Basic Information | |
---|---|
Family ID | F020052 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 226 |
Average Sequence Length | 42 residues |
Representative Sequence | EFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Number of Associated Samples | 204 |
Number of Associated Scaffolds | 226 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 94.69 % |
% of genes from short scaffolds (< 2000 bps) | 85.40 % |
Associated GOLD sequencing projects | 188 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.469 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.850 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.912 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.885 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 226 Family Scaffolds |
---|---|---|
PF00091 | Tubulin | 65.93 |
PF12327 | FtsZ_C | 22.57 |
PF00905 | Transpeptidase | 1.33 |
PF08238 | Sel1 | 0.88 |
PF09537 | DUF2383 | 0.44 |
PF13231 | PMT_2 | 0.44 |
PF05960 | DUF885 | 0.44 |
PF09720 | Unstab_antitox | 0.44 |
PF08447 | PAS_3 | 0.44 |
PF14534 | DUF4440 | 0.44 |
PF16576 | HlyD_D23 | 0.44 |
PF00005 | ABC_tran | 0.44 |
PF15631 | Imm-NTF2-2 | 0.44 |
COG ID | Name | Functional Category | % Frequency in 226 Family Scaffolds |
---|---|---|---|
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.47 % |
Unclassified | root | N/A | 30.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2065487018|GPINP_F5MS3JC02FX8Q4 | Not Available | 515 | Open in IMG/M |
3300000955|JGI1027J12803_104215120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 511 | Open in IMG/M |
3300000955|JGI1027J12803_104456103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300001174|JGI12679J13547_1015344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
3300001546|JGI12659J15293_10073178 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300001990|JGI24737J22298_10151786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 684 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100265658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10047487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1621 | Open in IMG/M |
3300004635|Ga0062388_102496594 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005093|Ga0062594_103154193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
3300005171|Ga0066677_10003890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5862 | Open in IMG/M |
3300005186|Ga0066676_10378072 | Not Available | 952 | Open in IMG/M |
3300005332|Ga0066388_102403695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 956 | Open in IMG/M |
3300005333|Ga0070677_10012816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2917 | Open in IMG/M |
3300005343|Ga0070687_101479220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 510 | Open in IMG/M |
3300005363|Ga0008090_15673287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1498 | Open in IMG/M |
3300005435|Ga0070714_101698443 | Not Available | 617 | Open in IMG/M |
3300005436|Ga0070713_102434350 | Not Available | 506 | Open in IMG/M |
3300005437|Ga0070710_11519107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
3300005468|Ga0070707_101046948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 782 | Open in IMG/M |
3300005541|Ga0070733_10976556 | Not Available | 569 | Open in IMG/M |
3300005542|Ga0070732_10731070 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005569|Ga0066705_10333854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 958 | Open in IMG/M |
3300005575|Ga0066702_10975509 | Not Available | 507 | Open in IMG/M |
3300005591|Ga0070761_10015117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4297 | Open in IMG/M |
3300005602|Ga0070762_10048079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2344 | Open in IMG/M |
3300005602|Ga0070762_10983144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
3300005843|Ga0068860_100132256 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
3300005950|Ga0066787_10108864 | Not Available | 597 | Open in IMG/M |
3300006028|Ga0070717_10054352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3302 | Open in IMG/M |
3300006032|Ga0066696_10337406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 982 | Open in IMG/M |
3300006034|Ga0066656_11070337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
3300006057|Ga0075026_100462936 | Not Available | 724 | Open in IMG/M |
3300006102|Ga0075015_100204628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1052 | Open in IMG/M |
3300006162|Ga0075030_100888222 | Not Available | 703 | Open in IMG/M |
3300006162|Ga0075030_101182401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
3300006175|Ga0070712_100667943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 884 | Open in IMG/M |
3300006175|Ga0070712_101458360 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300006796|Ga0066665_11645975 | Not Available | 507 | Open in IMG/M |
3300006804|Ga0079221_11160708 | Not Available | 596 | Open in IMG/M |
3300006893|Ga0073928_10029999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 5257 | Open in IMG/M |
3300007265|Ga0099794_10297714 | Not Available | 835 | Open in IMG/M |
3300009098|Ga0105245_10696177 | Not Available | 1049 | Open in IMG/M |
3300009137|Ga0066709_104024832 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300009143|Ga0099792_10032450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2429 | Open in IMG/M |
