| Basic Information | |
|---|---|
| Family ID | F020157 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 225 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN |
| Number of Associated Samples | 199 |
| Number of Associated Scaffolds | 225 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.56 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 188 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.556 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.778 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.81% Coil/Unstructured: 82.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 225 Family Scaffolds |
|---|---|---|
| PF13188 | PAS_8 | 2.22 |
| PF01850 | PIN | 2.22 |
| PF13426 | PAS_9 | 1.78 |
| PF13302 | Acetyltransf_3 | 1.78 |
| PF02604 | PhdYeFM_antitox | 1.33 |
| PF13578 | Methyltransf_24 | 1.33 |
| PF05598 | DUF772 | 1.33 |
| PF14499 | DUF4437 | 1.33 |
| PF03551 | PadR | 0.89 |
| PF02954 | HTH_8 | 0.89 |
| PF03150 | CCP_MauG | 0.44 |
| PF03061 | 4HBT | 0.44 |
| PF14384 | BrnA_antitoxin | 0.44 |
| PF05163 | DinB | 0.44 |
| PF02749 | QRPTase_N | 0.44 |
| PF02190 | LON_substr_bdg | 0.44 |
| PF08448 | PAS_4 | 0.44 |
| PF00069 | Pkinase | 0.44 |
| PF02518 | HATPase_c | 0.44 |
| PF12893 | Lumazine_bd_2 | 0.44 |
| PF00483 | NTP_transferase | 0.44 |
| PF00474 | SSF | 0.44 |
| PF07366 | SnoaL | 0.44 |
| PF15780 | ASH | 0.44 |
| PF04134 | DCC1-like | 0.44 |
| PF07495 | Y_Y_Y | 0.44 |
| PF13011 | LZ_Tnp_IS481 | 0.44 |
| PF13439 | Glyco_transf_4 | 0.44 |
| PF03734 | YkuD | 0.44 |
| PF05368 | NmrA | 0.44 |
| PF00795 | CN_hydrolase | 0.44 |
| PF00092 | VWA | 0.44 |
| PF00730 | HhH-GPD | 0.44 |
| PF00891 | Methyltransf_2 | 0.44 |
| PF00989 | PAS | 0.44 |
| PF00072 | Response_reg | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.78 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.33 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.33 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.89 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.89 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.89 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.44 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.44 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.44 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.44 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.44 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.44 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.44 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.44 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.56 % |
| Unclassified | root | N/A | 4.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10070604 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300001593|JGI12635J15846_10120485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300001593|JGI12635J15846_10263407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300001661|JGI12053J15887_10058612 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100173499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2039 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10242580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300004091|Ga0062387_101426761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300004152|Ga0062386_100099398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2234 | Open in IMG/M |
| 3300004157|Ga0062590_102195689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300004463|Ga0063356_101945079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
| 3300004468|Ga0068977_1253338 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300004479|Ga0062595_100627438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300004480|Ga0062592_101451156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300004612|Ga0068961_1301832 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005177|Ga0066690_10492110 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005345|Ga0070692_11255777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300005356|Ga0070674_102017339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005434|Ga0070709_11047621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300005435|Ga0070714_101152224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300005445|Ga0070708_100024385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 5160 | Open in IMG/M |
| 3300005456|Ga0070678_100987682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300005458|Ga0070681_11063883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300005459|Ga0068867_100012131 | All Organisms → cellular organisms → Bacteria | 6086 | Open in IMG/M |
| 3300005536|Ga0070697_100817811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 825 | Open in IMG/M |
| 3300005547|Ga0070693_100235932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300005557|Ga0066704_10630420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005559|Ga0066700_11152382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300005564|Ga0070664_100138641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2140 | Open in IMG/M |
| 3300005610|Ga0070763_10964580 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005712|Ga0070764_10236286 | Not Available | 1036 | Open in IMG/M |
| 3300005718|Ga0068866_10360468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300005764|Ga0066903_106441642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300005993|Ga0080027_10084742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300006059|Ga0075017_101221151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300006086|Ga0075019_10922648 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006086|Ga0075019_11016154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300006162|Ga0075030_100331470 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006162|Ga0075030_100751924 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300006642|Ga0075521_10346103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300006797|Ga0066659_10703516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 826 | Open in IMG/M |
