NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020157

Metagenome / Metatranscriptome Family F020157

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020157
Family Type Metagenome / Metatranscriptome
Number of Sequences 225
Average Sequence Length 44 residues
Representative Sequence DSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN
Number of Associated Samples 199
Number of Associated Scaffolds 225

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.56 %
% of genes from short scaffolds (< 2000 bps) 88.00 %
Associated GOLD sequencing projects 188
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.556 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.222 % of family members)
Environment Ontology (ENVO) Unclassified
(26.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(33.778 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 17.81%    Coil/Unstructured: 82.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 225 Family Scaffolds
PF13188PAS_8 2.22
PF01850PIN 2.22
PF13426PAS_9 1.78
PF13302Acetyltransf_3 1.78
PF02604PhdYeFM_antitox 1.33
PF13578Methyltransf_24 1.33
PF05598DUF772 1.33
PF14499DUF4437 1.33
PF03551PadR 0.89
PF02954HTH_8 0.89
PF03150CCP_MauG 0.44
PF030614HBT 0.44
PF14384BrnA_antitoxin 0.44
PF05163DinB 0.44
PF02749QRPTase_N 0.44
PF02190LON_substr_bdg 0.44
PF08448PAS_4 0.44
PF00069Pkinase 0.44
PF02518HATPase_c 0.44
PF12893Lumazine_bd_2 0.44
PF00483NTP_transferase 0.44
PF00474SSF 0.44
PF07366SnoaL 0.44
PF15780ASH 0.44
PF04134DCC1-like 0.44
PF07495Y_Y_Y 0.44
PF13011LZ_Tnp_IS481 0.44
PF13439Glyco_transf_4 0.44
PF03734YkuD 0.44
PF05368NmrA 0.44
PF00795CN_hydrolase 0.44
PF00092VWA 0.44
PF00730HhH-GPD 0.44
PF00891Methyltransf_2 0.44
PF00989PAS 0.44
PF00072Response_reg 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 225 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.78
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.33
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.33
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.89
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.89
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.89
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.44
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.44
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 0.44
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.44
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.44
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.44
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 0.44
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.44
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.44
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.44
COG3011Predicted thiol-disulfide oxidoreductase YuxK, DCC familyGeneral function prediction only [R] 0.44
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.44
COG0157Nicotinate-nucleotide pyrophosphorylaseCoenzyme transport and metabolism [H] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.56 %
UnclassifiedrootN/A4.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10070604All Organisms → cellular organisms → Bacteria1732Open in IMG/M
3300001593|JGI12635J15846_10120485All Organisms → cellular organisms → Bacteria → Acidobacteria1854Open in IMG/M
3300001593|JGI12635J15846_10263407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1098Open in IMG/M
3300001661|JGI12053J15887_10058612All Organisms → cellular organisms → Bacteria2143Open in IMG/M
3300002245|JGIcombinedJ26739_100173499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2039Open in IMG/M
3300003505|JGIcombinedJ51221_10242580All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300004091|Ga0062387_101426761All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300004152|Ga0062386_100099398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2234Open in IMG/M
3300004157|Ga0062590_102195689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300004463|Ga0063356_101945079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium888Open in IMG/M
3300004468|Ga0068977_1253338All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300004479|Ga0062595_100627438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300004480|Ga0062592_101451156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300004612|Ga0068961_1301832All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005177|Ga0066690_10492110All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005345|Ga0070692_11255777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300005356|Ga0070674_102017339All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300005434|Ga0070709_11047621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300005435|Ga0070714_101152224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300005445|Ga0070708_100024385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium5160Open in IMG/M
3300005456|Ga0070678_100987682All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300005458|Ga0070681_11063883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300005459|Ga0068867_100012131All Organisms → cellular organisms → Bacteria6086Open in IMG/M
3300005536|Ga0070697_100817811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae825Open in IMG/M
3300005547|Ga0070693_100235932All Organisms → cellular organisms → Bacteria → Acidobacteria1206Open in IMG/M
3300005557|Ga0066704_10630420All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300005559|Ga0066700_11152382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300005564|Ga0070664_100138641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2140Open in IMG/M