3300009518|Ga0116128_1172773 | Not Available | 613 | Open in IMG/M |
3300009522|Ga0116218_1417653 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300009522|Ga0116218_1478255 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300009523|Ga0116221_1223261 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300009523|Ga0116221_1347379 | Not Available | 643 | Open in IMG/M |
3300009525|Ga0116220_10215857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300009637|Ga0116118_1273246 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009698|Ga0116216_10126665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
3300009764|Ga0116134_1260264 | Not Available | 598 | Open in IMG/M |
3300009839|Ga0116223_10761625 | Not Available | 554 | Open in IMG/M |
3300010048|Ga0126373_10908507 | Not Available | 945 | Open in IMG/M |
3300010159|Ga0099796_10210247 | Not Available | 793 | Open in IMG/M |
3300010343|Ga0074044_11011178 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010360|Ga0126372_10977352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300010361|Ga0126378_13134459 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300010375|Ga0105239_11167975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300010376|Ga0126381_104432439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300010396|Ga0134126_11790610 | Not Available | 673 | Open in IMG/M |
3300010400|Ga0134122_11788044 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300010401|Ga0134121_11472269 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300010880|Ga0126350_10277622 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300011120|Ga0150983_12882891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
3300011120|Ga0150983_13496584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
3300011120|Ga0150983_16726962 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300011270|Ga0137391_10395461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
3300011270|Ga0137391_11483440 | Not Available | 523 | Open in IMG/M |
3300012096|Ga0137389_10998190 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012202|Ga0137363_10807306 | Not Available | 796 | Open in IMG/M |
3300012349|Ga0137387_10766066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300012353|Ga0137367_10516526 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300012359|Ga0137385_10740149 | Not Available | 819 | Open in IMG/M |
3300012469|Ga0150984_106822354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3141 | Open in IMG/M |
3300012918|Ga0137396_11156705 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012925|Ga0137419_10295391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1237 | Open in IMG/M |
3300012985|Ga0164308_11497765 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012986|Ga0164304_10863421 | Not Available | 704 | Open in IMG/M |
3300013104|Ga0157370_11231602 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300013296|Ga0157374_11581263 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300013296|Ga0157374_12181592 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300013307|Ga0157372_10891269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1032 | Open in IMG/M |
3300013307|Ga0157372_13029231 | Not Available | 537 | Open in IMG/M |
3300013308|Ga0157375_10659539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
3300014201|Ga0181537_10083647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2165 | Open in IMG/M |
3300014325|Ga0163163_10322566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1598 | Open in IMG/M |
3300014490|Ga0182010_10480448 | Not Available | 685 | Open in IMG/M |
3300014495|Ga0182015_10780533 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300014839|Ga0182027_10668792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
3300015372|Ga0132256_103828170 | Not Available | 506 | Open in IMG/M |
3300016270|Ga0182036_10627266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
3300016702|Ga0181511_1060340 | Not Available | 572 | Open in IMG/M |
3300017822|Ga0187802_10150247 | Not Available | 889 | Open in IMG/M |
3300017823|Ga0187818_10519639 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300017930|Ga0187825_10182440 | Not Available | 750 | Open in IMG/M |
3300017936|Ga0187821_10167788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300017936|Ga0187821_10504755 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300017943|Ga0187819_10417570 | Not Available | 770 | Open in IMG/M |
3300017943|Ga0187819_10534821 | Not Available | 667 | Open in IMG/M |
3300017961|Ga0187778_10934350 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300017966|Ga0187776_11500816 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300017975|Ga0187782_10077051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2439 | Open in IMG/M |
3300018014|Ga0187860_1129165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
3300018034|Ga0187863_10019424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4172 | Open in IMG/M |
3300018034|Ga0187863_10474346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 700 | Open in IMG/M |
3300018035|Ga0187875_10748263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300018043|Ga0187887_10823686 | Not Available | 549 | Open in IMG/M |
3300018046|Ga0187851_10834951 | Not Available | 518 | Open in IMG/M |