| 3300006804|Ga0079221_10865956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300006806|Ga0079220_11870792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300006854|Ga0075425_101888665 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006881|Ga0068865_101689409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300006893|Ga0073928_10629019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300006904|Ga0075424_102654140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009038|Ga0099829_10206308 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300009092|Ga0105250_10138086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300009098|Ga0105245_11640037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300009148|Ga0105243_11341338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300009162|Ga0075423_11511815 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009174|Ga0105241_10143684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1946 | Open in IMG/M |
| 3300009176|Ga0105242_11144329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300009177|Ga0105248_12974256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300009519|Ga0116108_1098291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300009524|Ga0116225_1307473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300009524|Ga0116225_1563131 | Not Available | 504 | Open in IMG/M |
| 3300009525|Ga0116220_10047393 | Not Available | 1787 | Open in IMG/M |
| 3300009631|Ga0116115_1127909 | Not Available | 647 | Open in IMG/M |
| 3300009643|Ga0116110_1200226 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009665|Ga0116135_1185370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300009764|Ga0116134_1026430 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| 3300009839|Ga0116223_10097276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
| 3300010046|Ga0126384_11209891 | Not Available | 697 | Open in IMG/M |
| 3300010343|Ga0074044_10062277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2536 | Open in IMG/M |
| 3300010360|Ga0126372_11247673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300010366|Ga0126379_10946634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300010375|Ga0105239_10880391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300010376|Ga0126381_100753373 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300010376|Ga0126381_103081269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300010379|Ga0136449_104319196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300011269|Ga0137392_10225061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1540 | Open in IMG/M |
| 3300011269|Ga0137392_11293119 | Not Available | 588 | Open in IMG/M |
| 3300011271|Ga0137393_11070449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300012200|Ga0137382_10143861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1611 | Open in IMG/M |
| 3300012203|Ga0137399_10784194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300012205|Ga0137362_10779759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300012205|Ga0137362_11311104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300012205|Ga0137362_11620533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012349|Ga0137387_11336286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300012351|Ga0137386_10329614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300012362|Ga0137361_11868906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300012582|Ga0137358_11035265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012918|Ga0137396_10748816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012924|Ga0137413_10205902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
| 3300012927|Ga0137416_11248029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300012927|Ga0137416_11313283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300012930|Ga0137407_11417049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300012948|Ga0126375_11502671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012975|Ga0134110_10034140 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300012989|Ga0164305_10499941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300012989|Ga0164305_11222479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300013100|Ga0157373_10070245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2475 | Open in IMG/M |
| 3300013296|Ga0157374_10155364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2226 | Open in IMG/M |
| 3300013297|Ga0157378_11419428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300014158|Ga0181521_10221538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300014158|Ga0181521_10428028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300014159|Ga0181530_10031812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3741 | Open in IMG/M |
| 3300014168|Ga0181534_10000299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 35728 | Open in IMG/M |
| 3300014489|Ga0182018_10637924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300014494|Ga0182017_10497704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300014655|Ga0181516_10094588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300014838|Ga0182030_10255246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1997 | Open in IMG/M |
| 3300014968|Ga0157379_10222793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1709 | Open in IMG/M |
| 3300015089|Ga0167643_1012900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1241 | Open in IMG/M |