3300005610|Ga0070763_10964580All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005712|Ga0070764_10236286Not Available1036Open in IMG/M
3300005718|Ga0068866_10360468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300005764|Ga0066903_106441642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300005993|Ga0080027_10084742All Organisms → cellular organisms → Bacteria → Acidobacteria1176Open in IMG/M
3300006059|Ga0075017_101221151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300006086|Ga0075019_10922648All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006086|Ga0075019_11016154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300006162|Ga0075030_100331470All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300006162|Ga0075030_100751924All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300006642|Ga0075521_10346103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300006797|Ga0066659_10703516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae826Open in IMG/M
3300006804|Ga0079221_10865956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300006806|Ga0079220_11870792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300006854|Ga0075425_101888665All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300006881|Ga0068865_101689409All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300006893|Ga0073928_10629019All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300006904|Ga0075424_102654140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300009038|Ga0099829_10206308All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300009092|Ga0105250_10138086All Organisms → cellular organisms → Bacteria → Acidobacteria1009Open in IMG/M
3300009098|Ga0105245_11640037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300009148|Ga0105243_11341338All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300009162|Ga0075423_11511815All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300009174|Ga0105241_10143684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1946Open in IMG/M
3300009176|Ga0105242_11144329All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300009177|Ga0105248_12974256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300009519|Ga0116108_1098291All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300009524|Ga0116225_1307473All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300009524|Ga0116225_1563131Not Available504Open in IMG/M
3300009525|Ga0116220_10047393Not Available1787Open in IMG/M
3300009631|Ga0116115_1127909Not Available647Open in IMG/M
3300009643|Ga0116110_1200226All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300009665|Ga0116135_1185370All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300009764|Ga0116134_1026430All Organisms → cellular organisms → Bacteria2326Open in IMG/M
3300009839|Ga0116223_10097276All Organisms → cellular organisms → Bacteria → Acidobacteria1863Open in IMG/M
3300010046|Ga0126384_11209891Not Available697Open in IMG/M
3300010343|Ga0074044_10062277All Organisms → cellular organisms → Bacteria → Acidobacteria2536Open in IMG/M
3300010360|Ga0126372_11247673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300010366|Ga0126379_10946634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium965Open in IMG/M
3300010375|Ga0105239_10880391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1028Open in IMG/M
3300010376|Ga0126381_100753373All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300010376|Ga0126381_103081269All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300010379|Ga0136449_104319196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300011269|Ga0137392_10225061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1540Open in IMG/M
3300011269|Ga0137392_11293119Not Available588Open in IMG/M
3300011271|Ga0137393_11070449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300012200|Ga0137382_10143861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1611Open in IMG/M
3300012203|Ga0137399_10784194All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300012205|Ga0137362_10779759All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300012205|Ga0137362_11311104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300012205|Ga0137362_11620533All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300012349|Ga0137387_11336286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300012351|Ga0137386_10329614All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300012362|Ga0137361_11868906All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300012582|Ga0137358_11035265All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300012918|Ga0137396_10748816All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300012924|Ga0137413_10205902All Organisms → cellular organisms → Bacteria → Acidobacteria1326Open in IMG/M
3300012927|Ga0137416_11248029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300012927|Ga0137416_11313283All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300012930|Ga0137407_11417049All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300012948|Ga0126375_11502671All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300012975|Ga0134110_10034140All Organisms → cellular organisms → Bacteria1992Open in IMG/M
3300012989|Ga0164305_10499941All Organisms → cellular organisms → Bacteria → Acidobacteria956Open in IMG/M
3300012989|Ga0164305_11222479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300013100|Ga0157373_10070245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2475Open in IMG/M
3300013296|Ga0157374_10155364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2226Open in IMG/M