3300018047|Ga0187859_10301068 | Not Available | 868 | Open in IMG/M |
3300018062|Ga0187784_10860657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300018431|Ga0066655_10688270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300018468|Ga0066662_11592120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300019886|Ga0193727_1068789 | Not Available | 1099 | Open in IMG/M |
3300020150|Ga0187768_1029098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
3300020199|Ga0179592_10155780 | Not Available | 1044 | Open in IMG/M |
3300020579|Ga0210407_10494116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
3300020581|Ga0210399_10605128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
3300021088|Ga0210404_10823439 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300021168|Ga0210406_10198718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
3300021170|Ga0210400_10533999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
3300021170|Ga0210400_10739854 | Not Available | 808 | Open in IMG/M |
3300021171|Ga0210405_10356840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
3300021178|Ga0210408_11150874 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300021181|Ga0210388_11810542 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300021388|Ga0213875_10499566 | Not Available | 584 | Open in IMG/M |
3300021402|Ga0210385_10535259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
3300021402|Ga0210385_11133678 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300021432|Ga0210384_11206743 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300021433|Ga0210391_10293563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
3300021479|Ga0210410_10289642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1469 | Open in IMG/M |
3300021479|Ga0210410_10835336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300021560|Ga0126371_11096637 | Not Available | 935 | Open in IMG/M |
3300021858|Ga0213852_1483239 | Not Available | 1160 | Open in IMG/M |
3300022533|Ga0242662_10226492 | Not Available | 598 | Open in IMG/M |
3300022557|Ga0212123_10897772 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300022724|Ga0242665_10216824 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300025134|Ga0207416_1190990 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300025473|Ga0208190_1002114 | All Organisms → cellular organisms → Bacteria | 6366 | Open in IMG/M |
3300025500|Ga0208686_1109742 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300025906|Ga0207699_10039178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2721 | Open in IMG/M |
3300025913|Ga0207695_10802587 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300025915|Ga0207693_10979240 | Not Available | 646 | Open in IMG/M |
3300025916|Ga0207663_10840124 | Not Available | 733 | Open in IMG/M |
3300025920|Ga0207649_10014965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4355 | Open in IMG/M |
3300025923|Ga0207681_11655517 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300025925|Ga0207650_10160599 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300025928|Ga0207700_11033732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300025931|Ga0207644_10804522 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300025932|Ga0207690_10112145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1966 | Open in IMG/M |
3300025939|Ga0207665_10424015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1017 | Open in IMG/M |
3300026078|Ga0207702_10198087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1860 | Open in IMG/M |
3300026305|Ga0209688_1110251 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300026315|Ga0209686_1070166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
3300026319|Ga0209647_1104880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
3300026329|Ga0209375_1118794 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300026330|Ga0209473_1168535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 868 | Open in IMG/M |
3300026334|Ga0209377_1005543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7774 | Open in IMG/M |
3300026497|Ga0257164_1040058 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300026550|Ga0209474_10162716 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300026557|Ga0179587_10191044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
3300027069|Ga0208859_1011870 | Not Available | 961 | Open in IMG/M |
3300027266|Ga0209215_1029717 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300027376|Ga0209004_1061904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300027575|Ga0209525_1111394 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300027629|Ga0209422_1102412 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300027641|Ga0208827_1179734 | Not Available | 572 | Open in IMG/M |
3300027643|Ga0209076_1071663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300027676|Ga0209333_1179190 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300027701|Ga0209447_10158203 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300027725|Ga0209178_1345729 | Not Available | 555 | Open in IMG/M |
3300027768|Ga0209772_10268426 | Not Available | 541 | Open in IMG/M |
3300027783|Ga0209448_10000505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12997 | Open in IMG/M |
