | Vadose Zone Soil | GEHTDKTSLVSTLSTNAELKVSDQDLKFLKSLRIKIDDADDD |
| Ga0208042_10112081 | 3300027568 | Peatlands Soil | KTSVVTTLSTNPEFKISDQDLKFLKSLRIKIDEGKQDKDK |
| Ga0209733_10465322 | 3300027591 | Forest Soil | NADKTSLVTTLSTNPEFKVNDQDLKFLKSLRIKVEEK |
| Ga0208324_10020841 | 3300027604 | Peatlands Soil | VTTLSTNPEFKISDQDLKFLKSLRIKIDEGKQDKDK |
| Ga0209221_10758861 | 3300027609 | Forest Soil | STDKTSLVSTLSTNAELKISDQDLKFLKSLRIKLDDDED |
| Ga0209009_11158912 | 3300027667 | Forest Soil | DKTSLVTTLSTNPEFKVNDQDLKFLKSLRIKVEEK |
| Ga0209333_11931191 | 3300027676 | Forest Soil | GEKSSDKTSLVTTLSTNPEFKISDQDLKFLKSLRIKIEEEK |
| Ga0209448_101598152 | 3300027783 | Bog Forest Soil | TSLVTTLSTNPEFKISDQDLKFLKSLRIKIEEEKEK |
| Ga0209448_102412611 | 3300027783 | Bog Forest Soil | ATDKTSLVSTLSTNSELKISDQDLKFLKSLRIKIDDAEDEE |
| Ga0209283_102657691 | 3300027875 | Vadose Zone Soil | SSDKTSLVTTLTSNPEFKISDQDLKFLKSLRIKIEEDAA |
| Ga0209275_104025211 | 3300027884 | Soil | KASLVTTITTNPELKVNDQDLKFLKSLRIKIDGEKVDAEKLDGSNDK |
| Ga0209068_104219612 | 3300027894 | Watersheds | SLVSTLSTNAELKISDQDLKFLKSLRIKIDEAEDEE |
| Ga0209067_109070262 | 3300027898 | Watersheds | HTTDKTSLVSTLSTNPELKISDQDLKFLKSLRIKLDEEEEE |
| Ga0209583_105948841 | 3300027910 | Watersheds | SSDKTSLVTTLTSNPTFRVNDQDLKFLKSLRIKIDEDVA |
| Ga0209698_105125682 | 3300027911 | Watersheds | HTTDKTSLVSTLSTNAELKISDQDLKFLKSLRIKLNEEEEE |
| Ga0209168_100298343 | 3300027986 | Surface Soil | EKSGKTSLVTTLSTNPEFKVSDQDLKFLKSLRIKIEEEKNDKDK |
| Ga0265355_10222922 | 3300028036 | Rhizosphere | KPTDKTSLVTTINTNPELKVNDQDLKFLKSLRIKIEEK |
| Ga0209526_109127022 | 3300028047 | Forest Soil | TSLVTTLSTNPEVKINDQDLKFLKSLRIKIDEDKHDPDRPDKGK |
| Ga0268264_103668021 | 3300028381 | Switchgrass Rhizosphere | SLVTTLSSNADLKISEQDLKFLKSLRIKLDEEEKKS |
| Ga0302144_101957642 | 3300028560 | Bog | TSLVSTLSTNTELKISDQDLKFLKSLRIKLDEEDE |
| Ga0302225_102449482 | 3300028780 | Palsa | KASVVATLSTNPEFRVNEQDMKFLRSLRIKIDEEKLDKPN |
| Ga0311369_108249071 | 3300029910 | Palsa | SSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKIEEEKEK |
| Ga0311332_115862672 | 3300029984 | Fen | DKTSLVSTLSSNPELKISDQDLKFLKSLRIKIDDADEE |
| Ga0311338_112130941 | 3300030007 | Palsa | SLVSTLSTNAELKISDQDLKFLKSLRIKLDDADDD |
| Ga0311372_118847573 | 3300030520 | Palsa | TSDKTSLVTTLSTNPEFKINDQDLKFLKSLRIKVEEK |
| Ga0311354_119375371 | 3300030618 | Palsa | ADQTSLVSARSLSTNAELKISDQDLKFLKSLRIKLDEAEED |
| Ga0302309_104936652 | 3300030687 | Palsa | TSLVTTLSTNPELKVNDQDLKFLKSLRIRIEEEKEK |
| Ga0170823_111120731 | 3300031128 | Forest Soil | TSLVSTLSTNSELKISDQDLKFLKSLRIKIENEEDEE |
| Ga0302324_1005054611 | 3300031236 | Palsa | SSDKTSLVTTLSTNPEFKVNDQDVKFLKSLRIKIEEEKRDK |
| Ga0302324_1029669622 | 3300031236 | Palsa | KAADKTSLVTTINTNPELKVNDQDLKFLKSLRIKIEEK |
