| Basic Information | |
|---|---|
| Family ID | F020032 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 226 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MAAGAGSTGGILAVCIGKFRKFFRANGLGLFQKIKEK |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 226 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.52 % |
| % of genes near scaffold ends (potentially truncated) | 30.09 % |
| % of genes from short scaffolds (< 2000 bps) | 81.42 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.133 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.602 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.088 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.982 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 226 Family Scaffolds |
|---|---|---|
| PF05988 | DUF899 | 62.83 |
| PF08327 | AHSA1 | 6.19 |
| PF00106 | adh_short | 5.75 |
| PF01638 | HxlR | 2.21 |
| PF12680 | SnoaL_2 | 1.33 |
| PF01022 | HTH_5 | 1.33 |
| PF12840 | HTH_20 | 1.33 |
| PF00583 | Acetyltransf_1 | 0.88 |
| PF04978 | DUF664 | 0.44 |
| PF00126 | HTH_1 | 0.44 |
| PF01565 | FAD_binding_4 | 0.44 |
| PF01381 | HTH_3 | 0.44 |
| PF03721 | UDPG_MGDP_dh_N | 0.44 |
| PF05036 | SPOR | 0.44 |
| PF04519 | Bactofilin | 0.44 |
| PF12704 | MacB_PCD | 0.44 |
| PF00590 | TP_methylase | 0.44 |
| PF00165 | HTH_AraC | 0.44 |
| PF16694 | Cytochrome_P460 | 0.44 |
| PF10604 | Polyketide_cyc2 | 0.44 |
| PF12867 | DinB_2 | 0.44 |
| PF09948 | DUF2182 | 0.44 |
| PF13377 | Peripla_BP_3 | 0.44 |
| PF14559 | TPR_19 | 0.44 |
| PF07992 | Pyr_redox_2 | 0.44 |
| PF13545 | HTH_Crp_2 | 0.44 |
| PF07681 | DoxX | 0.44 |
| PF00732 | GMC_oxred_N | 0.44 |
| PF00400 | WD40 | 0.44 |
| PF02837 | Glyco_hydro_2_N | 0.44 |
| PF00775 | Dioxygenase_C | 0.44 |
| PF05016 | ParE_toxin | 0.44 |
| PF06941 | NT5C | 0.44 |
| PF02604 | PhdYeFM_antitox | 0.44 |
| PF00072 | Response_reg | 0.44 |
| PF01379 | Porphobil_deam | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 226 Family Scaffolds |
|---|---|---|---|
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 62.83 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.21 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.44 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.44 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.44 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.44 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.44 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.44 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.44 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.44 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.44 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.44 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.44 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.90 % |
| Unclassified | root | N/A | 3.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459009|GA8DASG02F3J7U | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 500 | Open in IMG/M |
| 3300000567|JGI12270J11330_10114936 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300000955|JGI1027J12803_105214755 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300001172|JGI12681J13546_1007632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300001593|JGI12635J15846_10193477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1351 | Open in IMG/M |
| 3300001593|JGI12635J15846_10767902 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 553 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100646574 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 935 | Open in IMG/M |
| 3300005177|Ga0066690_10778040 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005367|Ga0070667_101231738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 701 | Open in IMG/M |
| 3300005518|Ga0070699_100263791 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300005529|Ga0070741_10116591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2773 | Open in IMG/M |
| 3300005553|Ga0066695_10197408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1262 | Open in IMG/M |
| 3300005554|Ga0066661_10300491 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 989 | Open in IMG/M |
| 3300005555|Ga0066692_10144741 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300005591|Ga0070761_10129222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 1471 | Open in IMG/M |
| 3300005591|Ga0070761_10278249 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300005591|Ga0070761_10658876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 654 | Open in IMG/M |
| 3300005602|Ga0070762_10002325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8941 | Open in IMG/M |
| 3300005610|Ga0070763_10063621 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300005713|Ga0066905_102002607 | Not Available | 537 | Open in IMG/M |
| 3300006028|Ga0070717_10241946 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300006028|Ga0070717_10718843 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300006028|Ga0070717_10973132 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 773 | Open in IMG/M |
| 3300006058|Ga0075432_10183632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 820 | Open in IMG/M |