3300013297|Ga0157378_11419428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300014158|Ga0181521_10221538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1019Open in IMG/M
3300014158|Ga0181521_10428028All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300014159|Ga0181530_10031812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3741Open in IMG/M
3300014168|Ga0181534_10000299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae35728Open in IMG/M
3300014489|Ga0182018_10637924All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300014494|Ga0182017_10497704All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300014655|Ga0181516_10094588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1507Open in IMG/M
3300014838|Ga0182030_10255246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1997Open in IMG/M
3300014968|Ga0157379_10222793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1709Open in IMG/M
3300015089|Ga0167643_1012900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71241Open in IMG/M
3300015264|Ga0137403_10118105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2646Open in IMG/M
3300015264|Ga0137403_11183359All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300015264|Ga0137403_11582113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300016702|Ga0181511_1040049All Organisms → cellular organisms → Bacteria → Acidobacteria1293Open in IMG/M
3300017822|Ga0187802_10314777All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300017823|Ga0187818_10158839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium984Open in IMG/M
3300017927|Ga0187824_10168309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi734Open in IMG/M
3300017930|Ga0187825_10025695All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300017934|Ga0187803_10167327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium865Open in IMG/M
3300017940|Ga0187853_10250349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300017955|Ga0187817_10684003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300017972|Ga0187781_10006578All Organisms → cellular organisms → Bacteria8554Open in IMG/M
3300017972|Ga0187781_10139081All Organisms → cellular organisms → Bacteria → Acidobacteria1700Open in IMG/M
3300017975|Ga0187782_10044660All Organisms → cellular organisms → Bacteria3227Open in IMG/M
3300017993|Ga0187823_10000107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae18394Open in IMG/M
3300017995|Ga0187816_10253065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300018002|Ga0187868_1296507All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300018005|Ga0187878_1064032All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300018008|Ga0187888_1222497All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300018009|Ga0187884_10027080All Organisms → cellular organisms → Bacteria → Acidobacteria2920Open in IMG/M
3300018012|Ga0187810_10032320All Organisms → cellular organisms → Bacteria → Acidobacteria1925Open in IMG/M
3300018017|Ga0187872_10159435All Organisms → cellular organisms → Bacteria → Acidobacteria1072Open in IMG/M
3300018018|Ga0187886_1171695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium850Open in IMG/M
3300018022|Ga0187864_10039743All Organisms → cellular organisms → Bacteria2714Open in IMG/M
3300018023|Ga0187889_10463653All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300018026|Ga0187857_10094196All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300018028|Ga0184608_10300609All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300018030|Ga0187869_10146332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1173Open in IMG/M
3300018034|Ga0187863_10558362All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300018037|Ga0187883_10564631All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300018037|Ga0187883_10682427All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300018040|Ga0187862_10507987All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300018042|Ga0187871_10637094All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300018468|Ga0066662_10363709All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1252Open in IMG/M
3300020001|Ga0193731_1169480All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300020021|Ga0193726_1079498All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300020580|Ga0210403_10590031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium898Open in IMG/M
3300020581|Ga0210399_10087477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2536Open in IMG/M
3300021178|Ga0210408_10124053All Organisms → cellular organisms → Bacteria → Proteobacteria2038Open in IMG/M
3300021181|Ga0210388_11110394Not Available674Open in IMG/M
3300021344|Ga0193719_10412605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300021402|Ga0210385_11519657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7511Open in IMG/M
3300021403|Ga0210397_10054725All Organisms → cellular organisms → Bacteria → Acidobacteria2570Open in IMG/M
3300021406|Ga0210386_11573956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300021420|Ga0210394_10391025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1223Open in IMG/M
3300021420|Ga0210394_10836970All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300021432|Ga0210384_10353668All Organisms → cellular organisms → Bacteria → Acidobacteria1323Open in IMG/M
3300021477|Ga0210398_11363555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300021559|Ga0210409_11551215All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300022733|Ga0224562_1000912All Organisms → cellular organisms → Bacteria1978Open in IMG/M
