NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020052

Metagenome / Metatranscriptome Family F020052

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020052
Family Type Metagenome / Metatranscriptome
Number of Sequences 226
Average Sequence Length 42 residues
Representative Sequence EFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Number of Associated Samples 204
Number of Associated Scaffolds 226

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.69 %
% of genes from short scaffolds (< 2000 bps) 85.40 %
Associated GOLD sequencing projects 188
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.469 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.850 % of family members)
Environment Ontology (ENVO) Unclassified
(19.912 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.885 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 226 Family Scaffolds
PF00091Tubulin 65.93
PF12327FtsZ_C 22.57
PF00905Transpeptidase 1.33
PF08238Sel1 0.88
PF09537DUF2383 0.44
PF13231PMT_2 0.44
PF05960DUF885 0.44
PF09720Unstab_antitox 0.44
PF08447PAS_3 0.44
PF14534DUF4440 0.44
PF16576HlyD_D23 0.44
PF00005ABC_tran 0.44
PF15631Imm-NTF2-2 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 226 Family Scaffolds
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.47 %
UnclassifiedrootN/A30.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02FX8Q4Not Available515Open in IMG/M
3300000955|JGI1027J12803_104215120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis511Open in IMG/M
3300000955|JGI1027J12803_104456103All Organisms → cellular organisms → Bacteria → Acidobacteria915Open in IMG/M
3300001174|JGI12679J13547_1015344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300001546|JGI12659J15293_10073178All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300001990|JGI24737J22298_10151786All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae684Open in IMG/M
3300002245|JGIcombinedJ26739_100265658All Organisms → cellular organisms → Bacteria → Acidobacteria1602Open in IMG/M
3300003505|JGIcombinedJ51221_10047487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1621Open in IMG/M
3300004635|Ga0062388_102496594All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005093|Ga0062594_103154193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae516Open in IMG/M
3300005171|Ga0066677_10003890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5862Open in IMG/M
3300005186|Ga0066676_10378072Not Available952Open in IMG/M
3300005332|Ga0066388_102403695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae956Open in IMG/M
3300005333|Ga0070677_10012816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2917Open in IMG/M
3300005343|Ga0070687_101479220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83510Open in IMG/M
3300005363|Ga0008090_15673287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1498Open in IMG/M
3300005435|Ga0070714_101698443Not Available617Open in IMG/M
3300005436|Ga0070713_102434350Not Available506Open in IMG/M
3300005437|Ga0070710_11519107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae504Open in IMG/M
3300005468|Ga0070707_101046948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae782Open in IMG/M
3300005541|Ga0070733_10976556Not Available569Open in IMG/M
3300005542|Ga0070732_10731070All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005569|Ga0066705_10333854All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter958Open in IMG/M
3300005575|Ga0066702_10975509Not Available507Open in IMG/M
3300005591|Ga0070761_10015117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4297Open in IMG/M
3300005602|Ga0070762_10048079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2344Open in IMG/M
3300005602|Ga0070762_10983144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae578Open in IMG/M
3300005843|Ga0068860_100132256All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300005950|Ga0066787_10108864Not Available597Open in IMG/M
3300006028|Ga0070717_10054352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3302Open in IMG/M
3300006032|Ga0066696_10337406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae982Open in IMG/M
3300006034|Ga0066656_11070337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae518Open in IMG/M
3300006057|Ga0075026_100462936Not Available724Open in IMG/M
3300006102|Ga0075015_100204628All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1052Open in IMG/M
3300006162|Ga0075030_100888222Not Available703Open in IMG/M
3300006162|Ga0075030_101182401All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae601Open in IMG/M
3300006175|Ga0070712_100667943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus884Open in IMG/M
3300006175|Ga0070712_101458360All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300006796|Ga0066665_11645975Not Available507Open in IMG/M
3300006804|Ga0079221_11160708Not Available596Open in IMG/M
3300006893|Ga0073928_10029999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium5257Open in IMG/M
3300007265|Ga0099794_10297714Not Available835Open in IMG/M
3300009098|Ga0105245_10696177Not Available1049Open in IMG/M