3300027795|Ga0209139_10099697 | Not Available | 1022 | Open in IMG/M |
3300027853|Ga0209274_10120960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
3300027869|Ga0209579_10018381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3995 | Open in IMG/M |
3300027875|Ga0209283_10685960 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300027882|Ga0209590_10527858 | Not Available | 762 | Open in IMG/M |
3300027894|Ga0209068_10302494 | Not Available | 898 | Open in IMG/M |
3300027895|Ga0209624_10587312 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300027911|Ga0209698_10889235 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300028017|Ga0265356_1000754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5497 | Open in IMG/M |
3300028536|Ga0137415_10739873 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300028775|Ga0302231_10170464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300028777|Ga0302290_10028564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
3300028792|Ga0307504_10038437 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300028800|Ga0265338_10442463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300029943|Ga0311340_10581887 | Not Available | 982 | Open in IMG/M |
3300030019|Ga0311348_11160853 | Not Available | 574 | Open in IMG/M |
3300030056|Ga0302181_10196299 | Not Available | 937 | Open in IMG/M |
3300030058|Ga0302179_10266535 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300030760|Ga0265762_1089173 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300031128|Ga0170823_14413193 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300031128|Ga0170823_17662297 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031236|Ga0302324_100478254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
3300031249|Ga0265339_10186614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
3300031715|Ga0307476_10424633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300031718|Ga0307474_10017272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5234 | Open in IMG/M |
3300031718|Ga0307474_10946756 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300031720|Ga0307469_11355735 | Not Available | 677 | Open in IMG/M |
3300031720|Ga0307469_11788959 | Not Available | 593 | Open in IMG/M |
3300031820|Ga0307473_11493627 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031823|Ga0307478_11643515 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300031912|Ga0306921_10673994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
3300032160|Ga0311301_10172046 | All Organisms → cellular organisms → Bacteria | 3821 | Open in IMG/M |
3300032180|Ga0307471_100769486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
3300032515|Ga0348332_10103190 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300032782|Ga0335082_10301549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1475 | Open in IMG/M |
3300032895|Ga0335074_10504808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1253 | Open in IMG/M |
3300033004|Ga0335084_12229100 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300033806|Ga0314865_054447 | Not Available | 1030 | Open in IMG/M |
3300033807|Ga0314866_021022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.08% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.87% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.98% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.10% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.10% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.21% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.21% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.21% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.21% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.33% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.33% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.44% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.44% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.44% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.44% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.44% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.44% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.44% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.44% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.89% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPINP_00432040 | 2065487018 | Soil | TVLGMVYYGHRARIARGLQDGGWSSRMKAMFAKKGA |
JGI1027J12803_1042151202 | 3300000955 | Soil | ELAEPEFATLLGLVYYGHRARVARGIQDDRWSSKIKAMFAKRGA* |
JGI1027J12803_1044561032 | 3300000955 | Soil | EFATVLGMVNYGHRARIARGFQEGGLGSRLKAMLVGKGA* |
JGI12679J13547_10153441 | 3300001174 | Forest Soil | KMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
JGI12659J15293_100731782 | 3300001546 | Forest Soil | LSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
JGI24737J22298_101517862 | 3300001990 | Corn Rhizosphere | PEFATVLGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA* |
JGIcombinedJ26739_1002656581 | 3300002245 | Forest Soil | SEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKSLLVGKGA* |
JGIcombinedJ51221_100474871 | 3300003505 | Forest Soil | LSEPEFATVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA* |
Ga0062389_1017195651 | 3300004092 | Bog Forest Soil | VLRRSVRLSWPAPLAKMPSTLSEPEHATVLGMVNYGQRARVARGIQEGGLGSRLKALLIGKGA* |