3300025460|Ga0208562_1003549All Organisms → cellular organisms → Bacteria4636Open in IMG/M
3300025480|Ga0208688_1077371All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300025711|Ga0207696_1087439All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300025911|Ga0207654_10119670All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1652Open in IMG/M
3300025921|Ga0207652_10227573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1681Open in IMG/M
3300025922|Ga0207646_10180331All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300025922|Ga0207646_11606632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300025924|Ga0207694_10289815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1346Open in IMG/M
3300025931|Ga0207644_10854001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300025944|Ga0207661_10484508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1129Open in IMG/M
3300025986|Ga0207658_10319331All Organisms → cellular organisms → Bacteria → Acidobacteria1344Open in IMG/M
3300026041|Ga0207639_11427348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300026088|Ga0207641_11660016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300026295|Ga0209234_1083976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1208Open in IMG/M
3300026331|Ga0209267_1077230All Organisms → cellular organisms → Bacteria → Acidobacteria1445Open in IMG/M
3300027070|Ga0208365_1011742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1085Open in IMG/M
3300027629|Ga0209422_1069608Not Available830Open in IMG/M
3300027846|Ga0209180_10265558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini986Open in IMG/M
3300027854|Ga0209517_10423548All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300027855|Ga0209693_10229187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium912Open in IMG/M
3300027874|Ga0209465_10101151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1414Open in IMG/M
3300027879|Ga0209169_10492660All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300027898|Ga0209067_10768316All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300027898|Ga0209067_10908093All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300027903|Ga0209488_10465983All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300027915|Ga0209069_10011734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4218Open in IMG/M
3300028381|Ga0268264_11709815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300028788|Ga0302189_10182726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola887Open in IMG/M
3300028906|Ga0308309_11812637All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300029883|Ga0311327_10406601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300029910|Ga0311369_10776736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300029917|Ga0311326_10607944All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300029918|Ga0302143_1174131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300029922|Ga0311363_10052358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6301Open in IMG/M
3300029939|Ga0311328_10401606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium985Open in IMG/M
3300029999|Ga0311339_10344173All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300030580|Ga0311355_10224376All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1946Open in IMG/M
3300030659|Ga0316363_10076189All Organisms → cellular organisms → Bacteria → Acidobacteria1532Open in IMG/M
3300031090|Ga0265760_10262639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300031236|Ga0302324_100624397All Organisms → cellular organisms → Bacteria → Acidobacteria1540Open in IMG/M
3300031446|Ga0170820_13422462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300031561|Ga0318528_10767645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300031718|Ga0307474_10401546All Organisms → cellular organisms → Bacteria → Acidobacteria1066Open in IMG/M
3300031720|Ga0307469_10757727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium886Open in IMG/M
3300031726|Ga0302321_102445850All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031753|Ga0307477_10278421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1157Open in IMG/M
3300031754|Ga0307475_10212274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1548Open in IMG/M
3300031754|Ga0307475_11380511All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300031946|Ga0310910_11448352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300031962|Ga0307479_10119671All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2567Open in IMG/M
3300031962|Ga0307479_10250018All Organisms → cellular organisms → Bacteria1750Open in IMG/M
3300032160|Ga0311301_10984320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini1119Open in IMG/M
3300032180|Ga0307471_100839483All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300032180|Ga0307471_101172548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini933Open in IMG/M
3300032180|Ga0307471_101333799Not Available879Open in IMG/M
3300032180|Ga0307471_102296847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300032205|Ga0307472_101998085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300032828|Ga0335080_11141648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300032893|Ga0335069_10164420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella2736Open in IMG/M
3300032893|Ga0335069_10864917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1013Open in IMG/M
3300032897|Ga0335071_11499362All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300032954|Ga0335083_11485395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300033158|Ga0335077_10475114All Organisms → cellular organisms → Bacteria → Acidobacteria1327Open in IMG/M