| 3300006194|Ga0075427_10027319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 927 | Open in IMG/M |
| 3300006358|Ga0068871_101615837 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006358|Ga0068871_102096357 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006845|Ga0075421_100233001 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300006853|Ga0075420_101536961 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 570 | Open in IMG/M |
| 3300006904|Ga0075424_102563689 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300007265|Ga0099794_10224200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300007788|Ga0099795_10184706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 872 | Open in IMG/M |
| 3300007819|Ga0104322_108574 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300009088|Ga0099830_10016524 | All Organisms → cellular organisms → Bacteria | 4690 | Open in IMG/M |
| 3300009088|Ga0099830_11833651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300009089|Ga0099828_10327870 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300009089|Ga0099828_10689089 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300009090|Ga0099827_10143542 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300009098|Ga0105245_10005847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 10801 | Open in IMG/M |
| 3300009098|Ga0105245_10062936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3349 | Open in IMG/M |
| 3300009100|Ga0075418_11561438 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300009143|Ga0099792_10748581 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009177|Ga0105248_10337989 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300009523|Ga0116221_1299749 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009524|Ga0116225_1083497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1494 | Open in IMG/M |
| 3300009623|Ga0116133_1026052 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300009826|Ga0123355_10304523 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300010046|Ga0126384_10512131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1036 | Open in IMG/M |
| 3300010046|Ga0126384_11307497 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010047|Ga0126382_11251282 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010048|Ga0126373_10504490 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300010048|Ga0126373_10897841 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300010048|Ga0126373_11921233 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010336|Ga0134071_10381683 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010358|Ga0126370_10623590 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300010361|Ga0126378_10749062 | Not Available | 1088 | Open in IMG/M |
| 3300010366|Ga0126379_10462381 | Not Available | 1333 | Open in IMG/M |
| 3300010366|Ga0126379_12372124 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010366|Ga0126379_12609470 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010371|Ga0134125_11571704 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 716 | Open in IMG/M |
| 3300010373|Ga0134128_10400881 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300010373|Ga0134128_11234323 | Not Available | 824 | Open in IMG/M |
| 3300010376|Ga0126381_100643399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1512 | Open in IMG/M |
| 3300010376|Ga0126381_103294806 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010379|Ga0136449_100007542 | All Organisms → cellular organisms → Bacteria | 31119 | Open in IMG/M |
| 3300010379|Ga0136449_100462784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2219 | Open in IMG/M |
| 3300010398|Ga0126383_10895600 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300011269|Ga0137392_10656118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 870 | Open in IMG/M |
| 3300011993|Ga0120182_1002964 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300012022|Ga0120191_10020368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Antrihabitans → Antrihabitans stalactiti | 939 | Open in IMG/M |
| 3300012189|Ga0137388_10874367 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012202|Ga0137363_10574396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300012202|Ga0137363_10655966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 887 | Open in IMG/M |
| 3300012202|Ga0137363_10845514 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012202|Ga0137363_11159901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 657 | Open in IMG/M |
| 3300012206|Ga0137380_11437717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300012361|Ga0137360_10001856 | All Organisms → cellular organisms → Bacteria | 12529 | Open in IMG/M |
| 3300012362|Ga0137361_10012690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6105 | Open in IMG/M |
| 3300012362|Ga0137361_10015875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5577 | Open in IMG/M |
| 3300012362|Ga0137361_10065203 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
| 3300012363|Ga0137390_11357974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 656 | Open in IMG/M |