Ga0062388_1024965941 | 3300004635 | Bog Forest Soil | EPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA* |
Ga0062594_1031541931 | 3300005093 | Soil | ALAKMPSTLSEPEFATVLGMATYSHRSRTARGFQDGRWSSKLKAMLVGKGA* |
Ga0066672_103580692 | 3300005167 | Soil | RLSWPAPLAKMPASLAEPEYATVLGMVNYGQRARIARGYQDDRWGSKLKALLVGKGA* |
Ga0066677_100038901 | 3300005171 | Soil | EPEFATVLGMVSYGHRARTARGMQDDGWSGRLKALFADKGA* |
Ga0066676_103780722 | 3300005186 | Soil | PEFATVLGMVTYGHRARSARGVQDGRWSSRLKAMLVGKAASSY* |
Ga0066388_1024036952 | 3300005332 | Tropical Forest Soil | LAKMPSTLSEPEFATVLGMVNYGQRARIARGFQEGGLGSRLKAMLVGKGA* |
Ga0070677_100128164 | 3300005333 | Miscanthus Rhizosphere | AEPEFATLLGLVYYGQRARMARGYQDYGWSSRLKALFAKKGA* |
Ga0070687_1014792202 | 3300005343 | Switchgrass Rhizosphere | EPEYATLLGMVFYTHRARIARGLQDERWSSRLKALFALKGA* |
Ga0008090_156732872 | 3300005363 | Tropical Rainforest Soil | AMLAEPEYATALGIVYYAHRARIARGIQDERWSSKLKSLFALKGA* |
Ga0070714_1016984432 | 3300005435 | Agricultural Soil | EFATVLGMVMYGHRARTARGALDERWSSRLKSMLVGKGA* |
Ga0070713_1024343501 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEPEFATVLGMVAYGHRARSARGIQDDRWSSRLKAMLVGKGA* |
Ga0070710_115191072 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEPEFATVLGMVFYGHRARIARGIQNGRWSSKLKAMFVGKGA* |
Ga0066689_105448851 | 3300005447 | Soil | GIFDVAESVLRRPVRLSWPTPLAKMPASLAEPEYATVLGMVNYGQRARIARGYQEDRWGSKLKALLVGKGA* |
Ga0070707_1010469481 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPEFATVLGMVSYGHRARTARGMQDDGWSSRLKSLFANRGA* |
Ga0070733_109765562 | 3300005541 | Surface Soil | ATVLGMVMYGHRARSARGVQDERWSSRLKAMLVGKGA* |
Ga0070732_107310702 | 3300005542 | Surface Soil | FATVLGMVNYGQRARIARGYQEDRWGSKLKALLVGKGA* |
Ga0066705_103338541 | 3300005569 | Soil | ELAEPEFATALGMIYYGHRARVARGVQDDRWSSRLKAMFVKKGA* |
Ga0066702_109755091 | 3300005575 | Soil | TVLGMVMYGHRARTARGALDERWSSKLKSMLVGKGA* |
Ga0070761_100151171 | 3300005591 | Soil | LGMAYYGHRARLARGLQEPSFGSRMKALFAGKGA* |
Ga0070761_102993721 | 3300005591 | Soil | IFDVAESVLRRPVRLSWPTPLAKMPVSLAEPEYATVLGMVAYGQRARMARGFQGDRWGSRLKAMLVG* |
Ga0070762_100480793 | 3300005602 | Soil | ATLAEPEFATLLGMVNYGQRARVARGYQGDRWGSRLKAMLVG* |
Ga0070762_109831442 | 3300005602 | Soil | AKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
Ga0068860_1001322563 | 3300005843 | Switchgrass Rhizosphere | TVIGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA* |
Ga0066787_101088641 | 3300005950 | Soil | ATVLGMVFYGHRARIARGVQNGRWSSKLKAMFVGKGA* |
Ga0070717_100543521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTLSEPEFATVLGMVNYGQRSRIARGLQEDRWGSRLKALIVGKGA* |
Ga0066696_103374061 | 3300006032 | Soil | EPEFATVLGMVVYGHRARSARGVQDARWSSKLKAMLVG* |
Ga0066656_110703371 | 3300006034 | Soil | AEPEFSTVLGMVYYGHRARIARGLQDGGWSSRMKAMFAKKGA* |
Ga0075026_1004629362 | 3300006057 | Watersheds | TVLGMVFYGHRARIARGFQDERWSSRLKAMFVGKGA* |
Ga0075015_1002046282 | 3300006102 | Watersheds | WPAPLAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA* |
Ga0075030_1008882221 | 3300006162 | Watersheds | EFATVLGMAMYAHRARVARGLQGERWGNRLKALFVGKGA* |
Ga0075030_1011824011 | 3300006162 | Watersheds | PRTLAEPEYATVLGMAMYWHRARVARGMQDDRWSSKFKAWFARKGA* |
Ga0070712_1006679432 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLAEPEYATVIGMIFYGHRARMARGMHGDGWSSKLKAMLVGKGA* |
Ga0070712_1014583601 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LGMIYYGHRARVARGVQDDRWSSRLKAMFVKKGA* |
Ga0066665_116459752 | 3300006796 | Soil | ATVLGMVVYGHRARSARGVQDERWSSKLKAMLVGKGA* |
Ga0079221_111607082 | 3300006804 | Agricultural Soil | ATVLGMVMYGHRARSARGVQDERWSSKLKAMLVGKGA* |
Ga0073928_100299991 | 3300006893 | Iron-Sulfur Acid Spring | TVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
Ga0099794_102977142 | 3300007265 | Vadose Zone Soil | EFSTVLGMVYYGYRARIARGLQDGGWSSRMKAMFAKKGA* |
Ga0099828_101569522 | 3300009089 | Vadose Zone Soil | RPVRLSWPTPLAKMPAALAEPEYATVLGMVNYGQRARIARGFQGDRWGSRLKAMLVGKGA |
Ga0105245_106961771 | 3300009098 | Miscanthus Rhizosphere | TVLGMVFYGHRARIARGIQNDGWGSKLKAMFVGRGA* |
Ga0066709_1040248321 | 3300009137 | Grasslands Soil | MVLGMVFYGHRARIARGVQDGGWSSKLKAMFVGKGA* |
Ga0099792_100324503 | 3300009143 | Vadose Zone Soil | EPEFATALGMVYYGHRARIARGMQNNGWSSRMKAMFAMKGA* |
Ga0116128_11727731 | 3300009518 | Peatland | TVLGMAYYGHRARLARGLQEPGFGSRMRALFARKGA* |
Ga0116218_14176531 | 3300009522 | Peatlands Soil | LAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
Ga0116218_14782552 | 3300009522 | Peatlands Soil | LAEPEYATLLGMAFYGHRARIARGQQEDRWGSKLKAMFVGKGA* |
Ga0116221_12232611 | 3300009523 | Peatlands Soil | EFATVLGMVNYGQRARTARGLQEDRWGSRLKALLVGKGA* |
Ga0116221_13473791 | 3300009523 | Peatlands Soil | ATVLGMAYYGHRARLARGLQEPSFGSRMKALFASKGA* |
Ga0116220_102158571 | 3300009525 | Peatlands Soil | EFATLLGMVNYGQRARIARGIQEDRWGTRLKAMLLGKGA* |
Ga0116118_12732462 | 3300009637 | Peatland | ATVLGMAYYGHRARLARGLQEPSFGSRMKAMFARKGA* |
Ga0116224_103472471 | 3300009683 | Peatlands Soil | SVLRRPVRLSWPTPLAKMPAVLAEPEYATVLGMVFYGHRSRIARGLQDTRWSTRLIGLFAKKGA* |
Ga0116216_101266652 | 3300009698 | Peatlands Soil | LAEPEFATVLGMAFYGHRARIARGMQEERWGSKLKAMFVGKGA* |
Ga0116134_12602642 | 3300009764 | Peatland | LGMAYYGHRARLARGLQEPGFGSRMKALFARKGA* |
Ga0116223_107616252 | 3300009839 | Peatlands Soil | EPEFATVLGMAYYGHRARLARGLQEPSFGSRMKALFASKGA* |
Ga0126373_109085071 | 3300010048 | Tropical Forest Soil | PEYATALGIVYYAHRARIARGIQDERWSSKLKSLFALKGA* |