3300009137|Ga0066709_104024832All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009143|Ga0099792_10032450All Organisms → cellular organisms → Bacteria → Acidobacteria2429Open in IMG/M
3300009518|Ga0116128_1172773Not Available613Open in IMG/M
3300009522|Ga0116218_1417653All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300009522|Ga0116218_1478255All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300009523|Ga0116221_1223261All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300009523|Ga0116221_1347379Not Available643Open in IMG/M
3300009525|Ga0116220_10215857All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300009637|Ga0116118_1273246All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300009698|Ga0116216_10126665All Organisms → cellular organisms → Bacteria → Acidobacteria1571Open in IMG/M
3300009764|Ga0116134_1260264Not Available598Open in IMG/M
3300009839|Ga0116223_10761625Not Available554Open in IMG/M
3300010048|Ga0126373_10908507Not Available945Open in IMG/M
3300010159|Ga0099796_10210247Not Available793Open in IMG/M
3300010343|Ga0074044_11011178All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010360|Ga0126372_10977352All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300010361|Ga0126378_13134459All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010375|Ga0105239_11167975All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300010376|Ga0126381_104432439All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300010396|Ga0134126_11790610Not Available673Open in IMG/M
3300010400|Ga0134122_11788044All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300010401|Ga0134121_11472269All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300010880|Ga0126350_10277622All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300011120|Ga0150983_12882891All Organisms → cellular organisms → Bacteria → Acidobacteria1305Open in IMG/M
3300011120|Ga0150983_13496584All Organisms → cellular organisms → Bacteria → Acidobacteria1122Open in IMG/M
3300011120|Ga0150983_16726962All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300011270|Ga0137391_10395461All Organisms → cellular organisms → Bacteria → Acidobacteria1182Open in IMG/M
3300011270|Ga0137391_11483440Not Available523Open in IMG/M
3300012096|Ga0137389_10998190All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300012202|Ga0137363_10807306Not Available796Open in IMG/M
3300012349|Ga0137387_10766066All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300012353|Ga0137367_10516526All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300012359|Ga0137385_10740149Not Available819Open in IMG/M
3300012469|Ga0150984_106822354All Organisms → cellular organisms → Bacteria → Acidobacteria3141Open in IMG/M
3300012918|Ga0137396_11156705All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300012925|Ga0137419_10295391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1237Open in IMG/M
3300012985|Ga0164308_11497765All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012986|Ga0164304_10863421Not Available704Open in IMG/M
3300013104|Ga0157370_11231602All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300013296|Ga0157374_11581263All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300013296|Ga0157374_12181592All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300013307|Ga0157372_10891269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB5112881032Open in IMG/M
3300013307|Ga0157372_13029231Not Available537Open in IMG/M
3300013308|Ga0157375_10659539All Organisms → cellular organisms → Bacteria → Acidobacteria1202Open in IMG/M
3300014201|Ga0181537_10083647All Organisms → cellular organisms → Bacteria → Acidobacteria2165Open in IMG/M
3300014325|Ga0163163_10322566All Organisms → cellular organisms → Bacteria → Acidobacteria1598Open in IMG/M
3300014490|Ga0182010_10480448Not Available685Open in IMG/M
3300014495|Ga0182015_10780533All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300014839|Ga0182027_10668792All Organisms → cellular organisms → Bacteria → Acidobacteria1105Open in IMG/M
3300015372|Ga0132256_103828170Not Available506Open in IMG/M
3300016270|Ga0182036_10627266All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300016702|Ga0181511_1060340Not Available572Open in IMG/M
3300017822|Ga0187802_10150247Not Available889Open in IMG/M
3300017823|Ga0187818_10519639All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300017930|Ga0187825_10182440Not Available750Open in IMG/M
3300017936|Ga0187821_10167788All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300017936|Ga0187821_10504755All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300017943|Ga0187819_10417570Not Available770Open in IMG/M
3300017943|Ga0187819_10534821Not Available667Open in IMG/M
3300017961|Ga0187778_10934350All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300017966|Ga0187776_11500816All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300017975|Ga0187782_10077051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2439Open in IMG/M