| 3300015264|Ga0137403_10118105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2646 | Open in IMG/M |
| 3300015264|Ga0137403_11183359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300015264|Ga0137403_11582113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300016702|Ga0181511_1040049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300017822|Ga0187802_10314777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300017823|Ga0187818_10158839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300017927|Ga0187824_10168309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 734 | Open in IMG/M |
| 3300017930|Ga0187825_10025695 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300017934|Ga0187803_10167327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300017940|Ga0187853_10250349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300017955|Ga0187817_10684003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300017972|Ga0187781_10006578 | All Organisms → cellular organisms → Bacteria | 8554 | Open in IMG/M |
| 3300017972|Ga0187781_10139081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
| 3300017975|Ga0187782_10044660 | All Organisms → cellular organisms → Bacteria | 3227 | Open in IMG/M |
| 3300017993|Ga0187823_10000107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18394 | Open in IMG/M |
| 3300017995|Ga0187816_10253065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300018002|Ga0187868_1296507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300018005|Ga0187878_1064032 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300018008|Ga0187888_1222497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300018009|Ga0187884_10027080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2920 | Open in IMG/M |
| 3300018012|Ga0187810_10032320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1925 | Open in IMG/M |
| 3300018017|Ga0187872_10159435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300018018|Ga0187886_1171695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300018022|Ga0187864_10039743 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
| 3300018023|Ga0187889_10463653 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300018026|Ga0187857_10094196 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300018028|Ga0184608_10300609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300018030|Ga0187869_10146332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300018034|Ga0187863_10558362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300018037|Ga0187883_10564631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300018037|Ga0187883_10682427 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300018040|Ga0187862_10507987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300018042|Ga0187871_10637094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300018468|Ga0066662_10363709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1252 | Open in IMG/M |
| 3300020001|Ga0193731_1169480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300020021|Ga0193726_1079498 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300020580|Ga0210403_10590031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300020581|Ga0210399_10087477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2536 | Open in IMG/M |
| 3300021178|Ga0210408_10124053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2038 | Open in IMG/M |
| 3300021181|Ga0210388_11110394 | Not Available | 674 | Open in IMG/M |
| 3300021344|Ga0193719_10412605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300021402|Ga0210385_11519657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 511 | Open in IMG/M |
| 3300021403|Ga0210397_10054725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2570 | Open in IMG/M |
| 3300021406|Ga0210386_11573956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300021420|Ga0210394_10391025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1223 | Open in IMG/M |
| 3300021420|Ga0210394_10836970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300021432|Ga0210384_10353668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300021477|Ga0210398_11363555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300021559|Ga0210409_11551215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300022733|Ga0224562_1000912 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300025460|Ga0208562_1003549 | All Organisms → cellular organisms → Bacteria | 4636 | Open in IMG/M |
| 3300025480|Ga0208688_1077371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300025711|Ga0207696_1087439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300025911|Ga0207654_10119670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1652 | Open in IMG/M |
| 3300025921|Ga0207652_10227573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1681 | Open in IMG/M |
| 3300025922|Ga0207646_10180331 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300025922|Ga0207646_11606632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300025924|Ga0207694_10289815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300025931|Ga0207644_10854001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300025944|Ga0207661_10484508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1129 | Open in IMG/M |
| 3300025986|Ga0207658_10319331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300026041|Ga0207639_11427348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300026088|Ga0207641_11660016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300026295|Ga0209234_1083976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1208 | Open in IMG/M |
| 3300026331|Ga0209267_1077230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1445 | Open in IMG/M |