3300033402|Ga0326728_10321827All Organisms → cellular organisms → Bacteria → Acidobacteria1389Open in IMG/M
3300033433|Ga0326726_10667662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1002Open in IMG/M
3300033513|Ga0316628_104178443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300033891|Ga0334811_059701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1013Open in IMG/M
3300034163|Ga0370515_0214275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300034163|Ga0370515_0488378All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.22%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.22%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.11%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.22%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.22%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.33%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.33%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.44%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.44%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.44%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.44%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.44%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.44%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.44%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.44%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.44%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.44%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004468Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004612Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1007060413300000567Peatlands SoilGGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAVGGTE*
JGI12635J15846_1012048553300001593Forest SoilLRRVSVIGGRLVGATPFDGVVLQPENESISAAAGGSE*
JGI12635J15846_1026340713300001593Forest SoilFPLRHITVAHGRYVAATPFDGVIAQPQSESQNAAALNSGAAN*
JGI12053J15887_1005861233300001661Forest SoilRGPDTGFPLRRVSVIGGRFVAATPFDGVVLQPDDGNISAAAGTGNSN*
JGIcombinedJ26739_10017349923300002245Forest SoilFPLRRVSVIGGRFVGATPFDGVVLQPENESISANAEAGSTE*
JGIcombinedJ26739_10144741723300002245Forest SoilSGVVFESRDRGRSWHRGPDSGYPLRRIAVVRGRFVGATPFEGVIVQPESEAESASAGLGGSSN*
JGIcombinedJ51221_1024258013300003505Forest SoilDSGYPLRRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN*
Ga0062387_10142676113300004091Bog Forest SoilPDSGFPLRRVGVFGGRLVGATPFDGVILQPENESISAGAEASSTE*
Ga0062386_10009939813300004152Bog Forest SoilPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESMSAAAEAGSSE*
Ga0062590_10219568913300004157SoilWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0063356_10194507923300004463Arabidopsis Thaliana RhizosphereGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0068977_125333813300004468Peatlands SoilGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAIGGTE*
Ga0062595_10062743813300004479SoilYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE*
Ga0062592_10145115613300004480SoilFESRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0068961_130183213300004612Peatlands SoilDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAIGGTE*
Ga0066690_1049211013300005177SoilWHRGPDSGYPLRRISVVHGRFLAATPFDGVVAQPERDGESASAVPGSSE*
Ga0070692_1125577723300005345Corn, Switchgrass And Miscanthus RhizosphereYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0070674_10201733913300005356Miscanthus RhizosphereDDDGISWHRGPDSGYPLRHVRVVQGRFLAATPFDGVIAQPAGEVASATASAATSH*
Ga0070709_1104762113300005434Corn, Switchgrass And Miscanthus RhizosphereWQRGPDSGYPLRRVGVVHGRFMGATPFDGVILQPESESQSAAVGSGGSSK*
Ga0070714_10115222413300005435Agricultural SoilSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVVVQPENESISAAANVGGSE*
Ga0070708_10002438513300005445Corn, Switchgrass And Miscanthus RhizosphereGRSWQRGPDTGFPLRRVSVVGGRFVAATPFDGVVLQPDDGNISAAAGTGSAD*
Ga0070678_10098768213300005456Miscanthus RhizosphereQSDDDGISWHRGPDSGYPLRHVRVVQGRFLAATPFDGVIAQPAGEVASATASAATSH*
Ga0070681_1106388313300005458Corn RhizospherePDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGMGGSSD*
Ga0068867_10001213113300005459Miscanthus RhizosphereSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0070697_10081781113300005536Corn, Switchgrass And Miscanthus RhizosphereWRRGPDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASADTGSN*
Ga0070693_10023593213300005547Corn, Switchgrass And Miscanthus RhizosphereSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGMGGSSD*
Ga0066704_1063042033300005557SoilSWQRGPDSGFPLRRISVVHGRFMAATPFDGVIIQPENEAQSALAEGSGSSN*
Ga0066700_1115238213300005559SoilLRRISVVHGRFMAATPFDGVIIQPENEAQSALAEGSGSSN*
Ga0070664_10013864143300005564Corn RhizosphereVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0070763_1096458023300005610SoilDAGFPLRRVSVIGGRLVGATPFDGVILQPENESISAAAEAGSSE*
Ga0070764_1023628623300005712SoilYPLRRVSVVHGHYVAATPFDGVIAEPENESQSANAGGN*
Ga0068866_1036046823300005718Miscanthus RhizosphereSRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0066903_10644164213300005764Tropical Forest SoilYPLRRIKIVAGRFLAATPFDGVIIQPELENTNASAASK*
Ga0080027_1008474213300005993Prmafrost SoilSKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASLGGSE*
Ga0075017_10122115123300006059WatershedsSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASVGFGGSTN*
Ga0075019_1092264823300006086WatershedsVSIVGGRYIGATPFDGVILQPENESISAAAGMGSSQ*
Ga0075019_1101615413300006086WatershedsTGFPLRRVSVLGGRFIAATPFDGVVLQPETDPISANASTGSSE*
Ga0075030_10033147033300006162WatershedsLTRRSGYPLRRVSIVGGRYIGATPFDGVILQPENESISAAAGMGSSQ*
Ga0075030_10075192413300006162WatershedsSWQRGPDSGFPLRRVSIIGGRFVGATPFDGVILQPENESISAVAAAGSTE*