3300018014|Ga0187860_1129165All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300018034|Ga0187863_10019424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4172Open in IMG/M
3300018034|Ga0187863_10474346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus700Open in IMG/M
3300018035|Ga0187875_10748263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300018043|Ga0187887_10823686Not Available549Open in IMG/M
3300018046|Ga0187851_10834951Not Available518Open in IMG/M
3300018047|Ga0187859_10301068Not Available868Open in IMG/M
3300018062|Ga0187784_10860657All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300018431|Ga0066655_10688270All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300018468|Ga0066662_11592120All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300019886|Ga0193727_1068789Not Available1099Open in IMG/M
3300020150|Ga0187768_1029098All Organisms → cellular organisms → Bacteria → Acidobacteria1201Open in IMG/M
3300020199|Ga0179592_10155780Not Available1044Open in IMG/M
3300020579|Ga0210407_10494116All Organisms → cellular organisms → Bacteria → Acidobacteria956Open in IMG/M
3300020581|Ga0210399_10605128All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300021088|Ga0210404_10823439All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300021168|Ga0210406_10198718All Organisms → cellular organisms → Bacteria → Acidobacteria1663Open in IMG/M
3300021170|Ga0210400_10533999All Organisms → cellular organisms → Bacteria → Acidobacteria968Open in IMG/M
3300021170|Ga0210400_10739854Not Available808Open in IMG/M
3300021171|Ga0210405_10356840All Organisms → cellular organisms → Bacteria → Acidobacteria1153Open in IMG/M
3300021178|Ga0210408_11150874All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300021181|Ga0210388_11810542All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300021388|Ga0213875_10499566Not Available584Open in IMG/M
3300021402|Ga0210385_10535259All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300021402|Ga0210385_11133678All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021432|Ga0210384_11206743All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300021433|Ga0210391_10293563All Organisms → cellular organisms → Bacteria → Acidobacteria1276Open in IMG/M
3300021479|Ga0210410_10289642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1469Open in IMG/M
3300021479|Ga0210410_10835336All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300021560|Ga0126371_11096637Not Available935Open in IMG/M
3300021858|Ga0213852_1483239Not Available1160Open in IMG/M
3300022533|Ga0242662_10226492Not Available598Open in IMG/M
3300022557|Ga0212123_10897772All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300022724|Ga0242665_10216824All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300025134|Ga0207416_1190990All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300025473|Ga0208190_1002114All Organisms → cellular organisms → Bacteria6366Open in IMG/M
3300025500|Ga0208686_1109742All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025906|Ga0207699_10039178All Organisms → cellular organisms → Bacteria → Acidobacteria2721Open in IMG/M
3300025913|Ga0207695_10802587All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300025915|Ga0207693_10979240Not Available646Open in IMG/M
3300025916|Ga0207663_10840124Not Available733Open in IMG/M
3300025920|Ga0207649_10014965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4355Open in IMG/M
3300025923|Ga0207681_11655517All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300025925|Ga0207650_10160599All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300025928|Ga0207700_11033732All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300025931|Ga0207644_10804522All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300025932|Ga0207690_10112145All Organisms → cellular organisms → Bacteria → Acidobacteria1966Open in IMG/M
3300025939|Ga0207665_10424015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1017Open in IMG/M
3300026078|Ga0207702_10198087All Organisms → cellular organisms → Bacteria → Acidobacteria1860Open in IMG/M
3300026305|Ga0209688_1110251All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300026315|Ga0209686_1070166All Organisms → cellular organisms → Bacteria → Acidobacteria1248Open in IMG/M
3300026319|Ga0209647_1104880All Organisms → cellular organisms → Bacteria → Acidobacteria1339Open in IMG/M
3300026329|Ga0209375_1118794All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300026330|Ga0209473_1168535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288868Open in IMG/M
3300026334|Ga0209377_1005543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7774Open in IMG/M
3300026497|Ga0257164_1040058All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300026550|Ga0209474_10162716All Organisms → cellular organisms → Bacteria1445Open in IMG/M
3300026557|Ga0179587_10191044All Organisms → cellular organisms → Bacteria → Acidobacteria1294Open in IMG/M
3300027069|Ga0208859_1011870Not Available961Open in IMG/M