Ga0099796_102102472 | 3300010159 | Vadose Zone Soil | FATALGMVYYGHRARIARGMQNNGWSSRMKAMFAKKGA* |
Ga0074044_110111782 | 3300010343 | Bog Forest Soil | VLGMAYYGHRARLARGLQEPSFGSGMKALFAGKGA* |
Ga0126372_109773521 | 3300010360 | Tropical Forest Soil | TVLGMVNYGQRARIARGFQEGGLGSRLKAMLVGKGA* |
Ga0126378_131344591 | 3300010361 | Tropical Forest Soil | ALGMIYYGHRARVARGIQDDRWSSRLKAMFVRKGA* |
Ga0105239_111679752 | 3300010375 | Corn Rhizosphere | LAEPEFATVLGMVFYGHRARVARGLQDERWSSRLKAMLVGKGA* |
Ga0126381_1044324391 | 3300010376 | Tropical Forest Soil | LGMVNYGHRARIARGFQEGGLGSRLKAMLVGKGA* |
Ga0134126_117906102 | 3300010396 | Terrestrial Soil | SALAEPEFATVIGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA* |
Ga0134127_123569952 | 3300010399 | Terrestrial Soil | PFPKMPAVLAEPEYATLLGMVFYTHRARIARGLQDERWSSRLKALFALKGA* |
Ga0134122_117880442 | 3300010400 | Terrestrial Soil | LGMVFYGHRARIARGLQDERWSSRLKAMLIGKGA* |
Ga0134121_114722692 | 3300010401 | Terrestrial Soil | VLGMLNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
Ga0126350_102776221 | 3300010880 | Boreal Forest Soil | LAEPEFATVLGMVNYGQRAQAARGFQADRWGSRLKALLVG* |
Ga0150983_128828912 | 3300011120 | Forest Soil | AKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALWVGKGA* |
Ga0150983_134965841 | 3300011120 | Forest Soil | EFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
Ga0150983_167269622 | 3300011120 | Forest Soil | VLGMVNYGQRARIARGLQEDHWGSRLKALLVGKGA* |
Ga0137391_103954611 | 3300011270 | Vadose Zone Soil | PEFATVLGMAYYGHRARLARGLQEPGFGSRMKALFAGKGA* |
Ga0137391_114834401 | 3300011270 | Vadose Zone Soil | ATVLGMVSYGHRARTARGMQDDGWSSRLKSLFANRGA* |
Ga0137389_109981901 | 3300012096 | Vadose Zone Soil | FATVLGMVFYGHRARIARGIQNGRWSSKLKAMFVGKGA* |
Ga0137363_108073061 | 3300012202 | Vadose Zone Soil | STLAEPEYATVLGMVFYGHRARLARGIHSEPWSSRLKAMFVGKGA* |
Ga0137387_107660662 | 3300012349 | Vadose Zone Soil | SLAEPEFATVLGMIVYGHRARTARGGQDERWSSKLKAMLVG* |
Ga0137367_105165262 | 3300012353 | Vadose Zone Soil | VLGMVFYGHRARIARGMQDQRWSSKLKAMIVGKGA* |
Ga0137385_107401492 | 3300012359 | Vadose Zone Soil | TVLGMVVYGHRARSARGVQDERWSSKLKAMLVGKGA* |
Ga0137390_112784672 | 3300012363 | Vadose Zone Soil | FDVAESVLRRPVRLSWPTPLAKMPASLAEPEYATVLGMVNYGQRARVARGYQQDRWGSKLKALLVGKGA* |
Ga0150984_1068223541 | 3300012469 | Avena Fatua Rhizosphere | PEFATVLGMVMYGHRARTARGMLDERWSSKLKSMLVGKGA* |
Ga0137396_111567052 | 3300012918 | Vadose Zone Soil | EPECATALGMVYYGHRARVARGMQDDRWSSRLKGFFAKKGA* |
Ga0137419_102953913 | 3300012925 | Vadose Zone Soil | LGEPEFATVLGMVYYGHRARIARGMQNNGWSSRMKAMFAMKGA* |
Ga0164308_114977652 | 3300012985 | Soil | ATVLGMVFYGHRARIARGIQNERWSSKLKAMFVGKGA* |
Ga0164304_108634211 | 3300012986 | Soil | PEFATVLGMVAYCHRARSARGIQDDRWSSRLKAMLVGKGA* |
Ga0157370_112316022 | 3300013104 | Corn Rhizosphere | VLAEPEYATLLGMVFYTHRARIARGLQDERWSSRLKALFALKGA* |
Ga0157374_115812632 | 3300013296 | Miscanthus Rhizosphere | ARMPSTLSEPEFATVLGMLNYGQRARIARGLQEDRWGSRLKALLVGKGA* |
Ga0157374_121815922 | 3300013296 | Miscanthus Rhizosphere | IGMIFYAHRARVARGIQNDRWSSRLKAMLVGKGA* |
Ga0157372_108912692 | 3300013307 | Corn Rhizosphere | SALAEPEFATVLGMVAYSHRARTARGIQDERWSSRLKAMLVRKGA* |
Ga0157372_130292311 | 3300013307 | Corn Rhizosphere | EPEFATVLGMVAYSHRARSARGIQDERWSSRLKAMLVGKGA* |
Ga0157375_106595391 | 3300013308 | Miscanthus Rhizosphere | TLAEPEFATVLGMVFYGHRARIARGIQNERWSSKLKAMFVGKGA* |
Ga0181537_100836474 | 3300014201 | Bog | FSTVLGMVYYGHRARVARGLQEPGFGSRMKALFARKGA* |
Ga0163163_103225662 | 3300014325 | Switchgrass Rhizosphere | TELAEPEFATTLGMVYYGHRARVARGIQDGRWSSRLKSFFAKKGA* |
Ga0182010_104804481 | 3300014490 | Fen | TVLGMAYYGHRACLARGLQAPSFSTRMKALFLRKGA* |
Ga0182015_107805332 | 3300014495 | Palsa | ATLAEPEYATVLGMVAYGQRARVARGFQGDRWGSRLKAMLVG* |
Ga0182027_106687922 | 3300014839 | Fen | FMAEPEFATVLGMVYYGHRARLAPGLQEPSFSSRMKAMFARKGA* |
Ga0132256_1038281701 | 3300015372 | Arabidopsis Rhizosphere | LAEPEFATVIGMVAYSHRARTARGIQDERWSSRLKAMLVGKGA* |
Ga0182036_106272662 | 3300016270 | Soil | AELAEPEFATALGMVYYGHRARVARGLQDSRWSSRLKTLFAKKGA |
Ga0181511_10603402 | 3300016702 | Peatland | EFATVLGMAYYGHRARLARGLQEPSFGSRMKAMFARKGA |
Ga0187802_101502471 | 3300017822 | Freshwater Sediment | TVLGMAFYGHRARLARGMQEERWGSKLKAMFVGKGA |
Ga0187818_105196392 | 3300017823 | Freshwater Sediment | EFATVLGMAFYGHRARLARGMQEERWGSKLKAMFVGKGA |
Ga0187825_101824402 | 3300017930 | Freshwater Sediment | EPEYATVLGMVFYGHRARLARGIQSDRWSSKLKAMFVGKGA |
Ga0187821_101677882 | 3300017936 | Freshwater Sediment | EFATVLGMVNYGQRARIARGLQEGGLGSKLKAMFVGTGA |
Ga0187821_105047551 | 3300017936 | Freshwater Sediment | PLPKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0187819_104175701 | 3300017943 | Freshwater Sediment | TVLGMAYYGHRARLARGLQQPSFGSRMKAMFAGKGA |
Ga0187819_105348211 | 3300017943 | Freshwater Sediment | MAEPEFATVLGMAYYSHRARLARGLQEPSFGSRMKALFAGKGA |
Ga0187778_109343501 | 3300017961 | Tropical Peatland | LSEPEFATVLGMVNYGHRARIARGFQEDRWGTKLKALLVGKGA |
Ga0187776_115008162 | 3300017966 | Tropical Peatland | LAEPEYATALGMVFYGHRARIARGIQDERWSSRLKAMFVGKGA |
Ga0187782_100770513 | 3300017975 | Tropical Peatland | EFATVLGMVNYGQRARIARGLQQDRWGSRLKALLVGA |
Ga0187860_11291652 | 3300018014 | Peatland | ATVLGMAYYGHRARLARGLQEPGFGSRMRALFARKGT |
Ga0187863_100194241 | 3300018034 | Peatland | RLSWPAPLARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA |
Ga0187863_104743461 | 3300018034 | Peatland | WPMPLAKMPANLAEPEYATVLGMLNYGQRARLARGFQGERWGSRLKAMLVG |