| 3300027070|Ga0208365_1011742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
| 3300027629|Ga0209422_1069608 | Not Available | 830 | Open in IMG/M |
| 3300027846|Ga0209180_10265558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 986 | Open in IMG/M |
| 3300027854|Ga0209517_10423548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300027855|Ga0209693_10229187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300027874|Ga0209465_10101151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1414 | Open in IMG/M |
| 3300027879|Ga0209169_10492660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300027898|Ga0209067_10768316 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027898|Ga0209067_10908093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300027903|Ga0209488_10465983 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300027915|Ga0209069_10011734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4218 | Open in IMG/M |
| 3300028381|Ga0268264_11709815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300028788|Ga0302189_10182726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 887 | Open in IMG/M |
| 3300028906|Ga0308309_11812637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300029883|Ga0311327_10406601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300029910|Ga0311369_10776736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300029917|Ga0311326_10607944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300029918|Ga0302143_1174131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300029922|Ga0311363_10052358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6301 | Open in IMG/M |
| 3300029939|Ga0311328_10401606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300029999|Ga0311339_10344173 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300030580|Ga0311355_10224376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1946 | Open in IMG/M |
| 3300030659|Ga0316363_10076189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1532 | Open in IMG/M |
| 3300031090|Ga0265760_10262639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300031236|Ga0302324_100624397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1540 | Open in IMG/M |
| 3300031446|Ga0170820_13422462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300031561|Ga0318528_10767645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300031718|Ga0307474_10401546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300031720|Ga0307469_10757727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300031726|Ga0302321_102445850 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031753|Ga0307477_10278421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300031754|Ga0307475_10212274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1548 | Open in IMG/M |
| 3300031754|Ga0307475_11380511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300031946|Ga0310910_11448352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300031962|Ga0307479_10119671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2567 | Open in IMG/M |
| 3300031962|Ga0307479_10250018 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300032160|Ga0311301_10984320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 1119 | Open in IMG/M |
| 3300032180|Ga0307471_100839483 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300032180|Ga0307471_101172548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 933 | Open in IMG/M |
| 3300032180|Ga0307471_101333799 | Not Available | 879 | Open in IMG/M |
| 3300032180|Ga0307471_102296847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300032205|Ga0307472_101998085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300032828|Ga0335080_11141648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300032893|Ga0335069_10164420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 2736 | Open in IMG/M |
| 3300032893|Ga0335069_10864917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1013 | Open in IMG/M |
| 3300032897|Ga0335071_11499362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300032954|Ga0335083_11485395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300033158|Ga0335077_10475114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
| 3300033402|Ga0326728_10321827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1389 | Open in IMG/M |
| 3300033433|Ga0326726_10667662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300033513|Ga0316628_104178443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300033891|Ga0334811_059701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300034163|Ga0370515_0214275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300034163|Ga0370515_0488378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.22% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.22% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.22% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.33% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.44% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.44% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.44% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.44% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.44% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100706041 | 3300000567 | Peatlands Soil | GGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAVGGTE* |
| JGI12635J15846_101204855 | 3300001593 | Forest Soil | LRRVSVIGGRLVGATPFDGVVLQPENESISAAAGGSE* |
| JGI12635J15846_102634071 | 3300001593 | Forest Soil | FPLRHITVAHGRYVAATPFDGVIAQPQSESQNAAALNSGAAN* |
| JGI12053J15887_100586123 | 3300001661 | Forest Soil | RGPDTGFPLRRVSVIGGRFVAATPFDGVVLQPDDGNISAAAGTGNSN* |
| JGIcombinedJ26739_1001734992 | 3300002245 | Forest Soil | FPLRRVSVIGGRFVGATPFDGVVLQPENESISANAEAGSTE* |