3300027266|Ga0209215_1029717All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300027376|Ga0209004_1061904All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300027575|Ga0209525_1111394All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300027629|Ga0209422_1102412All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300027641|Ga0208827_1179734Not Available572Open in IMG/M
3300027643|Ga0209076_1071663All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300027676|Ga0209333_1179190All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300027701|Ga0209447_10158203All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300027725|Ga0209178_1345729Not Available555Open in IMG/M
3300027768|Ga0209772_10268426Not Available541Open in IMG/M
3300027783|Ga0209448_10000505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis12997Open in IMG/M
3300027795|Ga0209139_10099697Not Available1022Open in IMG/M
3300027853|Ga0209274_10120960All Organisms → cellular organisms → Bacteria → Acidobacteria1304Open in IMG/M
3300027869|Ga0209579_10018381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3995Open in IMG/M
3300027875|Ga0209283_10685960All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300027882|Ga0209590_10527858Not Available762Open in IMG/M
3300027894|Ga0209068_10302494Not Available898Open in IMG/M
3300027895|Ga0209624_10587312All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300027911|Ga0209698_10889235All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300028017|Ga0265356_1000754All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5497Open in IMG/M
3300028536|Ga0137415_10739873All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300028775|Ga0302231_10170464All Organisms → cellular organisms → Bacteria → Acidobacteria909Open in IMG/M
3300028777|Ga0302290_10028564All Organisms → cellular organisms → Bacteria → Acidobacteria1375Open in IMG/M
3300028792|Ga0307504_10038437All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300028800|Ga0265338_10442463All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300029943|Ga0311340_10581887Not Available982Open in IMG/M
3300030019|Ga0311348_11160853Not Available574Open in IMG/M
3300030056|Ga0302181_10196299Not Available937Open in IMG/M
3300030058|Ga0302179_10266535All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300030760|Ga0265762_1089173All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300031128|Ga0170823_14413193All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300031128|Ga0170823_17662297All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031236|Ga0302324_100478254All Organisms → cellular organisms → Bacteria → Acidobacteria1828Open in IMG/M
3300031249|Ga0265339_10186614All Organisms → cellular organisms → Bacteria → Acidobacteria1030Open in IMG/M
3300031715|Ga0307476_10424633All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300031718|Ga0307474_10017272All Organisms → cellular organisms → Bacteria → Acidobacteria5234Open in IMG/M
3300031718|Ga0307474_10946756All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031720|Ga0307469_11355735Not Available677Open in IMG/M
3300031720|Ga0307469_11788959Not Available593Open in IMG/M
3300031820|Ga0307473_11493627All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031823|Ga0307478_11643515All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031912|Ga0306921_10673994All Organisms → cellular organisms → Bacteria → Acidobacteria1190Open in IMG/M
3300032160|Ga0311301_10172046All Organisms → cellular organisms → Bacteria3821Open in IMG/M
3300032180|Ga0307471_100769486All Organisms → cellular organisms → Bacteria → Acidobacteria1129Open in IMG/M
3300032515|Ga0348332_10103190All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300032782|Ga0335082_10301549All Organisms → cellular organisms → Bacteria → Acidobacteria1475Open in IMG/M
3300032895|Ga0335074_10504808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1253Open in IMG/M
3300033004|Ga0335084_12229100All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300033806|Ga0314865_054447Not Available1030Open in IMG/M
3300033807|Ga0314866_021022All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.08%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.10%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.10%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.21%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.21%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.21%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.77%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.33%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.33%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.44%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.44%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.44%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.44%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.44%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.44%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.44%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.44%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.89%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027069Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes)EnvironmentalOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028777Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033806Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_004320402065487018SoilTVLGMVYYGHRARIARGLQDGGWSSRMKAMFAKKGA