Ga0187875_107482631 | 3300018035 | Peatland | LSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA |
Ga0187887_108236861 | 3300018043 | Peatland | TTLGMVYYGHRARLARGLQEPGFGSRMKALFAKKGA |
Ga0187851_108349511 | 3300018046 | Peatland | TVLGMVYYGHRARLARGLQEPGFGTRMKALFARKGA |
Ga0187859_103010682 | 3300018047 | Peatland | EFATVLGMAYYGHRARLARGLQEPGFGSRMKALFARKGA |
Ga0187784_108606572 | 3300018062 | Tropical Peatland | ATVLGMVNYGQRARIARGLQQDRWGSRLKALLVGA |
Ga0066655_106882701 | 3300018431 | Grasslands Soil | PSTLSEPEFATVLGMVNYGQRARVARGLQESGLGSRLKAMLVGKGA |
Ga0066662_115921202 | 3300018468 | Grasslands Soil | VGKRAASLADPEFATVLGMIAYGHRARSARGVQDDRWSSRLKAMLVGKGA |
Ga0193727_10687891 | 3300019886 | Soil | PRVLAEPEFATVLGMALYSHRVRVARGMQDGRWSSRLKAFFGRKGA |
Ga0187768_10290982 | 3300020150 | Tropical Peatland | EPEFATVLGMVNYGQRARVARGLQGERWGSKLKAMLVG |
Ga0179592_101557801 | 3300020199 | Vadose Zone Soil | LAEPEFATVLGMALYSHRVRVARGMQDGRWSSRLKSFFGRKGA |
Ga0210407_104941162 | 3300020579 | Soil | APLARMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA |
Ga0210399_106051281 | 3300020581 | Soil | TLSEPEFATVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA |
Ga0210404_108234392 | 3300021088 | Soil | PEFATVLGMVFYGHRARIARGIQNGRWSSKLKAMFVGKGA |
Ga0210406_101987182 | 3300021168 | Soil | TVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0210400_105339991 | 3300021170 | Soil | FATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0210400_107398541 | 3300021170 | Soil | LARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA |
Ga0210405_103568402 | 3300021171 | Soil | ATVLGMIFYGHRARLARGIQDERWSARLKAMFVGKGA |
Ga0210408_111508742 | 3300021178 | Soil | AKMPSTLSEPEYATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA |
Ga0210388_118105422 | 3300021181 | Soil | MPATLAEPEFATVLGMVHYAQRARVARGFQGDRWGSRLKAMLVG |
Ga0213875_104995661 | 3300021388 | Plant Roots | PSALAEPEFSTVLGMAVYGHRARTARGIDQDRWSSRLKAMLVGKGA |
Ga0210385_105352591 | 3300021402 | Soil | WPAPLARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA |
Ga0210385_111336782 | 3300021402 | Soil | SWPAPLAKMPSTLSEPEFATVLGMVNYGQRARIARGIQSDRWGTRLKSLLVGKGA |
Ga0210384_112067432 | 3300021432 | Soil | ATLSEPEFATVLGMVNYGQRARAARGIQGDRWGSKLKAMLVG |
Ga0210391_102935632 | 3300021433 | Soil | TVLGMVNYGQRARVARGLQEDRWGTRLRALLVGKGA |
Ga0210398_102692682 | 3300021477 | Soil | SVRLSWPAPLARMPSTLSEPEFATVLGMVNYGQRARTARGMQEDRWGTRLKALLVGKGA |
Ga0210410_102896421 | 3300021479 | Soil | PSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGTRLKALLVGKGA |
Ga0210410_108353362 | 3300021479 | Soil | TLSEPEFATVIGMANYGHRARIARGQQEDRWGTRLKALLVGKGA |
Ga0126371_110966371 | 3300021560 | Tropical Forest Soil | EPEFATVLGMVVYGHRARTARGVQDERWSAKLKAMLVGKGA |
Ga0213852_14832392 | 3300021858 | Watersheds | AEPEFATVLGMAMYAHRARVARGLQGERWGNRLKALFVGKGA |
Ga0242662_102264921 | 3300022533 | Soil | FATVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA |
Ga0212123_108977721 | 3300022557 | Iron-Sulfur Acid Spring | AKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0242665_102168241 | 3300022724 | Soil | EPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA |
Ga0247668_11110391 | 3300024331 | Soil | FDVAESVLRRSVRLSWPAPLAKMPSTLSEPEYATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0207416_11909902 | 3300025134 | Iron-Sulfur Acid Spring | EYATLIGMVNYGQRARVARGFQGDRWGSRLKAMLVG |
Ga0208190_10021141 | 3300025473 | Peatland | PEFATVLGMAYYGHRARLARGLQEPSFGSRMKALFAGKGA |
Ga0208686_11097421 | 3300025500 | Peatland | PLAKMPVTLAEPEYATLLGMVNYGQRARVARGFQGDRWGSRLKAMLVG |
Ga0207699_100391781 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PEYATVLGLVYYGHRARVARGYQDDRWSSKIKAMFAKKGA |
Ga0207695_108025871 | 3300025913 | Corn Rhizosphere | FATLLGLVYYGQRARMARGYQDYGWSSRLKALFAKKGA |
Ga0207693_109792402 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FATLLGMVAYSHRARSARGIQDERWSSRLKAMLVGKGA |
Ga0207663_108401241 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TALGTIFYGHRARIARGLQEDGWSSRLKSLFALKGA |
Ga0207649_100149651 | 3300025920 | Corn Rhizosphere | FATVLGMVFYGHRARIARGIQNERWSSKLKAMFVGKGA |
Ga0207681_116555171 | 3300025923 | Switchgrass Rhizosphere | VLGMVFYGHRARVARGLQDERWSSRLKAMLVGKGA |
Ga0207650_101605993 | 3300025925 | Switchgrass Rhizosphere | EPEFSTLLGLVYYGQRARMARGYQDDGWSSRLKALFAKKGA |
Ga0207700_110337321 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SSLAEPEFATVLGMVAYGHRARSARGIQDDRWSSRLKAMLVGKGA |
Ga0207644_108045222 | 3300025931 | Switchgrass Rhizosphere | EYATVLGMVFYGHRARIARGIQNDGWGSKLKAMFVGRGA |
Ga0207690_101121453 | 3300025932 | Corn Rhizosphere | LLGLVYYGQRARMARGYQDYGWSSRLKALFAKKGA |
Ga0207665_104240151 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | FASVLGMVNYGHRARIARGYQEGGLGSRLKAMLVGKGA |
Ga0207702_101980871 | 3300026078 | Corn Rhizosphere | ATVLGMINYGHRARLARGYQEGGLGSRLKAMLVGKGA |
Ga0209688_11102511 | 3300026305 | Soil | PEFATVLGMVNYGHRARIARGYQEGGLGSRLKAMLVGKGA |
Ga0209686_10701662 | 3300026315 | Soil | EPEFATVLGMVSYGHRARTARGMQDDGWSGRLKALFADKGA |
Ga0209647_11048801 | 3300026319 | Grasslands Soil | MPSSLGEPEFATVLGMVAYAHRARSARGVHDERWSSRLKAMLVG |
Ga0209375_11187941 | 3300026329 | Soil | EPEFATVLGMVHYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0209473_11685352 | 3300026330 | Soil | EPEFATVLGMVVYGHRARSARGVQDARWSSKLKAMLVG |
Ga0209377_10055431 | 3300026334 | Soil | EYATVIGMIFYGHRARMARGMHGDGWSSKLKALLVGKGA |