| Ga0265340_102477772 | 3300031247 | Rhizosphere | HITDKTSLVSTLSTNAELKVNDQDLKFLKSLRIKIDAEDE |
| Ga0302140_109928381 | 3300031261 | Bog | KTSLVSTLSTNTELKISDQDLKFLKSLRIKLDEEDE |
| Ga0310686_1174007751 | 3300031708 | Soil | DKQSLVSTLRTSASAELKINDQDLKFLKSLRIKFDDEEDEE |
| Ga0265342_103535532 | 3300031712 | Rhizosphere | TLSTNPEFKINDQDLKFLKSLRIKIDEEKHEKDKHDKDK |
| Ga0310813_109774711 | 3300031716 | Soil | DKSSEKTSMVTTLSSNADLKISEQDLKFLKSLRIKLDEEDKNRPE |
| Ga0307474_101746101 | 3300031718 | Hardwood Forest Soil | SSDKTSMVTTLTSNPEFKISDQDLKFLKSLRIKIDSDAA |
| Ga0307469_111673602 | 3300031720 | Hardwood Forest Soil | KTSLVSTLSTNPEFKVSDQDLKFLKSLRIKIEEEEKRDSQK |
| Ga0307477_102460001 | 3300031753 | Hardwood Forest Soil | TSLITTLSTNPEFKVSDQDLKFLKSLRIKIDEEKRDKDK |
| Ga0307477_105330941 | 3300031753 | Hardwood Forest Soil | KTSLVTTLTTNPTFKVNDQDLKFLKSLRIKIDEDVA |
| Ga0307475_109989781 | 3300031754 | Hardwood Forest Soil | NPEFKINDQDLKFLKSLRIKIDEDKHDPDRPDKGK |
| Ga0307475_115538481 | 3300031754 | Hardwood Forest Soil | TSLVTTLTSNPTFKVNDQDLKFLKSLRIKIDEDVA |
| Ga0318526_103882561 | 3300031769 | Soil | STDKTSLVTTLTSNPELKVSDQDLKFLKSLRIKIDEDVA |
| Ga0318546_104711602 | 3300031771 | Soil | PDKTSLVTTLTTNPSFKVNDSDVKFLKALRIKIDEDVA |
| Ga0307478_102162512 | 3300031823 | Hardwood Forest Soil | SADKTSLVTTLSTNPEFKVNDQDLKFLKSLRIKVEEK |
| Ga0307478_102566422 | 3300031823 | Hardwood Forest Soil | SLVATMSTNPELKVSDQDLKFLKSLRIRLDEDKDKKDK |
| Ga0318520_105306261 | 3300031897 | Soil | DKTSLVTTLTGNPEFKVSDQDLKFLKSLRIKIEDDAA |
| Ga0306923_107589411 | 3300031910 | Soil | VTTMSSNPELKVSDQDLKFLKSLRIKIDEDKHEKEK |
| Ga0307479_102573573 | 3300031962 | Hardwood Forest Soil | ASDKTSLVTTLTSNPTFKVNDQDLKFLKSLRIKIDEDVA |
| Ga0308176_108624452 | 3300031996 | Soil | KTSLVTTLTSNPELKVSEQDLKFLKSLRIKIEDDAA |
| Ga0311301_102462713 | 3300032160 | Peatlands Soil | TSVVTTLSTNPEFKISDQDLKFLKSLRIKIDEGKQDKDK |
| Ga0306920_1031405633 | 3300032261 | Soil | SDKTSLVSTLSTNPELKISDQDLKFLKSLRIKLDEEEEE |
| Ga0335078_104965162 | 3300032805 | Soil | DKTSLVTTLTSNPEFKISEQDLKFLKSLRIKIDNDAA |
| Ga0335069_108645371 | 3300032893 | Soil | SSDKTSLVTTLSTNPEFKVSDQDLKFLKSLRIKIDEEKSDEQK |
| Ga0335071_104476333 | 3300032897 | Soil | TSLVTTLTSNPEFKISDQDMKFLKSLRIKIENDAA |
| Ga0335071_106789972 | 3300032897 | Soil | KTSLVTTLTSNPEFKINDQDLKFLKSLRIKIEDGKT |
| Ga0335076_109355931 | 3300032955 | Soil | ADKTSLVSTMSTNPEFKISDQDLKFLKSLRIKIEDEKKDK |
| Ga0310914_118171183 | 3300033289 | Soil | KTSLVTTLTSNPTFKISDQDLKFLKSLRIKIDEDVA |
| Ga0326728_103337032 | 3300033402 | Peat Soil | TTLSTNPEFKVNDQDLKFLRSLRIKIEEEKPGKDK |
| Ga0314865_201367_2_124 | 3300033806 | Peatland | GTDKTSLVSTLSTNPELKISDQDLKFLKSLRIKIDEDEED |
| Ga0370492_0472289_399_509 | 3300034282 | Untreated Peat Soil | DSLVTTLSNSEFKINDQDVKFLKSLKIKIEEEKEKK |
| ⦗Top⦘ |