JGI1027J12803_10421512023300000955SoilELAEPEFATLLGLVYYGHRARVARGIQDDRWSSKIKAMFAKRGA*
JGI1027J12803_10445610323300000955SoilEFATVLGMVNYGHRARIARGFQEGGLGSRLKAMLVGKGA*
JGI12679J13547_101534413300001174Forest SoilKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA*
JGI12659J15293_1007317823300001546Forest SoilLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA*
JGI24737J22298_1015178623300001990Corn RhizospherePEFATVLGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA*
JGIcombinedJ26739_10026565813300002245Forest SoilSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKSLLVGKGA*
JGIcombinedJ51221_1004748713300003505Forest SoilLSEPEFATVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA*
Ga0062389_10171956513300004092Bog Forest SoilVLRRSVRLSWPAPLAKMPSTLSEPEHATVLGMVNYGQRARVARGIQEGGLGSRLKALLIGKGA*
Ga0062388_10249659413300004635Bog Forest SoilEPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA*
Ga0062594_10315419313300005093SoilALAKMPSTLSEPEFATVLGMATYSHRSRTARGFQDGRWSSKLKAMLVGKGA*
Ga0066672_1035806923300005167SoilRLSWPAPLAKMPASLAEPEYATVLGMVNYGQRARIARGYQDDRWGSKLKALLVGKGA*
Ga0066677_1000389013300005171SoilEPEFATVLGMVSYGHRARTARGMQDDGWSGRLKALFADKGA*
Ga0066676_1037807223300005186SoilPEFATVLGMVTYGHRARSARGVQDGRWSSRLKAMLVGKAASSY*
Ga0066388_10240369523300005332Tropical Forest SoilLAKMPSTLSEPEFATVLGMVNYGQRARIARGFQEGGLGSRLKAMLVGKGA*
Ga0070677_1001281643300005333Miscanthus RhizosphereAEPEFATLLGLVYYGQRARMARGYQDYGWSSRLKALFAKKGA*
Ga0070687_10147922023300005343Switchgrass RhizosphereEPEYATLLGMVFYTHRARIARGLQDERWSSRLKALFALKGA*
Ga0008090_1567328723300005363Tropical Rainforest SoilAMLAEPEYATALGIVYYAHRARIARGIQDERWSSKLKSLFALKGA*
Ga0070714_10169844323300005435Agricultural SoilEFATVLGMVMYGHRARTARGALDERWSSRLKSMLVGKGA*
Ga0070713_10243435013300005436Corn, Switchgrass And Miscanthus RhizosphereLAEPEFATVLGMVAYGHRARSARGIQDDRWSSRLKAMLVGKGA*
Ga0070710_1151910723300005437Corn, Switchgrass And Miscanthus RhizosphereLAEPEFATVLGMVFYGHRARIARGIQNGRWSSKLKAMFVGKGA*
Ga0066689_1054488513300005447SoilGIFDVAESVLRRPVRLSWPTPLAKMPASLAEPEYATVLGMVNYGQRARIARGYQEDRWGSKLKALLVGKGA*
Ga0070707_10104694813300005468Corn, Switchgrass And Miscanthus RhizosphereAEPEFATVLGMVSYGHRARTARGMQDDGWSSRLKSLFANRGA*
Ga0070733_1097655623300005541Surface SoilATVLGMVMYGHRARSARGVQDERWSSRLKAMLVGKGA*
Ga0070732_1073107023300005542Surface SoilFATVLGMVNYGQRARIARGYQEDRWGSKLKALLVGKGA*
Ga0066705_1033385413300005569SoilELAEPEFATALGMIYYGHRARVARGVQDDRWSSRLKAMFVKKGA*
Ga0066702_1097550913300005575SoilTVLGMVMYGHRARTARGALDERWSSKLKSMLVGKGA*
Ga0070761_1001511713300005591SoilLGMAYYGHRARLARGLQEPSFGSRMKALFAGKGA*
Ga0070761_1029937213300005591SoilIFDVAESVLRRPVRLSWPTPLAKMPVSLAEPEYATVLGMVAYGQRARMARGFQGDRWGSRLKAMLVG*
Ga0070762_1004807933300005602SoilATLAEPEFATLLGMVNYGQRARVARGYQGDRWGSRLKAMLVG*
Ga0070762_1098314423300005602SoilAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA*
Ga0068860_10013225633300005843Switchgrass RhizosphereTVIGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA*
Ga0066787_1010886413300005950SoilATVLGMVFYGHRARIARGVQNGRWSSKLKAMFVGKGA*
Ga0070717_1005435213300006028Corn, Switchgrass And Miscanthus RhizosphereMPSTLSEPEFATVLGMVNYGQRSRIARGLQEDRWGSRLKALIVGKGA*
Ga0066696_1033740613300006032SoilEPEFATVLGMVVYGHRARSARGVQDARWSSKLKAMLVG*
Ga0066656_1107033713300006034SoilAEPEFSTVLGMVYYGHRARIARGLQDGGWSSRMKAMFAKKGA*
Ga0075026_10046293623300006057WatershedsTVLGMVFYGHRARIARGFQDERWSSRLKAMFVGKGA*
Ga0075015_10020462823300006102WatershedsWPAPLAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA*
Ga0075030_10088822213300006162WatershedsEFATVLGMAMYAHRARVARGLQGERWGNRLKALFVGKGA*
Ga0075030_10118240113300006162WatershedsPRTLAEPEYATVLGMAMYWHRARVARGMQDDRWSSKFKAWFARKGA*
Ga0070712_10066794323300006175Corn, Switchgrass And Miscanthus RhizosphereAVLAEPEYATVIGMIFYGHRARMARGMHGDGWSSKLKAMLVGKGA*
Ga0070712_10145836013300006175Corn, Switchgrass And Miscanthus RhizosphereLGMIYYGHRARVARGVQDDRWSSRLKAMFVKKGA*
Ga0066665_1164597523300006796SoilATVLGMVVYGHRARSARGVQDERWSSKLKAMLVGKGA*
Ga0079221_1116070823300006804Agricultural SoilATVLGMVMYGHRARSARGVQDERWSSKLKAMLVGKGA*
Ga0073928_1002999913300006893Iron-Sulfur Acid SpringTVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA*
Ga0099794_1029771423300007265Vadose Zone SoilEFSTVLGMVYYGYRARIARGLQDGGWSSRMKAMFAKKGA*
Ga0099828_1015695223300009089Vadose Zone SoilRPVRLSWPTPLAKMPAALAEPEYATVLGMVNYGQRARIARGFQGDRWGSRLKAMLVGKGA
Ga0105245_1069617713300009098Miscanthus RhizosphereTVLGMVFYGHRARIARGIQNDGWGSKLKAMFVGRGA*
Ga0066709_10402483213300009137Grasslands SoilMVLGMVFYGHRARIARGVQDGGWSSKLKAMFVGKGA*
Ga0099792_1003245033300009143Vadose Zone SoilEPEFATALGMVYYGHRARIARGMQNNGWSSRMKAMFAMKGA*
Ga0116128_117277313300009518PeatlandTVLGMAYYGHRARLARGLQEPGFGSRMRALFARKGA*
Ga0116218_141765313300009522Peatlands SoilLAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA*