Ga0257164_10400581 | 3300026497 | Soil | LAEPEYATVLGMVFYGHRARIARGIQDERWSSRLKAMFVGKGA |
Ga0209474_101627161 | 3300026550 | Soil | LAEPEFATVLGMVVYGHRARSARGVQDARWSSKLKAMLVG |
Ga0179587_101910442 | 3300026557 | Vadose Zone Soil | LSEPEFATVLGMVNYAQRARTARGLQEDRWGTRLKALLVGKGA |
Ga0208859_10118701 | 3300027069 | Forest Soil | FAAALGMIYYGHRARVARGMQDDRWSSRLKAMFVRKGA |
Ga0209215_10297172 | 3300027266 | Forest Soil | VLGMVNYGQRARIARGFQEDRWGTRLKALLVGKGA |
Ga0209004_10619041 | 3300027376 | Forest Soil | SEPEFATVLGMVNYGQRARVARGFQEDRWGTRLKALLVGKGA |
Ga0209525_11113941 | 3300027575 | Forest Soil | FATVIGMVNYGQRARVARGFQGDRWGSRLKAMLVG |
Ga0209422_11024121 | 3300027629 | Forest Soil | EFATVIGMVNYGQRARVARGFQGDRWASRLKAMLVG |
Ga0208827_11797342 | 3300027641 | Peatlands Soil | ATVLGMAYYGHRARLARGLQEPSFGSRMKALFASKGA |
Ga0209076_10716632 | 3300027643 | Vadose Zone Soil | TALGMIYYGHRARVARGIQDGRWSSRLKNLFATRKGA |
Ga0209333_11791902 | 3300027676 | Forest Soil | EPEFATALGMVAYGQRARVARGFQGDRWGSKLKAMLAG |
Ga0209447_101582031 | 3300027701 | Bog Forest Soil | LSWPAPLAKMPSTLSEPEFATVLGMVNYFQRARIARGLQEDRWGTRLKALLVGKGA |
Ga0209178_13457291 | 3300027725 | Agricultural Soil | ATVLGMVMYGHRARSARGVQDERWSSKLKAMLVGKGA |
Ga0209772_102684261 | 3300027768 | Bog Forest Soil | AEPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA |
Ga0209448_100005051 | 3300027783 | Bog Forest Soil | FATVLGMAYYGHRARLARGLQEPGFGSRMKALFARKGA |
Ga0209139_100996971 | 3300027795 | Bog Forest Soil | TVLGMAYYGHRARLARGLQEPGFGSRMKALFAGKGA |
Ga0209274_101209601 | 3300027853 | Soil | MPSTLSEPEFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA |
Ga0209579_100183814 | 3300027869 | Surface Soil | AKMPSTLAEPEYATVLGMVNYGQRARVARGFQGDRWGSRLKAMLVG |
Ga0209283_106859601 | 3300027875 | Vadose Zone Soil | TLAEPEYATVLGMVFYGHRARMARGIQDGRWSSRLKAMFAGKGA |
Ga0209590_105278582 | 3300027882 | Vadose Zone Soil | AEPEFATVLGMVSYGHRARTARGMQDDGWSSRLKSLFANRGA |
Ga0209068_103024941 | 3300027894 | Watersheds | VLGMVYYGHRARVARGLQDSGWSGRMKALFAKKGA |
Ga0209624_105873122 | 3300027895 | Forest Soil | EFATVLGMVNYGQRARVARGLQEDRWGTRLKAMLVGKGA |
Ga0209698_108541682 | 3300027911 | Watersheds | SVLRRSVRLSWPAPLAKMPSTLSEPEYATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0209698_108892352 | 3300027911 | Watersheds | PRTLAEPEYATVLGMAMYWHRARVARGMQDDRWSSKFKAWFARKGA |
Ga0265356_10007541 | 3300028017 | Rhizosphere | EFATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA |
Ga0137415_107398732 | 3300028536 | Vadose Zone Soil | VLGMVNYGQRARIARGYQGDRWGSRLKAMLVGKGA |
Ga0302231_101704641 | 3300028775 | Palsa | ATLAEPEYATVLGMVAYGQRARVARGFQGDRWGSRLKALLVG |
Ga0302290_100285642 | 3300028777 | Fen | EPEFATVLGMVYYGHRARVARGLQDSGWSGRMKALFAKKGA |
Ga0307504_100384371 | 3300028792 | Soil | TAIGMVYYGHRARVARGIQDDRWSSRLKGMFAKKGA |
Ga0265338_104424632 | 3300028800 | Rhizosphere | PSTLSEPEFATVLGMVNYGQRARTARGLQESGFGSRLKAMLVGKGA |
Ga0311340_105818872 | 3300029943 | Palsa | TVLGMLYYGHRARLARGLQERGFGSRMKALFAGKGA |
Ga0311348_111608531 | 3300030019 | Fen | EFATVLGMVYYGHRARVARGLQDSGWSGRMKALFAKKGA |
Ga0302181_101962992 | 3300030056 | Palsa | ATVLGMAYYGHRARLARGLQEPGFGSRMKALFARKGA |
Ga0302179_102665352 | 3300030058 | Palsa | ARMPSTLSEPEFATVLGMVNYGQRARVARGLQQDRWGTRLKELLVGKGA |
Ga0265762_10891731 | 3300030760 | Soil | YATVLGMVHYGQRARVARGFQGDRWGSRLKAMLVG |
Ga0170823_144131932 | 3300031128 | Forest Soil | WPAPLARMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0170823_176622972 | 3300031128 | Forest Soil | FATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGTGA |
Ga0302324_1004782541 | 3300031236 | Palsa | FATVLGMVNYGQRARVARGLQEDRWGTRLKALLVGKGA |
Ga0265339_101866141 | 3300031249 | Rhizosphere | WPAPLAKMPSTLSEPEFATVLGMVNYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0307476_104246331 | 3300031715 | Hardwood Forest Soil | TVLGMANYGHRARIARGQQEDRWGTRLKALLVGKGA |
Ga0307474_100172724 | 3300031718 | Hardwood Forest Soil | PEYATALGMVYYGHRARVARGLQDGRWSSRLRAMFAKKGA |
Ga0307474_109467562 | 3300031718 | Hardwood Forest Soil | ATVLGMVNYGQRARIARGLQEDGWGHRLKAMLVGKGA |
Ga0307469_113557352 | 3300031720 | Hardwood Forest Soil | PEFATVLGMVMYGHRARSARGVQDERWSSKLKAMLVGKGA |
Ga0307469_117889591 | 3300031720 | Hardwood Forest Soil | PEFATVLGMVYYGHRARLARGLQEPSFGSRMKALFAGKGA |
Ga0307477_101829832 | 3300031753 | Hardwood Forest Soil | SVRLSWPAPLPKMPSTLSEPEFATALGMINYGQRARIARGLQEDRWGSRLKALLVGKGA |
Ga0307473_114936271 | 3300031820 | Hardwood Forest Soil | EPEFSTVLGMVYYGHRARIARGLQDGGWSSRMKAMFAKKGA |
Ga0307478_116435151 | 3300031823 | Hardwood Forest Soil | PLARMPSTLSEPEFATVLGMVNYGQRARIARGLQEDGWGHRLKAMLVGKGA |
Ga0306921_106739941 | 3300031912 | Soil | EPEFATALGMVYYGHRARVARGIQDPRWSSRLKALFAKKGA |
Ga0311301_101720461 | 3300032160 | Peatlands Soil | TLAEPEYATLLGMVAYGQRARVARGFQGDRWGSRLKAMLVG |
Ga0307471_1007694861 | 3300032180 | Hardwood Forest Soil | SEPEFATVLGMANYGHRARIARGQQEDRWGTRLKALLIGKGA |
Ga0348332_101031901 | 3300032515 | Plant Litter | ATVLGMVNYGQRARTARGLQEDRWGSRLKALLVGKGA |
Ga0335082_103015491 | 3300032782 | Soil | PEFATVLGMVFYGHRARIARGIQDDRWSARLKSMFVGKGA |
Ga0335074_105048081 | 3300032895 | Soil | PEFATVLGMIAYGQRARVARGIQGDRWGAKLKALLVG |
Ga0335084_122291002 | 3300033004 | Soil | TVLGMAMYGHRARIARGIQDARWSSRLKSLFVGKGA |
Ga0314865_054447_1_144 | 3300033806 | Peatland | MPVVLAEPEYATALGMVFYAHRARVARGIQDERWSSRLKALFAKKGA |
Ga0314866_021022_3_122 | 3300033807 | Peatland | EPEYATVLGMVNYGQRARVARGLQESGLGSRLKAMLMGA |
⦗Top⦘ |