Ga0075521_1034610323300006642Arctic Peat SoilGFPLRRVSVIGGRFVGATPFDGVILQPENESISAAADAGGNE*
Ga0066659_1070351623300006797SoilGPDSGYPLRRVSVVHGRFLGATPFDGVILQPEGESQSAAAGSGGGSK*
Ga0079221_1086595613300006804Agricultural SoilRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAAGASAGLGGSSD*
Ga0079220_1187079213300006806Agricultural SoilTWQRGPDSGYPLRRVSVVHGRFLGATPFDGVILQPEGGSESAAAGSGGGSK*
Ga0075425_10188866513300006854Populus RhizosphereNGRTWHRGPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN*
Ga0068865_10168940923300006881Miscanthus RhizosphereFESRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGMGGSSD*
Ga0073928_1062901913300006893Iron-Sulfur Acid SpringYPLRRISVVHGRYVAATPFDGVIAQPENEPQSANAGGSN*
Ga0075424_10265414013300006904Populus RhizosphereISVVRGRFVAATPFDGVIVQPENESESAAAMGATN*
Ga0099829_1020630843300009038Vadose Zone SoilGYPLRLISVVRGRLLAATPFDGVIAQPESEAKSAAGVAGASN*
Ga0105250_1013808613300009092Switchgrass RhizosphereSGRTWTRGPDSGFPLRRITVIHGRYVAATPFDGVVVQPESEPQSAAVDGSSR*
Ga0105245_1164003713300009098Miscanthus RhizosphereFESKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE*
Ga0105243_1134133823300009148Miscanthus RhizosphereFESRDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGLGGSSD*
Ga0075423_1151181523300009162Populus RhizosphereRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN*
Ga0105241_1014368413300009174Corn RhizosphereSVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0105242_1114432913300009176Miscanthus RhizosphereSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGLGGSSD*
Ga0105248_1297425613300009177Switchgrass RhizosphereGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE*
Ga0116108_109829113300009519PeatlandGGRSWQRGPDSGFPLRRVSVIGGRFAGATPFDGVILQPEDESISAAAEAGSTE*
Ga0116225_130747323300009524Peatlands SoilRRVSVIGGRFVGATPFDGVVLQPENESISAAAEAGSTE*
Ga0116225_156313113300009524Peatlands SoilISVVHGHFVAATPFDGVVVQPDNSPQSASTAMGDVSN*
Ga0116220_1004739313300009525Peatlands SoilGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVTAIGGTE*
Ga0116115_112790923300009631PeatlandIVIGRRFVAATPFDGVILQPENESISAAAEAGSSE*
Ga0116110_120022623300009643PeatlandGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE*
Ga0116135_118537013300009665PeatlandRRISVVHGRFVAATPFDGVIAQPENEPQSANAGGGSN*
Ga0116134_102643013300009764PeatlandSGYPLRHISVVHGRYVAATPFDGVIAQPENESQSANAGGGTN*
Ga0116223_1009727653300009839Peatlands SoilRRVSVFGGRFVGATPFDGVILQPENESISASAEAGSTE*
Ga0126384_1120989113300010046Tropical Forest SoilRVWHRGPDSGYPLRRISVVRGRFVAATPFDGVIVQPQNESESAAAMGATS*
Ga0074044_1006227713300010343Bog Forest SoilDSGYPLRRISVVHGRYVAATPFDGVIAQPENESQSANAGGGTN*
Ga0126372_1124767323300010360Tropical Forest SoilVSVVHGRFVGATPFDGVIVQPENEPHSAAAGSGGGNN*
Ga0126379_1094663423300010366Tropical Forest SoilQRGPDSGYPLRRVSVVHGRFVGATPFDGVILQPENDGQSAAAGAGGASN*
Ga0105239_1088039123300010375Corn RhizosphereRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPANEAASASAGLGGSSD*
Ga0126381_10075337313300010376Tropical Forest SoilRGPDSGYPLHRISVIQGRFMAATPFDGVIAQPGSEPESASATGSSN*
Ga0126381_10308126923300010376Tropical Forest SoilWKPGPDTGYPLRRIKIVAGRFLAATPFDGVIIQPELENTSASAASK*
Ga0136449_10431919613300010379Peatlands SoilDSGFPLRRISVVHGRYVATTPFDGVIAQPENEAQSANASAGSN*
Ga0137392_1022506133300011269Vadose Zone SoilRWRRGPDSGFPLRRINVVHGRFLAATPFDGVIAQPENESQSASAEGVGGK*
Ga0137392_1129311913300011269Vadose Zone SoilRHITVAHGRYVAATPFDGVIAQPQSEAQNTAALNSGASN*
Ga0137393_1107044923300011271Vadose Zone SoilRGPDSGFPLRHITVAHGRYVAATPFDGVIAQPQSEAQNTAALNSGASN*
Ga0137382_1014386133300012200Vadose Zone SoilPDTGFPLRRVSVVGGRFIAATPFDGVVLQPDDGNISAAAGNGSSN*
Ga0137399_1078419413300012203Vadose Zone SoilGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVVLQPENESISANAEAGSTE*
Ga0137362_1077975913300012205Vadose Zone SoilSWRRGPDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASAE*
Ga0137362_1131110423300012205Vadose Zone SoilDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN*
Ga0137362_1162053313300012205Vadose Zone SoilVSVIGGRYVGATPFDGVVLQPENESISATAEAGSTE*
Ga0137387_1133628623300012349Vadose Zone SoilRRISVVRGRLLAATPFDGVIAQPESEAESAAAGVAGASN*
Ga0137386_1032961423300012351Vadose Zone SoilHITVAHGRYVAATPFDGVIAQPQSESQSAAALNSGASN*
Ga0137361_1186890623300012362Vadose Zone SoilSVVGGRFVAATPFDGVVLQPDDGNISAAAGTGSAD*
Ga0137358_1103526513300012582Vadose Zone SoilPLRRVSVVGGRFVAATPFDGVVLQPENGDISAAAGNGSSN*
Ga0137396_1074881623300012918Vadose Zone SoilDSGRSWQRGPDTGFPLRRVSVIGGRFVAATPFDGVVLQPDDGNISAAAGTGNSN*
Ga0137413_1020590233300012924Vadose Zone SoilRGPDTGFPLRRVSVIGGRFVAATPFDGVVLQPEDGNISAAADSGSTK*
Ga0137416_1124802913300012927Vadose Zone SoilGPDSGFPLRRVSVIGGRFVGATPFDGVVLQPENESISAAVEAGSTE*
Ga0137416_1131328323300012927Vadose Zone SoilGFPLRHITVAHGRYVAATPFDGVIAQPQSESQSAAALNSGASN*
Ga0137407_1141704913300012930Vadose Zone SoilPDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASADTGSN*
Ga0126375_1150267123300012948Tropical Forest SoilPLRRVSVVGGRFVAATPFDGVVVQPGDGNMSAAADAGSN*
Ga0134110_1003414033300012975Grasslands SoilPLRRVSVMRGRFLAATPFDGVILQPEGESERASAGLGGSSN*
Ga0164305_1049994123300012989SoilFPLRRITVIHGRYVAATPFDGVVVQPESEPQSAAVDGSSR*
Ga0164305_1122247933300012989SoilGPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN*
Ga0157373_1007024533300013100Corn RhizosphereRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD*
Ga0157374_1015536413300013296Miscanthus RhizosphereWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGMGGSSE*
Ga0157378_1141942823300013297Miscanthus RhizosphereGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN*
Ga0181521_1022153813300014158BogSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE*
Ga0181521_1042802813300014158BogFPLRRVSIIGGRFVGATPFDGVILQPEGESISAAAGSGSTE*