Ga0116218_147825523300009522Peatlands SoilLAEPEYATLLGMAFYGHRARIARGQQEDRWGSKLKAMFVGKGA*
Ga0116221_122326113300009523Peatlands SoilEFATVLGMVNYGQRARTARGLQEDRWGSRLKALLVGKGA*
Ga0116221_134737913300009523Peatlands SoilATVLGMAYYGHRARLARGLQEPSFGSRMKALFASKGA*
Ga0116220_1021585713300009525Peatlands SoilEFATLLGMVNYGQRARIARGIQEDRWGTRLKAMLLGKGA*
Ga0116118_127324623300009637PeatlandATVLGMAYYGHRARLARGLQEPSFGSRMKAMFARKGA*
Ga0116224_1034724713300009683Peatlands SoilSVLRRPVRLSWPTPLAKMPAVLAEPEYATVLGMVFYGHRSRIARGLQDTRWSTRLIGLFAKKGA*
Ga0116216_1012666523300009698Peatlands SoilLAEPEFATVLGMAFYGHRARIARGMQEERWGSKLKAMFVGKGA*
Ga0116134_126026423300009764PeatlandLGMAYYGHRARLARGLQEPGFGSRMKALFARKGA*
Ga0116223_1076162523300009839Peatlands SoilEPEFATVLGMAYYGHRARLARGLQEPSFGSRMKALFASKGA*
Ga0126373_1090850713300010048Tropical Forest SoilPEYATALGIVYYAHRARIARGIQDERWSSKLKSLFALKGA*
Ga0099796_1021024723300010159Vadose Zone SoilFATALGMVYYGHRARIARGMQNNGWSSRMKAMFAKKGA*
Ga0074044_1101117823300010343Bog Forest SoilVLGMAYYGHRARLARGLQEPSFGSGMKALFAGKGA*
Ga0126372_1097735213300010360Tropical Forest SoilTVLGMVNYGQRARIARGFQEGGLGSRLKAMLVGKGA*
Ga0126378_1313445913300010361Tropical Forest SoilALGMIYYGHRARVARGIQDDRWSSRLKAMFVRKGA*
Ga0105239_1116797523300010375Corn RhizosphereLAEPEFATVLGMVFYGHRARVARGLQDERWSSRLKAMLVGKGA*
Ga0126381_10443243913300010376Tropical Forest SoilLGMVNYGHRARIARGFQEGGLGSRLKAMLVGKGA*
Ga0134126_1179061023300010396Terrestrial SoilSALAEPEFATVIGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA*
Ga0134127_1235699523300010399Terrestrial SoilPFPKMPAVLAEPEYATLLGMVFYTHRARIARGLQDERWSSRLKALFALKGA*
Ga0134122_1178804423300010400Terrestrial SoilLGMVFYGHRARIARGLQDERWSSRLKAMLIGKGA*
Ga0134121_1147226923300010401Terrestrial SoilVLGMLNYGQRARIARGLQEDRWGSRLKALLVGKGA*
Ga0126350_1027762213300010880Boreal Forest SoilLAEPEFATVLGMVNYGQRAQAARGFQADRWGSRLKALLVG*
Ga0150983_1288289123300011120Forest SoilAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALWVGKGA*
Ga0150983_1349658413300011120Forest SoilEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA*
Ga0150983_1672696223300011120Forest SoilVLGMVNYGQRARIARGLQEDHWGSRLKALLVGKGA*
Ga0137391_1039546113300011270Vadose Zone SoilPEFATVLGMAYYGHRARLARGLQEPGFGSRMKALFAGKGA*
Ga0137391_1148344013300011270Vadose Zone SoilATVLGMVSYGHRARTARGMQDDGWSSRLKSLFANRGA*
Ga0137389_1099819013300012096Vadose Zone SoilFATVLGMVFYGHRARIARGIQNGRWSSKLKAMFVGKGA*
Ga0137363_1080730613300012202Vadose Zone SoilSTLAEPEYATVLGMVFYGHRARLARGIHSEPWSSRLKAMFVGKGA*
Ga0137387_1076606623300012349Vadose Zone SoilSLAEPEFATVLGMIVYGHRARTARGGQDERWSSKLKAMLVG*
Ga0137367_1051652623300012353Vadose Zone SoilVLGMVFYGHRARIARGMQDQRWSSKLKAMIVGKGA*
Ga0137385_1074014923300012359Vadose Zone SoilTVLGMVVYGHRARSARGVQDERWSSKLKAMLVGKGA*
Ga0137390_1127846723300012363Vadose Zone SoilFDVAESVLRRPVRLSWPTPLAKMPASLAEPEYATVLGMVNYGQRARVARGYQQDRWGSKLKALLVGKGA*
Ga0150984_10682235413300012469Avena Fatua RhizospherePEFATVLGMVMYGHRARTARGMLDERWSSKLKSMLVGKGA*
Ga0137396_1115670523300012918Vadose Zone SoilEPECATALGMVYYGHRARVARGMQDDRWSSRLKGFFAKKGA*
Ga0137419_1029539133300012925Vadose Zone SoilLGEPEFATVLGMVYYGHRARIARGMQNNGWSSRMKAMFAMKGA*
Ga0164308_1149776523300012985SoilATVLGMVFYGHRARIARGIQNERWSSKLKAMFVGKGA*
Ga0164304_1086342113300012986SoilPEFATVLGMVAYCHRARSARGIQDDRWSSRLKAMLVGKGA*
Ga0157370_1123160223300013104Corn RhizosphereVLAEPEYATLLGMVFYTHRARIARGLQDERWSSRLKALFALKGA*
Ga0157374_1158126323300013296Miscanthus RhizosphereARMPSTLSEPEFATVLGMLNYGQRARIARGLQEDRWGSRLKALLVGKGA*
Ga0157374_1218159223300013296Miscanthus RhizosphereIGMIFYAHRARVARGIQNDRWSSRLKAMLVGKGA*
Ga0157372_1089126923300013307Corn RhizosphereSALAEPEFATVLGMVAYSHRARTARGIQDERWSSRLKAMLVRKGA*
Ga0157372_1302923113300013307Corn RhizosphereEPEFATVLGMVAYSHRARSARGIQDERWSSRLKAMLVGKGA*
Ga0157375_1065953913300013308Miscanthus RhizosphereTLAEPEFATVLGMVFYGHRARIARGIQNERWSSKLKAMFVGKGA*
Ga0181537_1008364743300014201BogFSTVLGMVYYGHRARVARGLQEPGFGSRMKALFARKGA*
Ga0163163_1032256623300014325Switchgrass RhizosphereTELAEPEFATTLGMVYYGHRARVARGIQDGRWSSRLKSFFAKKGA*
Ga0182010_1048044813300014490FenTVLGMAYYGHRACLARGLQAPSFSTRMKALFLRKGA*
Ga0182015_1078053323300014495PalsaATLAEPEYATVLGMVAYGQRARVARGFQGDRWGSRLKAMLVG*
Ga0182027_1066879223300014839FenFMAEPEFATVLGMVYYGHRARLAPGLQEPSFSSRMKAMFARKGA*
Ga0132256_10382817013300015372Arabidopsis RhizosphereLAEPEFATVIGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA*
Ga0182036_1062726623300016270SoilAELAEPEFATALGMVYYGHRARVARGLQDSRWSSRLKTLFAKKGA
Ga0181511_106034023300016702PeatlandEFATVLGMAYYGHRARLARGLQEPSFGSRMKAMFARKGA
Ga0187802_1015024713300017822Freshwater SedimentTVLGMAFYGHRARLARGMQEERWGSKLKAMFVGKGA
Ga0187818_1051963923300017823Freshwater SedimentEFATVLGMAFYGHRARLARGMQEERWGSKLKAMFVGKGA
Ga0187825_1018244023300017930Freshwater SedimentEPEYATVLGMVFYGHRARLARGIQSDRWSSKLKAMFVGKGA
Ga0187821_1016778823300017936Freshwater SedimentEFATVLGMVNYGQRARIARGLQEGGLGSKLKAMFVGTGA
Ga0187821_1050475513300017936Freshwater SedimentPLPKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0187819_1041757013300017943Freshwater SedimentTVLGMAYYGHRARLARGLQQPSFGSRMKAMFAGKGA