| 3300012685|Ga0137397_10125047 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300012685|Ga0137397_10530722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Antrihabitans → Antrihabitans stalactiti | 876 | Open in IMG/M |
| 3300012923|Ga0137359_10662987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 911 | Open in IMG/M |
| 3300012929|Ga0137404_12229661 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012930|Ga0137407_10026685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4438 | Open in IMG/M |
| 3300012944|Ga0137410_10231285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1442 | Open in IMG/M |
| 3300012948|Ga0126375_10341672 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300012948|Ga0126375_11241586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 623 | Open in IMG/M |
| 3300012951|Ga0164300_10842688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 573 | Open in IMG/M |
| 3300012971|Ga0126369_11419124 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012975|Ga0134110_10306611 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012984|Ga0164309_11563766 | Not Available | 565 | Open in IMG/M |
| 3300014489|Ga0182018_10025760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3807 | Open in IMG/M |
| 3300014495|Ga0182015_10069385 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300014501|Ga0182024_10002271 | All Organisms → cellular organisms → Bacteria | 48086 | Open in IMG/M |
| 3300014501|Ga0182024_10147309 | All Organisms → cellular organisms → Bacteria | 3316 | Open in IMG/M |
| 3300014501|Ga0182024_10179824 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
| 3300014501|Ga0182024_10413701 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300014501|Ga0182024_10799798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1149 | Open in IMG/M |
| 3300014969|Ga0157376_11364576 | Not Available | 740 | Open in IMG/M |
| 3300014969|Ga0157376_12730627 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300015197|Ga0167638_1079685 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300015241|Ga0137418_10056967 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
| 3300015371|Ga0132258_13480248 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300016404|Ga0182037_11818632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 544 | Open in IMG/M |
| 3300017946|Ga0187879_10070969 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300017995|Ga0187816_10235000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 799 | Open in IMG/M |
| 3300018031|Ga0184634_10383152 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 644 | Open in IMG/M |
| 3300019882|Ga0193713_1139888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 656 | Open in IMG/M |
| 3300020004|Ga0193755_1128749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 784 | Open in IMG/M |
| 3300020021|Ga0193726_1214464 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300020580|Ga0210403_10000337 | All Organisms → cellular organisms → Bacteria | 50752 | Open in IMG/M |
| 3300020580|Ga0210403_11490387 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300020581|Ga0210399_10013959 | All Organisms → cellular organisms → Bacteria | 6319 | Open in IMG/M |
| 3300020581|Ga0210399_10038903 | All Organisms → cellular organisms → Bacteria | 3808 | Open in IMG/M |
| 3300020581|Ga0210399_10332250 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300020583|Ga0210401_10633138 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300021086|Ga0179596_10202554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 967 | Open in IMG/M |
| 3300021086|Ga0179596_10680672 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300021168|Ga0210406_10493167 | Not Available | 969 | Open in IMG/M |
| 3300021171|Ga0210405_11241365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 550 | Open in IMG/M |
| 3300021178|Ga0210408_11401898 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021181|Ga0210388_10130602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2171 | Open in IMG/M |
| 3300021181|Ga0210388_10884197 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300021181|Ga0210388_11424929 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021384|Ga0213876_10223255 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300021388|Ga0213875_10013561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3997 | Open in IMG/M |
| 3300021388|Ga0213875_10219585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 895 | Open in IMG/M |
| 3300021404|Ga0210389_10970427 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021404|Ga0210389_11231835 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300021405|Ga0210387_10623372 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300021407|Ga0210383_10692049 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300021420|Ga0210394_10490169 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300021420|Ga0210394_11071205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 696 | Open in IMG/M |
| 3300021420|Ga0210394_11595496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 549 | Open in IMG/M |
| 3300021432|Ga0210384_10037294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4490 | Open in IMG/M |
| 3300021432|Ga0210384_10334921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1363 | Open in IMG/M |