Ga0181530_1003181253300014159BogSWQRGPDSGFPLRRVSVIGGRFVAATPFDGVILQPENESISAAAEAGSSE*
Ga0181534_10000299373300014168BogFPLRRVSIVHGRYVAATPFDGVVAQPESQSQSASASSGGN*
Ga0182018_1063792413300014489PalsaRGPDSGFPLRRISVVNGHYVAATPFDGVIAQPENEAQSANAGGGSN*
Ga0182017_1049770413300014494FenFPLRRVSIIGGRFVAATPFDGVILQPENESISAAAGSGGTE*
Ga0181516_1009458813300014655BogSGFPLRRISVVHGRFVAATPFDGVIAQPQDEMQSANAGGSN*
Ga0182030_1025524623300014838BogSRGPDAGYPLRRVSILHGQFLAATPFDGVILQPENESQSAAVGLGGASN*
Ga0157379_1022279343300014968Switchgrass RhizospherePDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE*
Ga0167643_101290013300015089Glacier Forefield SoilRRISVVHGRFMAATPFDGVIVQPENEPQSAAADAGMSN*
Ga0137403_1011810553300015264Vadose Zone SoilLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN*
Ga0137403_1118335913300015264Vadose Zone SoilTGVVFESKDGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEASSALVGLGGSSE*
Ga0137403_1158211313300015264Vadose Zone SoilGYPLRRVSVVGGRFVAATPFDGVVLQPENGDISAAAGNGSSN*
Ga0181511_104004913300016702PeatlandRRISVVHGRYVAATPFDGVIAQPENESQSANAGGGSN
Ga0187802_1031477723300017822Freshwater SedimentRGPDSGYPLRHISVVNGHYVGATPFDGVIVQTESEGRSASASVTTRRTN
Ga0187818_1015883933300017823Freshwater SedimentGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVKAGGTE
Ga0187824_1016830923300017927Freshwater SedimentRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN
Ga0187825_1002569533300017930Freshwater SedimentYPLRRVSVVHGRFIGATPFDGVILQPENDGQSAAAGSGGGSK
Ga0187803_1016732713300017934Freshwater SedimentRDGGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPEDESISAAAEAGSTE
Ga0187853_1025034923300017940PeatlandRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGGSTE
Ga0187817_1068400323300017955Freshwater SedimentRSWQRGPDSGYPLRRVSVVGGRFIGATPFDGVVLQPENEPMSAAADAGSTE
Ga0187781_1000657813300017972Tropical PeatlandPLRRVSIVGGRFIGATPFDGVILQPENESISAAADMSSSE
Ga0187781_1013908143300017972Tropical PeatlandPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVKGGGTE
Ga0187782_1004466063300017975Tropical PeatlandVSIVGGRFIGATPFDGVILQPENESISAAADMSSSE
Ga0187823_1000010713300017993Freshwater SedimentLVRGRFVGATPFDGLIVQPENEAASASAGFGGSSD
Ga0187816_1025306513300017995Freshwater SedimentGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGVGSTE
Ga0187868_129650713300018002PeatlandFPLRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE
Ga0187878_106403233300018005PeatlandWQRGPDSGFPLRRVSVIGGRFVAATPFDGVILQPENESISAAAEAGSSE
Ga0187888_122249723300018008PeatlandLRRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE
Ga0187884_1002708013300018009PeatlandRDGGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGGSTK
Ga0187810_1003232043300018012Freshwater SedimentFESRDGGRSWQRGPDSGFPLRRVSVIGGRFVGATSFDGVILQPENESISAVVEAGSTE
Ga0187872_1015943523300018017PeatlandRVSVIGGRFVGATPFDGVILQPENESISAVAGGSTE
Ga0187886_117169533300018018PeatlandGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVVGGSTK
Ga0187864_1003974343300018022PeatlandRRVSVIGGRFVGATPFDGVILQPENESISSVTAIGGTE
Ga0187889_1046365313300018023PeatlandGSTWQRGPDSGFPLLRISVVHGRYVAATPFDGVIAQPENDSQSANAGGGSN
Ga0187857_1009419613300018026PeatlandDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAAAEAGSTE
Ga0184608_1030060923300018028Groundwater SedimentRRGPDSGYPLRRISVVRGRFMAATPFDGVIAQPESEVESASAETGSN
Ga0187869_1014633213300018030PeatlandSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAVAAAGSTE
Ga0187863_1055836213300018034PeatlandRVSIIGGRLVGATPFDGVILQPENESISAAAGVGGNE
Ga0187883_1056463113300018037PeatlandGFPLRRISVVHGRFVAATPFDGVIAQPENEPQSANAGGGSN
Ga0187883_1068242723300018037PeatlandLRRISVVHGRYVAATPFDGVIAQPEDETQSASGGSN
Ga0187862_1050798723300018040PeatlandPDSGFPLRRVSIIGGRFVGATPFDGVILQPEGESISAAAEAGSTE
Ga0187871_1063709413300018042PeatlandRISVVHGRFVAATPFDGVIAQPENEPQSANAGGGSN
Ga0066662_1036370913300018468Grasslands SoilLSVVRGRVLAATPFDGVVAQPDKEAQTASAGGASR
Ga0193731_116948013300020001SoilLRRISVVRGRFMAATPFDGVVAQPESDVESASADTGSN
Ga0193726_107949813300020021SoilGYPLRRISVVHGRFMAATPFDGVIVQPENEPQSAAADAGMAN
Ga0210403_1059003113300020580SoilFPLRRVSVVHGRFVGATPFDGVIVQPENEPQSAAAGSGGASN
Ga0210399_1008747713300020581SoilRRVSVVRGRFVGATPFDGLIVQPENEAASASLGGGSSN
Ga0210408_1012405313300021178SoilLRRISVVHGRFVAATSFDGVVVQPENGPQSAAAGMGDSSN
Ga0210388_1111039423300021181SoilPLRQISVIHGHYVAATPFDGVISQPDNEPQSANAGGGSN
Ga0193719_1041260523300021344SoilSGYPLRRISVVRGRFIGATPFDGVIVQPENEAESASASFGNSSN
Ga0210385_1151965723300021402SoilSVVHGHFVAATPFDGVVVQPDGDRSASAGVGSSNN
Ga0210397_1005472513300021403SoilGPDSGYPLRRISVVHGRFVAATPFDGVIAQPENESQSANAGSGSN
Ga0210386_1157395623300021406SoilSGYPLRRISVVHGRFVAATPFDGVIAQPENESQSANAGSGSN
Ga0210394_1039102523300021420SoilRGPDSGYPLRRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN
Ga0210394_1083697013300021420SoilVSVIGGRFVGATPFDGVVLQPENESISATAEAGSTE
Ga0210384_1035366823300021432SoilKTWKRGPDSGFPLRRISVVHGRYVAATPFDGVVAQPENESQSANAGSGSN
Ga0210398_1136355523300021477SoilISVVHGRFVAATPFDGVIAQPENESQSANAGSGSN
Ga0210409_1155121513300021559SoilLRRVSVVRGRFVGATPFDGLIVQPENEAANASLGGGSSN
Ga0224562_100091213300022733SoilGFPLRHISVVHGHYVAATPFDGVIAQPENEPQSANAGGRSN
Ga0208562_100354913300025460PeatlandGRSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVVLQPENESISAAAEAGSTE
Ga0208688_107737123300025480PeatlandRVSVIGGRFAGATPFDGVILQPEDESISAAAEAGSTE
Ga0207696_108743923300025711Switchgrass RhizosphereLRRITVIHGRYVAATPFDGVVVQPESEPQSAAVDGSSR
Ga0207654_1011967013300025911Corn RhizosphereRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD
Ga0207652_1022757333300025921Corn RhizosphereVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD
Ga0207646_1018033113300025922Corn, Switchgrass And Miscanthus RhizosphereWHRGPDSGYPLRLISVVRGRLLAATPFDGVIAQPESEAKSAAPGVAGASN