| JGIcombinedJ26739_1014474172 | 3300002245 | Forest Soil | SGVVFESRDRGRSWHRGPDSGYPLRRIAVVRGRFVGATPFEGVIVQPESEAESASAGLGGSSN* |
| JGIcombinedJ51221_102425801 | 3300003505 | Forest Soil | DSGYPLRRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN* |
| Ga0062387_1014267611 | 3300004091 | Bog Forest Soil | PDSGFPLRRVGVFGGRLVGATPFDGVILQPENESISAGAEASSTE* |
| Ga0062386_1000993981 | 3300004152 | Bog Forest Soil | PDSGFPLRRVSVIGGRFVGATPFDGVILQPENESMSAAAEAGSSE* |
| Ga0062590_1021956891 | 3300004157 | Soil | WHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0063356_1019450792 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0068977_12533381 | 3300004468 | Peatlands Soil | GRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAIGGTE* |
| Ga0062595_1006274381 | 3300004479 | Soil | YPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE* |
| Ga0062592_1014511561 | 3300004480 | Soil | FESRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0068961_13018321 | 3300004612 | Peatlands Soil | DSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAIGGTE* |
| Ga0066690_104921101 | 3300005177 | Soil | WHRGPDSGYPLRRISVVHGRFLAATPFDGVVAQPERDGESASAVPGSSE* |
| Ga0070692_112557772 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | YPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0070674_1020173391 | 3300005356 | Miscanthus Rhizosphere | DDDGISWHRGPDSGYPLRHVRVVQGRFLAATPFDGVIAQPAGEVASATASAATSH* |
| Ga0070709_110476211 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | WQRGPDSGYPLRRVGVVHGRFMGATPFDGVILQPESESQSAAVGSGGSSK* |
| Ga0070714_1011522241 | 3300005435 | Agricultural Soil | SWQRGPDSGFPLRRVSVIGGRFVGATPFDGVVVQPENESISAAANVGGSE* |
| Ga0070708_1000243851 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GRSWQRGPDTGFPLRRVSVVGGRFVAATPFDGVVLQPDDGNISAAAGTGSAD* |
| Ga0070678_1009876821 | 3300005456 | Miscanthus Rhizosphere | QSDDDGISWHRGPDSGYPLRHVRVVQGRFLAATPFDGVIAQPAGEVASATASAATSH* |
| Ga0070681_110638831 | 3300005458 | Corn Rhizosphere | PDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGMGGSSD* |
| Ga0068867_1000121311 | 3300005459 | Miscanthus Rhizosphere | SGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0070697_1008178111 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | WRRGPDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASADTGSN* |
| Ga0070693_1002359321 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | SGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGMGGSSD* |
| Ga0066704_106304203 | 3300005557 | Soil | SWQRGPDSGFPLRRISVVHGRFMAATPFDGVIIQPENEAQSALAEGSGSSN* |
| Ga0066700_111523821 | 3300005559 | Soil | LRRISVVHGRFMAATPFDGVIIQPENEAQSALAEGSGSSN* |
| Ga0070664_1001386414 | 3300005564 | Corn Rhizosphere | VVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0070763_109645802 | 3300005610 | Soil | DAGFPLRRVSVIGGRLVGATPFDGVILQPENESISAAAEAGSSE* |
| Ga0070764_102362862 | 3300005712 | Soil | YPLRRVSVVHGHYVAATPFDGVIAEPENESQSANAGGN* |
| Ga0068866_103604682 | 3300005718 | Miscanthus Rhizosphere | SRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0066903_1064416421 | 3300005764 | Tropical Forest Soil | YPLRRIKIVAGRFLAATPFDGVIIQPELENTNASAASK* |
| Ga0080027_100847421 | 3300005993 | Prmafrost Soil | SKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASLGGSE* |
| Ga0075017_1012211512 | 3300006059 | Watersheds | SGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASVGFGGSTN* |
| Ga0075019_109226482 | 3300006086 | Watersheds | VSIVGGRYIGATPFDGVILQPENESISAAAGMGSSQ* |
| Ga0075019_110161541 | 3300006086 | Watersheds | TGFPLRRVSVLGGRFIAATPFDGVVLQPETDPISANASTGSSE* |
| Ga0075030_1003314703 | 3300006162 | Watersheds | LTRRSGYPLRRVSIVGGRYIGATPFDGVILQPENESISAAAGMGSSQ* |
| Ga0075030_1007519241 | 3300006162 | Watersheds | SWQRGPDSGFPLRRVSIIGGRFVGATPFDGVILQPENESISAVAAAGSTE* |
| Ga0075521_103461032 | 3300006642 | Arctic Peat Soil | GFPLRRVSVIGGRFVGATPFDGVILQPENESISAAADAGGNE* |
| Ga0066659_107035162 | 3300006797 | Soil | GPDSGYPLRRVSVVHGRFLGATPFDGVILQPEGESQSAAAGSGGGSK* |
| Ga0079221_108659561 | 3300006804 | Agricultural Soil | RDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAAGASAGLGGSSD* |
| Ga0079220_118707921 | 3300006806 | Agricultural Soil | TWQRGPDSGYPLRRVSVVHGRFLGATPFDGVILQPEGGSESAAAGSGGGSK* |
| Ga0075425_1018886651 | 3300006854 | Populus Rhizosphere | NGRTWHRGPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN* |
| Ga0068865_1016894092 | 3300006881 | Miscanthus Rhizosphere | FESRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGMGGSSD* |
| Ga0073928_106290191 | 3300006893 | Iron-Sulfur Acid Spring | YPLRRISVVHGRYVAATPFDGVIAQPENEPQSANAGGSN* |
| Ga0075424_1026541401 | 3300006904 | Populus Rhizosphere | ISVVRGRFVAATPFDGVIVQPENESESAAAMGATN* |
| Ga0099829_102063084 | 3300009038 | Vadose Zone Soil | GYPLRLISVVRGRLLAATPFDGVIAQPESEAKSAAGVAGASN* |
| Ga0105250_101380861 | 3300009092 | Switchgrass Rhizosphere | SGRTWTRGPDSGFPLRRITVIHGRYVAATPFDGVVVQPESEPQSAAVDGSSR* |
| Ga0105245_116400371 | 3300009098 | Miscanthus Rhizosphere | FESKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE* |
| Ga0105243_113413382 | 3300009148 | Miscanthus Rhizosphere | FESRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGLGGSSD* |
| Ga0075423_115118152 | 3300009162 | Populus Rhizosphere | RISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN* |
| Ga0105241_101436841 | 3300009174 | Corn Rhizosphere | SVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0105242_111443291 | 3300009176 | Miscanthus Rhizosphere | SWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGLGGSSD* |
| Ga0105248_129742561 | 3300009177 | Switchgrass Rhizosphere | GPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE* |
| Ga0116108_10982911 | 3300009519 | Peatland | GGRSWQRGPDSGFPLRRVSVIGGRFAGATPFDGVILQPEDESISAAAEAGSTE* |