Ga0187819_1053482113300017943Freshwater SedimentMAEPEFATVLGMAYYSHRARLARGLQEPSFGSRMKALFAGKGA
Ga0187778_1093435013300017961Tropical PeatlandLSEPEFATVLGMVNYGHRARIARGFQEDRWGTKLKALLVGKGA
Ga0187776_1150081623300017966Tropical PeatlandLAEPEYATALGMVFYGHRARIARGIQDERWSSRLKAMFVGKGA
Ga0187782_1007705133300017975Tropical PeatlandEFATVLGMVNYGQRARIARGLQQDRWGSRLKALLVGA
Ga0187860_112916523300018014PeatlandATVLGMAYYGHRARLARGLQEPGFGSRMRALFARKGT
Ga0187863_1001942413300018034PeatlandRLSWPAPLARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA
Ga0187863_1047434613300018034PeatlandWPMPLAKMPANLAEPEYATVLGMLNYGQRARLARGFQGERWGSRLKAMLVG
Ga0187875_1074826313300018035PeatlandLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA
Ga0187887_1082368613300018043PeatlandTTLGMVYYGHRARLARGLQEPGFGSRMKALFAKKGA
Ga0187851_1083495113300018046PeatlandTVLGMVYYGHRARLARGLQEPGFGTRMKALFARKGA
Ga0187859_1030106823300018047PeatlandEFATVLGMAYYGHRARLARGLQEPGFGSRMKALFARKGA
Ga0187784_1086065723300018062Tropical PeatlandATVLGMVNYGQRARIARGLQQDRWGSRLKALLVGA
Ga0066655_1068827013300018431Grasslands SoilPSTLSEPEFATVLGMVNYGQRARVARGLQESGLGSRLKAMLVGKGA
Ga0066662_1159212023300018468Grasslands SoilVGKRAASLADPEFATVLGMIAYGHRARSARGVQDDRWSSRLKAMLVGKGA
Ga0193727_106878913300019886SoilPRVLAEPEFATVLGMALYSHRVRVARGMQDGRWSSRLKAFFGRKGA
Ga0187768_102909823300020150Tropical PeatlandEPEFATVLGMVNYGQRARVARGLQGERWGSKLKAMLVG
Ga0179592_1015578013300020199Vadose Zone SoilLAEPEFATVLGMALYSHRVRVARGMQDGRWSSRLKSFFGRKGA
Ga0210407_1049411623300020579SoilAPLARMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA
Ga0210399_1060512813300020581SoilTLSEPEFATVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA
Ga0210404_1082343923300021088SoilPEFATVLGMVFYGHRARIARGIQNGRWSSKLKAMFVGKGA
Ga0210406_1019871823300021168SoilTVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0210400_1053399913300021170SoilFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0210400_1073985413300021170SoilLARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA
Ga0210405_1035684023300021171SoilATVLGMIFYGHRARLARGIQDERWSARLKAMFVGKGA
Ga0210408_1115087423300021178SoilAKMPSTLSEPEYATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA
Ga0210388_1181054223300021181SoilMPATLAEPEFATVLGMVHYAQRARVARGFQGDRWGSRLKAMLVG
Ga0213875_1049956613300021388Plant RootsPSALAEPEFSTVLGMAVYGHRARTARGIDQDRWSSRLKAMLVGKGA
Ga0210385_1053525913300021402SoilWPAPLARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA
Ga0210385_1113367823300021402SoilSWPAPLAKMPSTLSEPEFATVLGMVNYGQRARIARGIQSDRWGTRLKSLLVGKGA
Ga0210384_1120674323300021432SoilATLSEPEFATVLGMVNYGQRARAARGIQGDRWGSKLKAMLVG
Ga0210391_1029356323300021433SoilTVLGMVNYGQRARVARGLQEDRWGTRLRALLVGKGA
Ga0210398_1026926823300021477SoilSVRLSWPAPLARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA
Ga0210410_1028964213300021479SoilPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA
Ga0210410_1083533623300021479SoilTLSEPEFATVIGMANYGHRARIARGQQEDRWGTRLKALLVGKGA
Ga0126371_1109663713300021560Tropical Forest SoilEPEFATVLGMVVYGHRARTARGVQDERWSAKLKAMLVGKGA
Ga0213852_148323923300021858WatershedsAEPEFATVLGMAMYAHRARVARGLQGERWGNRLKALFVGKGA
Ga0242662_1022649213300022533SoilFATVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA
Ga0212123_1089777213300022557Iron-Sulfur Acid SpringAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0242665_1021682413300022724SoilEPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA
Ga0247668_111103913300024331SoilFDVAESVLRRSVRLSWPAPLAKMPSTLSEPEYATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0207416_119099023300025134Iron-Sulfur Acid SpringEYATLIGMVNYGQRARVARGFQGDRWGSRLKAMLVG
Ga0208190_100211413300025473PeatlandPEFATVLGMAYYGHRARLARGLQEPSFGSRMKALFAGKGA
Ga0208686_110974213300025500PeatlandPLAKMPVTLAEPEYATLLGMVNYGQRARVARGFQGDRWGSRLKAMLVG
Ga0207699_1003917813300025906Corn, Switchgrass And Miscanthus RhizospherePEYATVLGLVYYGHRARVARGYQDDRWSSKIKAMFAKKGA
Ga0207695_1080258713300025913Corn RhizosphereFATLLGLVYYGQRARMARGYQDYGWSSRLKALFAKKGA
Ga0207693_1097924023300025915Corn, Switchgrass And Miscanthus RhizosphereFATLLGMVAYSHRARSARGIQDERWSSRLKAMLVGKGA
Ga0207663_1084012413300025916Corn, Switchgrass And Miscanthus RhizosphereTALGTIFYGHRARIARGLQEDGWSSRLKSLFALKGA
Ga0207649_1001496513300025920Corn RhizosphereFATVLGMVFYGHRARIARGIQNERWSSKLKAMFVGKGA
Ga0207681_1165551713300025923Switchgrass RhizosphereVLGMVFYGHRARVARGLQDERWSSRLKAMLVGKGA
Ga0207650_1016059933300025925Switchgrass RhizosphereEPEFSTLLGLVYYGQRARMARGYQDDGWSSRLKALFAKKGA
Ga0207700_1103373213300025928Corn, Switchgrass And Miscanthus RhizosphereSSLAEPEFATVLGMVAYGHRARSARGIQDDRWSSRLKAMLVGKGA
Ga0207644_1080452223300025931Switchgrass RhizosphereEYATVLGMVFYGHRARIARGIQNDGWGSKLKAMFVGRGA
Ga0207690_1011214533300025932Corn RhizosphereLLGLVYYGQRARMARGYQDYGWSSRLKALFAKKGA
Ga0207665_1042401513300025939Corn, Switchgrass And Miscanthus RhizosphereFASVLGMVNYGHRARIARGYQEGGLGSRLKAMLVGKGA
Ga0207702_1019808713300026078Corn RhizosphereATVLGMINYGHRARLARGYQEGGLGSRLKAMLVGKGA
Ga0209688_111025113300026305SoilPEFATVLGMVNYGHRARIARGYQEGGLGSRLKAMLVGKGA
Ga0209686_107016623300026315SoilEPEFATVLGMVSYGHRARTARGMQDDGWSGRLKALFADKGA
Ga0209647_110488013300026319Grasslands SoilMPSSLGEPEFATVLGMVAYAHRARSARGVHDERWSSRLKAMLVG