Ga0207646_1160663213300025922Corn, Switchgrass And Miscanthus RhizosphereSKDSGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGVIIQPENEAQSASVSMGGSSN
Ga0207694_1028981533300025924Corn RhizosphereLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE
Ga0207644_1085400123300025931Switchgrass RhizosphereGVIFESKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGFGGSSE
Ga0207661_1048450823300025944Corn RhizosphereSVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD
Ga0207658_1031933123300025986Switchgrass RhizosphereSDDDGISWHRGPDSGYPLRHVRVVQGRFLAATPFDGVIAQPAGEVASATASAATSH
Ga0207639_1142734813300026041Corn RhizosphereSVVRGRFVGATPFDGLIVQPENEAASASAGMGGSSE
Ga0207641_1166001623300026088Switchgrass RhizosphereFPLRRISVVHGRYLAATPFDGVIVQPESEPQSAAMESTR
Ga0209234_108397633300026295Grasslands SoilRVSVVGGRFVAATPFDGVVLQPENGDISAAADAGSN
Ga0209267_107723033300026331SoilYPLRRISVVRGRFMAATPFDGVIAQPESKVESASAE
Ga0208365_101174223300027070Forest SoilSGYPLRRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN
Ga0209422_106960813300027629Forest SoilFESRDGGRSWQRGPDSGFPLRRVSVIGGRFVGATSFDGVIIQPENESISASVQTGNSE
Ga0209180_1026555813300027846Vadose Zone SoilGYPLRLISVVRGRLLAATPFDGVIAQPESEAKSAAGVAGASN
Ga0209517_1042354813300027854Peatlands SoilRSWQRGPDSGFPLRRVSVFGGRFVGATPFDGVILQPENESISASAEAGSTE
Ga0209693_1022918723300027855SoilSVIGGRLVGATPFDGVILQPENESISAAAEAGSTE
Ga0209465_1010115113300027874Tropical Forest SoilYPLRRVSVVGGRFIAATPFDGVVLQPGDGNMSAAADAGSN
Ga0209169_1049266023300027879SoilRGPDTGYPLRRISVVHGHYVAATPFDGVVVQPDGDRSASAGVGSSTN
Ga0209067_1076831623300027898WatershedsVSIVGGRYIGATPFDGVILQPENESISAAAGMGSSQ
Ga0209067_1090809313300027898WatershedsPDTGFPLRRVSVLGGRFIAATPFDGVVLQPETDPISANASTGSSE
Ga0209488_1046598313300027903Vadose Zone SoilDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASAAAGLSGSSN
Ga0209069_1001173453300027915WatershedsTGVIFESKDGGRSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSE
Ga0268264_1170981523300028381Switchgrass RhizosphereSWHRGPDSGYPLRRVSVVRGRFVGATPFDGLIVQPENEAASASAGMGGSSE
Ga0302189_1018272623300028788BogRGPDSGFPLRRISVVHGRYVAATPFDGVIAQPEDETQSASGGSN
Ga0308309_1181263713300028906SoilRRISVVHGHFVAATPFDGVVVQPDGDRSASADVGSSTN
Ga0311327_1040660113300029883BogVSIIGGRLVGATPFDGVILQPENESISAAAGVGGTE
Ga0311369_1077673623300029910PalsaDSGFPLRRISVMHGHYVAATPFDGVIAQPENEAHSASASGGSN
Ga0311326_1060794423300029917BogRRVSIIGGRLVGATPFDGVILQPENESISAAAGVGGNE
Ga0302143_117413123300029918BogDSGFPLRRISVVHGRYVAATPFDGVIAQPEDETQSASGGSN
Ga0311363_1005235813300029922FenISVVHGHYVAATPFDGVIAQPDNEPQSANAGGGSK
Ga0311328_1040160613300029939BogSWQRGPDSGFPLRRVSIIGGRLVGATPFDGVILQPENESISAAAGVGGNE
Ga0311339_1034417333300029999PalsaISVVHGRYVAATPFDGVVAQPENESQSANAGSGTN
Ga0311355_1022437623300030580PalsaLRRVSVIGGRFVGATPFDGVILQPDNEPMSANAGSSE
Ga0316363_1007618943300030659Peatlands SoilRRVSVFGGRFVGATPFDGVILQPENESISASAEAGSTE
Ga0265760_1026263913300031090SoilSWQRGPDSGFPLRRVGVLGGRFIGATPFDGVILQPDNEPMSAAAGSSE
Ga0302324_10062439713300031236PalsaWQRGPDSGFPLRHISVVHGHYVAATPFDGVIAQPENEPQSANAGGGSN
Ga0170820_1342246213300031446Forest SoilDSGYPLRRVSIVRGRFVGATPFDGLIVQPENEAASASAGLGGSSE
Ga0318528_1076764513300031561SoilRVSVVHGRFVGATPFDGVIVQPENEPQSAAAGSGGGNN
Ga0307474_1040154623300031718Hardwood Forest SoilDSGFPLRRISVVHGRYVAATPFDGVVAQPENDSQSANAGSGSN
Ga0307469_1075772713300031720Hardwood Forest SoilSSDSGRSWQRGPDTGFPLRRVSVVGGRFIAATPFDGVVLEPGDGNISAAAGTGSSN
Ga0302321_10244585013300031726FenQISVVHGRFMAATPFDGVIVQPDHENESASAEPSN
Ga0307477_1027842123300031753Hardwood Forest SoilYPLRRVSVIRGRFLGATPFDGVIMQPEGESESAAAGSGGGSN
Ga0307475_1021227413300031754Hardwood Forest SoilSVVHGRFLGATPFDGVILQPEGGSESAAAGSGGGSK
Ga0307475_1138051123300031754Hardwood Forest SoilLRRVSVIGGRFVGATPFDGVVLQPENESISATAEAGSTE
Ga0310910_1144835213300031946SoilRVSVVHGRYIAATPFDGIVLQPESDMQSASAEAGSGSRN
Ga0307479_1011967113300031962Hardwood Forest SoilDSGFPLRRISVVNGRFVAATPFDGVIAQPERESESAAMGGGSSK
Ga0307479_1025001843300031962Hardwood Forest SoilRRISVVHGRFVAATPFDGVIVQPENGPQSAAAGMGDSSN
Ga0311301_1098432033300032160Peatlands SoilRRISVVHGHYVAATPFDGVVVQPDGDRSASAGVGSSTN
Ga0307471_10083948333300032180Hardwood Forest SoilSKDNGRTWHRGPDSGYPLRRISVVRGRFVGATPFDGVIVQPENEAESASAGFGSSSN
Ga0307471_10117254813300032180Hardwood Forest SoilLISVVRGRLLAATPFDGVIAQPESEAKSAAAGVAGASN
Ga0307471_10133379913300032180Hardwood Forest SoilVVHGRFVAATPFEGVILQPESGPQSAAADGGGASN
Ga0307471_10229684723300032180Hardwood Forest SoilRGPDTGYPLRRISVVHGHFVAATPFDGVVVQPDGDRSASAGVGSSTN
Ga0307472_10199808513300032205Hardwood Forest SoilESKDGGRSWHRGPDSGYPLRRVSVVRGRLVGATPFDGLIVQPENEAASASAGFGGSSD
Ga0335080_1114164813300032828SoilESRDSGRSWQRGPDAGYPLRRLSVAPGRLLGATPFDGVIEQPENPSQSAAAGLGASSN
Ga0335069_1016442023300032893SoilPLRRVSVMGGRFVGATPFDGVVLQPDGEPMSAAAGSTE
Ga0335069_1086491713300032893SoilLRRISVVHGHYVAATPFDGIVVEPDGENHSAAINGGSSN
Ga0335071_1149936213300032897SoilGRSWQRGPDSGYPLRRVSVMGGRFVGATPFDGVVLQPDGEPMSAAAGSTE
Ga0335083_1148539513300032954SoilDSGYPLRRINVVHGRFVAATPFDGVILQPGNESQSAGLD
Ga0335077_1047511423300033158SoilQRGPDSGYPLRRVSVMGGRFVGATPFDGVVLQPDGEPMSAAAGSTE
Ga0326728_1032182733300033402Peat SoilDSGFPLRRVSIIGGRFVGATPFDGVILQPANESISAAAEAGGTE
Ga0326726_1066766223300033433Peat SoilQRGPDSGYPLRRVSVVGGRYVGATPFDGIILQPENESISAAAGTGSSR
Ga0316628_10417844313300033513SoilGRSWHRGPDSGYPLRRISVVRGRFVGATPFDGLIVQPENEAASASAGLGGSSD
Ga0334811_059701_1_1533300033891SoilSWQRGPDSGFPLRRVSVIGGRFVGATPFDGVILQPENESISAAAGSGGTE
Ga0370515_0214275_2_1273300034163Untreated Peat SoilFPLRRISIIGGRFVGATPFDGVILQPENELNRASAGVGGNE
Ga0370515_0488378_364_5193300034163Untreated Peat SoilGGTSWQRGPDSGFPLRHISVVHGHYVAATPFDGVIAQPENEPQSANAGGSN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.