| Ga0116225_13074732 | 3300009524 | Peatlands Soil | RRVSVIGGRFVGATPFDGVVLQPENESISAAAEAGSTE* |
| Ga0116225_15631311 | 3300009524 | Peatlands Soil | ISVVHGHFVAATPFDGVVVQPDNSPQSASTAMGDVSN* |
| Ga0116220_100473931 | 3300009525 | Peatlands Soil | GFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAIGGTE* |
| Ga0116115_11279092 | 3300009631 | Peatland | IVIGRRFVAATPFDGVILQPENESISAAAEAGSSE* |
| Ga0116110_12002262 | 3300009643 | Peatland | GPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE* |
| Ga0116135_11853701 | 3300009665 | Peatland | RRISVVHGRFVAATPFDGVIAQPENEPQSANAGGGSN* |
| Ga0116134_10264301 | 3300009764 | Peatland | SGYPLRHISVVHGRYVAATPFDGVIAQPENESQSANAGGGTN* |
| Ga0116223_100972765 | 3300009839 | Peatlands Soil | RRVSVFGGRFVGATPFDGVILQPENESISASAEAGSTE* |
| Ga0126384_112098911 | 3300010046 | Tropical Forest Soil | RVWHRGPDSGYPLRRISVVRGRFVAATPFDGVIVQPQNESESAAAMGATS* |
| Ga0074044_100622771 | 3300010343 | Bog Forest Soil | DSGYPLRRISVVHGRYVAATPFDGVIAQPENESQSANAGGGTN* |
| Ga0126372_112476732 | 3300010360 | Tropical Forest Soil | VSVVHGRFVGATPFDGVIVQPENEPHSAAAGSGGGNN* |
| Ga0126379_109466342 | 3300010366 | Tropical Forest Soil | QRGPDSGYPLRRVSVVHGRFVGATPFDGVILQPENDGQSAAAGAGGASN* |
| Ga0105239_108803912 | 3300010375 | Corn Rhizosphere | RGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGLGGSSD* |
| Ga0126381_1007533731 | 3300010376 | Tropical Forest Soil | RGPDSGYPLHRISVIQGRFMAATPFDGVIAQPGSEPESASATGSSN* |
| Ga0126381_1030812692 | 3300010376 | Tropical Forest Soil | WKPGPDTGYPLRRIKIVAGRFLAATPFDGVIIQPELENTSASAASK* |
| Ga0136449_1043191961 | 3300010379 | Peatlands Soil | DSGFPLRRISVVHGRYVATTPFDGVIAQPENEAQSANASAGSN* |
| Ga0137392_102250613 | 3300011269 | Vadose Zone Soil | RWRRGPDSGFPLRRINVVHGRFLAATPFDGVIAQPENESQSASAEGVGGK* |
| Ga0137392_112931191 | 3300011269 | Vadose Zone Soil | RHITVAHGRYVAATPFDGVIAQPQSEAQNTAALNSGASN* |
| Ga0137393_110704492 | 3300011271 | Vadose Zone Soil | RGPDSGFPLRHITVAHGRYVAATPFDGVIAQPQSEAQNTAALNSGASN* |
| Ga0137382_101438613 | 3300012200 | Vadose Zone Soil | PDTGFPLRRVSVVGGRFIAATPFDGVVLQPDDGNISAAAGNGSSN* |
| Ga0137399_107841941 | 3300012203 | Vadose Zone Soil | GRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVVLQPENESISANAEAGSTE* |
| Ga0137362_107797591 | 3300012205 | Vadose Zone Soil | SWRRGPDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASAE* |
| Ga0137362_113111042 | 3300012205 | Vadose Zone Soil | DSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN* |
| Ga0137362_116205331 | 3300012205 | Vadose Zone Soil | VSVIGGRYVGATPFDGVVLQPENESISATAEAGSTE* |
| Ga0137387_113362862 | 3300012349 | Vadose Zone Soil | RRISVVRGRLLAATPFDGVIAQPESEAESAAAGVAGASN* |
| Ga0137386_103296142 | 3300012351 | Vadose Zone Soil | HITVAHGRYVAATPFDGVIAQPQSESQSAAALNSGASN* |
| Ga0137361_118689062 | 3300012362 | Vadose Zone Soil | SVVGGRFVAATPFDGVVLQPDDGNISAAAGTGSAD* |
| Ga0137358_110352651 | 3300012582 | Vadose Zone Soil | PLRRVSVVGGRFVAATPFDGVVLQPENGDISAAAGNGSSN* |
| Ga0137396_107488162 | 3300012918 | Vadose Zone Soil | DSGRSWQRGPDTGFPLRRVSVIGGRFVAATPFDGVVLQPDDGNISAAAGTGNSN* |
| Ga0137413_102059023 | 3300012924 | Vadose Zone Soil | RGPDTGFPLRRVSVIGGRFVAATPFDGVVLQPEDGNISAAADSGSTK* |
| Ga0137416_112480291 | 3300012927 | Vadose Zone Soil | GPDSGFPLRRVSVIGGRFVGATPFDGVVLQPENESISAAVEAGSTE* |
| Ga0137416_113132832 | 3300012927 | Vadose Zone Soil | GFPLRHITVAHGRYVAATPFDGVIAQPQSESQSAAALNSGASN* |
| Ga0137407_114170491 | 3300012930 | Vadose Zone Soil | PDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASADTGSN* |
| Ga0126375_115026712 | 3300012948 | Tropical Forest Soil | PLRRVSVVGGRFVAATPFDGVVVQPGDGNMSAAADAGSN* |
| Ga0134110_100341403 | 3300012975 | Grasslands Soil | PLRRVSVMRGRFLAATPFDGVILQPEGESERASAGLGGSSN* |
| Ga0164305_104999412 | 3300012989 | Soil | FPLRRITVIHGRYVAATPFDGVVVQPESEPQSAAVDGSSR* |
| Ga0164305_112224793 | 3300012989 | Soil | GPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN* |
| Ga0157373_100702453 | 3300013100 | Corn Rhizosphere | RRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD* |
| Ga0157374_101553641 | 3300013296 | Miscanthus Rhizosphere | WHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGMGGSSE* |
| Ga0157378_114194282 | 3300013297 | Miscanthus Rhizosphere | GYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN* |
| Ga0181521_102215381 | 3300014158 | Bog | SGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE* |
| Ga0181521_104280281 | 3300014158 | Bog | FPLRRVSIIGGRFVGATPFDGVILQPEGESISAAAGSGSTE* |
| Ga0181530_100318125 | 3300014159 | Bog | SWQRGPDSGFPLRRVSVIGGRFVAATPFDGVILQPENESISAAAEAGSSE* |
| Ga0181534_1000029937 | 3300014168 | Bog | FPLRRVSIVHGRYVAATPFDGVVAQPESQSQSASASSGGN* |
| Ga0182018_106379241 | 3300014489 | Palsa | RGPDSGFPLRRISVVNGHYVAATPFDGVIAQPENEAQSANAGGGSN* |
| Ga0182017_104977041 | 3300014494 | Fen | FPLRRVSIIGGRFVAATPFDGVILQPENESISAAAGSGGTE* |
| Ga0181516_100945881 | 3300014655 | Bog | SGFPLRRISVVHGRFVAATPFDGVIAQPQDEMQSANAGGSN* |
| Ga0182030_102552462 | 3300014838 | Bog | SRGPDAGYPLRRVSILHGQFLAATPFDGVILQPENESQSAAVGLGGASN* |
| Ga0157379_102227934 | 3300014968 | Switchgrass Rhizosphere | PDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE* |
| Ga0167643_10129001 | 3300015089 | Glacier Forefield Soil | RRISVVHGRFMAATPFDGVIVQPENEPQSAAADAGMSN* |
| Ga0137403_101181055 | 3300015264 | Vadose Zone Soil | LRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN* |
| Ga0137403_111833591 | 3300015264 | Vadose Zone Soil | TGVVFESKDGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEASSALVGLGGSSE* |
| Ga0137403_115821131 | 3300015264 | Vadose Zone Soil | GYPLRRVSVVGGRFVAATPFDGVVLQPENGDISAAAGNGSSN* |
| Ga0181511_10400491 | 3300016702 | Peatland | RRISVVHGRYVAATPFDGVIAQPENESQSANAGGGSN |
| Ga0187802_103147772 | 3300017822 | Freshwater Sediment | RGPDSGYPLRHISVVNGHYVGATPFDGVIVQTESEGRSASASVTTRRTN |