Ga0209375_111879413300026329SoilEPEFATVLGMVHYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0209473_116853523300026330SoilEPEFATVLGMVVYGHRARSARGVQDARWSSKLKAMLVG
Ga0209377_100554313300026334SoilEYATVIGMIFYGHRARMARGMHGDGWSSKLKALLVGKGA
Ga0257164_104005813300026497SoilLAEPEYATVLGMVFYGHRARIARGIQDERWSSRLKAMFVGKGA
Ga0209474_1016271613300026550SoilLAEPEFATVLGMVVYGHRARSARGVQDARWSSKLKAMLVG
Ga0179587_1019104423300026557Vadose Zone SoilLSEPEFATVLGMVNYAQRARTARGLQEDRWGTRLKALLVGKGA
Ga0208859_101187013300027069Forest SoilFAAALGMIYYGHRARVARGMQDDRWSSRLKAMFVRKGA
Ga0209215_102971723300027266Forest SoilVLGMVNYGQRARIARGFQEDRWGTRLKALLVGKGA
Ga0209004_106190413300027376Forest SoilSEPEFATVLGMVNYGQRARVARGFQEDRWGTRLKALLVGKGA
Ga0209525_111139413300027575Forest SoilFATVIGMVNYGQRARVARGFQGDRWGSRLKAMLVG
Ga0209422_110241213300027629Forest SoilEFATVIGMVNYGQRARVARGFQGDRWASRLKAMLVG
Ga0208827_117973423300027641Peatlands SoilATVLGMAYYGHRARLARGLQEPSFGSRMKALFASKGA
Ga0209076_107166323300027643Vadose Zone SoilTALGMIYYGHRARVARGIQDGRWSSRLKNLFATRKGA
Ga0209333_117919023300027676Forest SoilEPEFATALGMVAYGQRARVARGFQGDRWGSKLKAMLAG
Ga0209447_1015820313300027701Bog Forest SoilLSWPAPLAKMPSTLSEPEFATVLGMVNYFQRARIARGLQEDRWGTRLKALLVGKGA
Ga0209178_134572913300027725Agricultural SoilATVLGMVMYGHRARSARGVQDERWSSKLKAMLVGKGA
Ga0209772_1026842613300027768Bog Forest SoilAEPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA
Ga0209448_1000050513300027783Bog Forest SoilFATVLGMAYYGHRARLARGLQEPGFGSRMKALFARKGA
Ga0209139_1009969713300027795Bog Forest SoilTVLGMAYYGHRARLARGLQEPGFGSRMKALFAGKGA
Ga0209274_1012096013300027853SoilMPSTLSEPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA
Ga0209579_1001838143300027869Surface SoilAKMPSTLAEPEYATVLGMVNYGQRARVARGFQGDRWGSRLKAMLVG
Ga0209283_1068596013300027875Vadose Zone SoilTLAEPEYATVLGMVFYGHRARMARGIQDGRWSSRLKAMFAGKGA
Ga0209590_1052785823300027882Vadose Zone SoilAEPEFATVLGMVSYGHRARTARGMQDDGWSSRLKSLFANRGA
Ga0209068_1030249413300027894WatershedsVLGMVYYGHRARVARGLQDSGWSGRMKALFAKKGA
Ga0209624_1058731223300027895Forest SoilEFATVLGMVNYGQRARVARGLQEDRWGTRLKAMLVGKGA
Ga0209698_1085416823300027911WatershedsSVLRRSVRLSWPAPLAKMPSTLSEPEYATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0209698_1088923523300027911WatershedsPRTLAEPEYATVLGMAMYWHRARVARGMQDDRWSSKFKAWFARKGA
Ga0265356_100075413300028017RhizosphereEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA
Ga0137415_1073987323300028536Vadose Zone SoilVLGMVNYGQRARIARGYQGDRWGSRLKAMLVGKGA
Ga0302231_1017046413300028775PalsaATLAEPEYATVLGMVAYGQRARVARGFQGDRWGSRLKALLVG
Ga0302290_1002856423300028777FenEPEFATVLGMVYYGHRARVARGLQDSGWSGRMKALFAKKGA
Ga0307504_1003843713300028792SoilTAIGMVYYGHRARVARGIQDDRWSSRLKGMFAKKGA
Ga0265338_1044246323300028800RhizospherePSTLSEPEFATVLGMVNYGQRARTARGLQESGFGSRLKAMLVGKGA
Ga0311340_1058188723300029943PalsaTVLGMLYYGHRARLARGLQERGFGSRMKALFAGKGA
Ga0311348_1116085313300030019FenEFATVLGMVYYGHRARVARGLQDSGWSGRMKALFAKKGA
Ga0302181_1019629923300030056PalsaATVLGMAYYGHRARLARGLQEPGFGSRMKALFARKGA
Ga0302179_1026653523300030058PalsaARMPSTLSEPEFATVLGMVNYGQRARVARGLQQDRWGTRLKELLVGKGA
Ga0265762_108917313300030760SoilYATVLGMVHYGQRARVARGFQGDRWGSRLKAMLVG
Ga0170823_1441319323300031128Forest SoilWPAPLARMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0170823_1766229723300031128Forest SoilFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGTGA
Ga0302324_10047825413300031236PalsaFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA
Ga0265339_1018661413300031249RhizosphereWPAPLAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0307476_1042463313300031715Hardwood Forest SoilTVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA
Ga0307474_1001727243300031718Hardwood Forest SoilPEYATALGMVYYGHRARVARGLQDGRWSSRLRAMFAKKGA
Ga0307474_1094675623300031718Hardwood Forest SoilATVLGMVNYGQRARIARGLQEDGWGHRLKAMLVGKGA
Ga0307469_1135573523300031720Hardwood Forest SoilPEFATVLGMVMYGHRARSARGVQDERWSSKLKAMLVGKGA
Ga0307469_1178895913300031720Hardwood Forest SoilPEFATVLGMVYYGHRARLARGLQEPSFGSRMKALFAGKGA
Ga0307477_1018298323300031753Hardwood Forest SoilSVRLSWPAPLPKMPSTLSEPEFATALGMINYGQRARIARGLQEDRWGSRLKALLVGKGA
Ga0307473_1149362713300031820Hardwood Forest SoilEPEFSTVLGMVYYGHRARIARGLQDGGWSSRMKAMFAKKGA
Ga0307478_1164351513300031823Hardwood Forest SoilPLARMPSTLSEPEFATVLGMVNYGQRARIARGLQEDGWGHRLKAMLVGKGA
Ga0306921_1067399413300031912SoilEPEFATALGMVYYGHRARVARGIQDPRWSSRLKALFAKKGA
Ga0311301_1017204613300032160Peatlands SoilTLAEPEYATLLGMVAYGQRARVARGFQGDRWGSRLKAMLVG
Ga0307471_10076948613300032180Hardwood Forest SoilSEPEFATVLGMANYGHRARIARGQQEDRWGTRLKALLIGKGA
Ga0348332_1010319013300032515Plant LitterATVLGMVNYGQRARTARGLQEDRWGSRLKALLVGKGA
Ga0335082_1030154913300032782SoilPEFATVLGMVFYGHRARIARGIQDDRWSARLKSMFVGKGA
Ga0335074_1050480813300032895SoilPEFATVLGMIAYGQRARVARGIQGDRWGAKLKALLVG
Ga0335084_1222910023300033004SoilTVLGMAMYGHRARIARGIQDARWSSRLKSLFVGKGA
Ga0314865_054447_1_1443300033806PeatlandMPVVLAEPEYATALGMVFYAHRARVARGIQDERWSSRLKALFAKKGA
Ga0314866_021022_3_1223300033807PeatlandEPEYATVLGMVNYGQRARVARGLQESGLGSRLKAMLMGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.