| 3300021433|Ga0210391_10000022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 252140 | Open in IMG/M |
| 3300021478|Ga0210402_11630832 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021479|Ga0210410_10800383 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300021560|Ga0126371_11648010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 766 | Open in IMG/M |
| 3300022518|Ga0224548_1005172 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300022523|Ga0242663_1113873 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300022881|Ga0224545_1004257 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300024225|Ga0224572_1066194 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300024295|Ga0224556_1076979 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300024330|Ga0137417_1339626 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
| 3300025482|Ga0208715_1037643 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300025905|Ga0207685_10385684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 137 | 715 | Open in IMG/M |
| 3300025922|Ga0207646_10661117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 936 | Open in IMG/M |
| 3300026035|Ga0207703_10030768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4241 | Open in IMG/M |
| 3300026214|Ga0209838_1021408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 904 | Open in IMG/M |
| 3300026298|Ga0209236_1118245 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300026319|Ga0209647_1050346 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300026496|Ga0257157_1027795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 930 | Open in IMG/M |
| 3300026538|Ga0209056_10181015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1568 | Open in IMG/M |
| 3300026865|Ga0207746_1016038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 633 | Open in IMG/M |
| 3300027039|Ga0207855_1044899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300027172|Ga0208098_1020613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300027330|Ga0207777_1023859 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300027376|Ga0209004_1062376 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300027388|Ga0208995_1021655 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027497|Ga0208199_1030979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1171 | Open in IMG/M |
| 3300027562|Ga0209735_1058116 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300027641|Ga0208827_1112228 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300027651|Ga0209217_1071130 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300027660|Ga0209736_1004110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4823 | Open in IMG/M |
| 3300027678|Ga0209011_1015027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2552 | Open in IMG/M |
| 3300027698|Ga0209446_1027309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
| 3300027729|Ga0209248_10156594 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027783|Ga0209448_10257247 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027829|Ga0209773_10315468 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300027855|Ga0209693_10155085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1130 | Open in IMG/M |
| 3300027862|Ga0209701_10018177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4586 | Open in IMG/M |
| 3300027903|Ga0209488_10774836 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027908|Ga0209006_10926755 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027909|Ga0209382_10452047 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300027909|Ga0209382_10456626 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300027911|Ga0209698_10060302 | All Organisms → cellular organisms → Bacteria | 3280 | Open in IMG/M |
| 3300028536|Ga0137415_10594740 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300028746|Ga0302233_10218383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 726 | Open in IMG/M |
| 3300028759|Ga0302224_10077766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 1261 | Open in IMG/M |
| 3300028779|Ga0302266_10253282 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300028906|Ga0308309_10615960 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300028906|Ga0308309_10808832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 814 | Open in IMG/M |
| 3300029914|Ga0311359_10028998 | All Organisms → cellular organisms → Bacteria | 6393 | Open in IMG/M |
| 3300029951|Ga0311371_11677604 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300030007|Ga0311338_10097591 | All Organisms → cellular organisms → Bacteria | 3665 | Open in IMG/M |
| 3300030044|Ga0302281_10276267 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300030520|Ga0311372_12532922 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300030617|Ga0311356_10487145 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300030743|Ga0265461_12079243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 652 | Open in IMG/M |
| 3300030760|Ga0265762_1054764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
| 3300030815|Ga0265746_1062476 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 536 | Open in IMG/M |