| Ga0187818_101588393 | 3300017823 | Freshwater Sediment | GPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVKAGGTE |
| Ga0187824_101683092 | 3300017927 | Freshwater Sediment | RISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN |
| Ga0187825_100256953 | 3300017930 | Freshwater Sediment | YPLRRVSVVHGRFIGATPFDGVILQPENDGQSAAAGSGGGSK |
| Ga0187803_101673271 | 3300017934 | Freshwater Sediment | RDGGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPEDESISAAAEAGSTE |
| Ga0187853_102503492 | 3300017940 | Peatland | RGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGGSTE |
| Ga0187817_106840032 | 3300017955 | Freshwater Sediment | RSWQRGPDSGYPLRRVSVVGGRFIGATPFDGVVLQPENEPMSAAADAGSTE |
| Ga0187781_100065781 | 3300017972 | Tropical Peatland | PLRRVSIVGGRFIGATPFDGVILQPENESISAAADMSSSE |
| Ga0187781_101390814 | 3300017972 | Tropical Peatland | PDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVKGGGTE |
| Ga0187782_100446606 | 3300017975 | Tropical Peatland | VSIVGGRFIGATPFDGVILQPENESISAAADMSSSE |
| Ga0187823_100001071 | 3300017993 | Freshwater Sediment | LVRGRFVGATPFDGLIVQPENEAASASAGFGGSSD |
| Ga0187816_102530651 | 3300017995 | Freshwater Sediment | GPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGVGSTE |
| Ga0187868_12965071 | 3300018002 | Peatland | FPLRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE |
| Ga0187878_10640323 | 3300018005 | Peatland | WQRGPDSGFPLRRVSVIGGRFVAATPFDGVILQPENESISAAAEAGSSE |
| Ga0187888_12224972 | 3300018008 | Peatland | LRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE |
| Ga0187884_100270801 | 3300018009 | Peatland | RDGGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGGSTK |
| Ga0187810_100323204 | 3300018012 | Freshwater Sediment | FESRDGGRSWQRGPDSGFPLRRVSVIGGRFVGATSFDGVILQPENESISAVVEAGSTE |
| Ga0187872_101594352 | 3300018017 | Peatland | RVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE |
| Ga0187886_11716953 | 3300018018 | Peatland | GPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGGSTK |
| Ga0187864_100397434 | 3300018022 | Peatland | RRVSVIGGRFVGATPFDGVILQPENESISSVTAIGGTE |
| Ga0187889_104636531 | 3300018023 | Peatland | GSTWQRGPDSGFPLLRISVVHGRYVAATPFDGVIAQPENDSQSANAGGGSN |
| Ga0187857_100941961 | 3300018026 | Peatland | DSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAAAEAGSTE |
| Ga0184608_103006092 | 3300018028 | Groundwater Sediment | RRGPDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASAETGSN |
| Ga0187869_101463321 | 3300018030 | Peatland | SGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVAAAGSTE |
| Ga0187863_105583621 | 3300018034 | Peatland | RVSIIGGRLVGATPFDGVILQPENESISAAAGVGGNE |
| Ga0187883_105646311 | 3300018037 | Peatland | GFPLRRISVVHGRFVAATPFDGVIAQPENEPQSANAGGGSN |
| Ga0187883_106824272 | 3300018037 | Peatland | LRRISVVHGRYVAATPFDGVIAQPEDETQSASGGSN |
| Ga0187862_105079872 | 3300018040 | Peatland | PDSGFPLRRVSIIGGRFVGATPFDGVILQPEGESISAAAEAGSTE |
| Ga0187871_106370941 | 3300018042 | Peatland | RISVVHGRFVAATPFDGVIAQPENEPQSANAGGGSN |
| Ga0066662_103637091 | 3300018468 | Grasslands Soil | LSVVRGRVLAATPFDGVVAQPDKEAQTASAGGASR |
| Ga0193731_11694801 | 3300020001 | Soil | LRRISVVRGRFMAATPFDGVVAQPESDVESASADTGSN |
| Ga0193726_10794981 | 3300020021 | Soil | GYPLRRISVVHGRFMAATPFDGVIVQPENEPQSAAADAGMAN |
| Ga0210403_105900311 | 3300020580 | Soil | FPLRRVSVVHGRFVGATPFDGVIVQPENEPQSAAAGSGGASN |
| Ga0210399_100874771 | 3300020581 | Soil | RRVSVVRGRFVGATPFDGLIVQPENEAASASLGGGSSN |
| Ga0210408_101240531 | 3300021178 | Soil | LRRISVVHGRFVAATSFDGVVVQPENGPQSAAAGMGDSSN |
| Ga0210388_111103942 | 3300021181 | Soil | PLRQISVIHGHYVAATPFDGVISQPDNEPQSANAGGGSN |
| Ga0193719_104126052 | 3300021344 | Soil | SGYPLRRISVVRGRFIGATPFDGVIVQPENEAESASASFGNSSN |
| Ga0210385_115196572 | 3300021402 | Soil | SVVHGHFVAATPFDGVVVQPDGDRSASAGVGSSNN |
| Ga0210397_100547251 | 3300021403 | Soil | GPDSGYPLRRISVVHGRFVAATPFDGVIAQPENESQSANAGSGSN |
| Ga0210386_115739562 | 3300021406 | Soil | SGYPLRRISVVHGRFVAATPFDGVIAQPENESQSANAGSGSN |
| Ga0210394_103910252 | 3300021420 | Soil | RGPDSGYPLRRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN |
| Ga0210394_108369701 | 3300021420 | Soil | VSVIGGRFVGATPFDGVVLQPENESISATAEAGSTE |
| Ga0210384_103536682 | 3300021432 | Soil | KTWKRGPDSGFPLRRISVVHGRYVAATPFDGVVAQPENESQSANAGSGSN |
| Ga0210398_113635552 | 3300021477 | Soil | ISVVHGRFVAATPFDGVIAQPENESQSANAGSGSN |
| Ga0210409_115512151 | 3300021559 | Soil | LRRVSVVRGRFVGATPFDGLIVQPENEAANASLGGGSSN |
| Ga0224562_10009121 | 3300022733 | Soil | GFPLRHISVVHGHYVAATPFDGVIAQPENEPQSANAGGRSN |
| Ga0208562_10035491 | 3300025460 | Peatland | GRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVVLQPENESISAAAEAGSTE |
| Ga0208688_10773712 | 3300025480 | Peatland | RVSVIGGRFAGATPFDGVILQPEDESISAAAEAGSTE |
| Ga0207696_10874392 | 3300025711 | Switchgrass Rhizosphere | LRRITVIHGRYVAATPFDGVVVQPESEPQSAAVDGSSR |
| Ga0207654_101196701 | 3300025911 | Corn Rhizosphere | RISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD |
| Ga0207652_102275733 | 3300025921 | Corn Rhizosphere | VVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD |
| Ga0207646_101803311 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | WHRGPDSGYPLRLISVVRGRLLAATPFDGVIAQPESEAKSAAPGVAGASN |
| Ga0207646_116066321 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SKDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGVIIQPENEAQSASVSMGGSSN |
| Ga0207694_102898153 | 3300025924 | Corn Rhizosphere | LRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE |
| Ga0207644_108540012 | 3300025931 | Switchgrass Rhizosphere | GVIFESKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE |
| Ga0207661_104845082 | 3300025944 | Corn Rhizosphere | SVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD |
| Ga0207658_103193312 | 3300025986 | Switchgrass Rhizosphere | SDDDGISWHRGPDSGYPLRHVRVVQGRFLAATPFDGVIAQPAGEVASATASAATSH |
| Ga0207639_114273481 | 3300026041 | Corn Rhizosphere | SVVRGRFVGATPFDGLIVQPENEAASASAGMGGSSE |
| Ga0207641_116600162 | 3300026088 | Switchgrass Rhizosphere | FPLRRISVVHGRYLAATPFDGVIVQPESEPQSAAMESTR |
| Ga0209234_10839763 | 3300026295 | Grasslands Soil | RVSVVGGRFVAATPFDGVVLQPENGDISAAADAGSN |
| Ga0209267_10772303 | 3300026331 | Soil | YPLRRISVVRGRFMAATPFDGVIAQPESKVESASAE |
| Ga0208365_10117422 | 3300027070 | Forest Soil | SGYPLRRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN |
| Ga0209422_10696081 | 3300027629 | Forest Soil | FESRDGGRSWQRGPDSGFPLRRVSVIGGRFVGATSFDGVIIQPENESISASVQTGNSE |
| Ga0209180_102655581 | 3300027846 | Vadose Zone Soil | GYPLRLISVVRGRLLAATPFDGVIAQPESEAKSAAGVAGASN |
| Ga0209517_104235481 | 3300027854 | Peatlands Soil | RSWQRGPDSGFPLRRVSVFGGRFVGATPFDGVILQPENESISASAEAGSTE |
| Ga0209693_102291872 | 3300027855 | Soil | SVIGGRLVGATPFDGVILQPENESISAAAEAGSTE |
| Ga0209465_101011511 | 3300027874 | Tropical Forest Soil | YPLRRVSVVGGRFIAATPFDGVVLQPGDGNMSAAADAGSN |
| Ga0209169_104926602 | 3300027879 | Soil | RGPDTGYPLRRISVVHGHYVAATPFDGVVVQPDGDRSASAGVGSSTN |
| Ga0209067_107683162 | 3300027898 | Watersheds | VSIVGGRYIGATPFDGVILQPENESISAAAGMGSSQ |
| Ga0209067_109080931 | 3300027898 | Watersheds | PDTGFPLRRVSVLGGRFIAATPFDGVVLQPETDPISANASTGSSE |
| Ga0209488_104659831 | 3300027903 | Vadose Zone Soil | DSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASAAAGLSGSSN |
| Ga0209069_100117345 | 3300027915 | Watersheds | TGVIFESKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSE |
| Ga0268264_117098152 | 3300028381 | Switchgrass Rhizosphere | SWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGMGGSSE |
| Ga0302189_101827262 | 3300028788 | Bog | RGPDSGFPLRRISVVHGRYVAATPFDGVIAQPEDETQSASGGSN |
| Ga0308309_118126371 | 3300028906 | Soil | RRISVVHGHFVAATPFDGVVVQPDGDRSASADVGSSTN |
| Ga0311327_104066011 | 3300029883 | Bog | VSIIGGRLVGATPFDGVILQPENESISAAAGVGGTE |
| Ga0311369_107767362 | 3300029910 | Palsa | DSGFPLRRISVMHGHYVAATPFDGVIAQPENEAHSASASGGSN |
| Ga0311326_106079442 | 3300029917 | Bog | RRVSIIGGRLVGATPFDGVILQPENESISAAAGVGGNE |
| Ga0302143_11741312 | 3300029918 | Bog | DSGFPLRRISVVHGRYVAATPFDGVIAQPEDETQSASGGSN |
| Ga0311363_100523581 | 3300029922 | Fen | ISVVHGHYVAATPFDGVIAQPDNEPQSANAGGGSK |
| Ga0311328_104016061 | 3300029939 | Bog | SWQRGPDSGFPLRRVSIIGGRLVGATPFDGVILQPENESISAAAGVGGNE |
| Ga0311339_103441733 | 3300029999 | Palsa | ISVVHGRYVAATPFDGVVAQPENESQSANAGSGTN |
| Ga0311355_102243762 | 3300030580 | Palsa | LRRVSVIGGRFVGATPFDGVILQPDNEPMSANAGSSE |
| Ga0316363_100761894 | 3300030659 | Peatlands Soil | RRVSVFGGRFVGATPFDGVILQPENESISASAEAGSTE |
| Ga0265760_102626391 | 3300031090 | Soil | SWQRGPDSGFPLRRVGVLGGRFIGATPFDGVILQPDNEPMSAAAGSSE |
| Ga0302324_1006243971 | 3300031236 | Palsa | WQRGPDSGFPLRHISVVHGHYVAATPFDGVIAQPENEPQSANAGGGSN |
| Ga0170820_134224621 | 3300031446 | Forest Soil | DSGYPLRRVSIVRGRFVGATPFDGLIVQPENEAASASAGLGGSSE |
| Ga0318528_107676451 | 3300031561 | Soil | RVSVVHGRFVGATPFDGVIVQPENEPQSAAAGSGGGNN |
| Ga0307474_104015462 | 3300031718 | Hardwood Forest Soil | DSGFPLRRISVVHGRYVAATPFDGVVAQPENDSQSANAGSGSN |
| Ga0307469_107577271 | 3300031720 | Hardwood Forest Soil | SSDSGRSWQRGPDTGFPLRRVSVVGGRFIAATPFDGVVLEPGDGNISAAAGTGSSN |
| Ga0302321_1024458501 | 3300031726 | Fen | QISVVHGRFMAATPFDGVIVQPDHENESASAEPSN |
| Ga0307477_102784212 | 3300031753 | Hardwood Forest Soil | YPLRRVSVIRGRFLGATPFDGVIMQPEGESESAAAGSGGGSN |
| Ga0307475_102122741 | 3300031754 | Hardwood Forest Soil | SVVHGRFLGATPFDGVILQPEGGSESAAAGSGGGSK |
| Ga0307475_113805112 | 3300031754 | Hardwood Forest Soil | LRRVSVIGGRFVGATPFDGVVLQPENESISATAEAGSTE |
| Ga0310910_114483521 | 3300031946 | Soil | RVSVVHGRYIAATPFDGIVLQPESDMQSASAEAGSGSRN |
| Ga0307479_101196711 | 3300031962 | Hardwood Forest Soil | DSGFPLRRISVVNGRFVAATPFDGVIAQPERESESAAMGGGSSK |
| Ga0307479_102500184 | 3300031962 | Hardwood Forest Soil | RRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN |
| Ga0311301_109843203 | 3300032160 | Peatlands Soil | RRISVVHGHYVAATPFDGVVVQPDGDRSASAGVGSSTN |
| Ga0307471_1008394833 | 3300032180 | Hardwood Forest Soil | SKDNGRTWHRGPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN |
| Ga0307471_1011725481 | 3300032180 | Hardwood Forest Soil | LISVVRGRLLAATPFDGVIAQPESEAKSAAAGVAGASN |
| Ga0307471_1013337991 | 3300032180 | Hardwood Forest Soil | VVHGRFVAATPFEGVILQPESGPQSAAADGGGASN |
| Ga0307471_1022968472 | 3300032180 | Hardwood Forest Soil | RGPDTGYPLRRISVVHGHFVAATPFDGVVVQPDGDRSASAGVGSSTN |
| Ga0307472_1019980851 | 3300032205 | Hardwood Forest Soil | ESKDGGRSWHRGPDSGYPLRRVSVVRGRLVGATPFDGLIVQPENEAASASAGFGGSSD |
| Ga0335080_111416481 | 3300032828 | Soil | ESRDSGRSWQRGPDAGYPLRRLSVAPGRLLGATPFDGVIEQPENPSQSAAAGLGASSN |
| Ga0335069_101644202 | 3300032893 | Soil | PLRRVSVMGGRFVGATPFDGVVLQPDGEPMSAAAGSTE |
| Ga0335069_108649171 | 3300032893 | Soil | LRRISVVHGHYVAATPFDGIVVEPDGENHSAAINGGSSN |
| Ga0335071_114993621 | 3300032897 | Soil | GRSWQRGPDSGYPLRRVSVMGGRFVGATPFDGVVLQPDGEPMSAAAGSTE |
| Ga0335083_114853951 | 3300032954 | Soil | DSGYPLRRINVVHGRFVAATPFDGVILQPGNESQSAGLD |
| Ga0335077_104751142 | 3300033158 | Soil | QRGPDSGYPLRRVSVMGGRFVGATPFDGVVLQPDGEPMSAAAGSTE |
| Ga0326728_103218273 | 3300033402 | Peat Soil | DSGFPLRRVSIIGGRFVGATPFDGVILQPANESISAAAEAGGTE |
| Ga0326726_106676622 | 3300033433 | Peat Soil | QRGPDSGYPLRRVSVVGGRYVGATPFDGIILQPENESISAAAGTGSSR |
| Ga0316628_1041784431 | 3300033513 | Soil | GRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD |
| Ga0334811_059701_1_153 | 3300033891 | Soil | SWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAAAGSGGTE |
| Ga0370515_0214275_2_127 | 3300034163 | Untreated Peat Soil | FPLRRISIIGGRFVGATPFDGVILQPENELNRASAGVGGNE |
| Ga0370515_0488378_364_519 | 3300034163 | Untreated Peat Soil | GGTSWQRGPDSGFPLRHISVVHGHYVAATPFDGVIAQPENEPQSANAGGSN |
| ⦗Top⦘ |