| 3300030862|Ga0265753_1008413 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300031018|Ga0265773_1016276 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300031027|Ga0302308_10025316 | All Organisms → cellular organisms → Bacteria | 4480 | Open in IMG/M |
| 3300031028|Ga0302180_10241207 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300031057|Ga0170834_113133832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
| 3300031090|Ga0265760_10110565 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 875 | Open in IMG/M |
| 3300031090|Ga0265760_10232682 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031122|Ga0170822_15824056 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300031344|Ga0265316_10984221 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031525|Ga0302326_12807160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 601 | Open in IMG/M |
| 3300031708|Ga0310686_100263339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 826 | Open in IMG/M |
| 3300031715|Ga0307476_11188237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 559 | Open in IMG/M |
| 3300031716|Ga0310813_10367915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1229 | Open in IMG/M |
| 3300031720|Ga0307469_11238993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 706 | Open in IMG/M |
| 3300031753|Ga0307477_11016397 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031754|Ga0307475_10042934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3359 | Open in IMG/M |
| 3300031754|Ga0307475_10344534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1197 | Open in IMG/M |
| 3300031754|Ga0307475_10994468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 659 | Open in IMG/M |
| 3300031823|Ga0307478_10536133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 977 | Open in IMG/M |
| 3300031910|Ga0306923_12472972 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031962|Ga0307479_10193510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2002 | Open in IMG/M |
| 3300032089|Ga0318525_10593461 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300032160|Ga0311301_10722582 | All Organisms → Viruses → Predicted Viral | 1393 | Open in IMG/M |
| 3300032174|Ga0307470_10646174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 798 | Open in IMG/M |
| 3300032174|Ga0307470_11324129 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032180|Ga0307471_100420464 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300032261|Ga0306920_103682792 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300032783|Ga0335079_10011258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10190 | Open in IMG/M |
| 3300032892|Ga0335081_10041196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7331 | Open in IMG/M |
| 3300033547|Ga0316212_1023140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 870 | Open in IMG/M |
| 3300034163|Ga0370515_0227617 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 792 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.21% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.33% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.44% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.44% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.44% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.44% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.44% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001172 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F47_03691110 | 2170459009 | Grass Soil | MVAGAASTGGILAVCTGKLRTFFRVNRLGLFQKTKDKEK |
| JGI12270J11330_101149362 | 3300000567 | Peatlands Soil | MAAGAGSMGGILAVCIGKFRNFFRTNGLSHLQKIKEK* |
| JGI1027J12803_1052147552 | 3300000955 | Soil | AVMVAGAASTGGILAVFIGKFRRFFRANGLQKTKEK* |
| JGI12681J13546_10076322 | 3300001172 | Forest Soil | MVAGVGSTGGILAVCIGKFRKFFGANRLGLIQKTTEEKDGNKQTERQG |
| JGI12635J15846_101934772 | 3300001593 | Forest Soil | MAAGAGSTGGILAVCISKFRKFFKANGLNLFQKTKEK* |
| JGI12635J15846_107679021 | 3300001593 | Forest Soil | AGAGSTGGILAVCIGKFRKFFRANGLGLFHKIKEK* |
| JGIcombinedJ26739_1006465741 | 3300002245 | Forest Soil | MAAGAGSTGGVLAVYIGKFKKFFRANGLGLFHKIKEK* |
| Ga0066690_107780402 | 3300005177 | Soil | TAVMVAGVASTGGILAVCIGKFRKVFRASSLGLFQKTKEN* |
| Ga0070667_1012317381 | 3300005367 | Switchgrass Rhizosphere | AVMVAGAGSTGGILAVCIGKFRRFFRANRLGLFQKTKEK* |
| Ga0070699_1002637912 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SAVVMAAGAGSTGGILAVCIGKFRKFFRANGLGLFQKIKEK* |
| Ga0070741_101165914 | 3300005529 | Surface Soil | MVAGVASTGGILAVCIGKFRKFFYASGLRLFDKTKGK* |
| Ga0066695_101974082 | 3300005553 | Soil | VPSMHRKHTVMVAGAGSTGGILAVCIGKFRKFFRANGLGLFQKTKEK* |
| Ga0066661_103004912 | 3300005554 | Soil | MVAGAASTGGILAVFVGKFRKFFRANGLQKTKEK* |
| Ga0066692_101447412 | 3300005555 | Soil | MVAGAGSTGGILAVYIGKFRKFFRANRLGLFQKTKEK* |
| Ga0070761_101292221 | 3300005591 | Soil | MAVGAGSTGGILAVYIGRFREFFRAIGLGLFQKIKEK* |
| Ga0070761_102782491 | 3300005591 | Soil | AGAGSTGGILAVCIGSFRKFTKANRLSLFQETKEK* |
| Ga0070761_106588761 | 3300005591 | Soil | LVTGTGSAGGFLAVCITKFRKFFRAKRFGQFQNAKEI* |
| Ga0070762_100023252 | 3300005602 | Soil | MAAGAGSAGGILAVCIGAFRNFFRTNGLGLFQKIKEK* |
| Ga0070763_100636212 | 3300005610 | Soil | MVAGAGSTGGILAVCIGKLRKFFRASGLGLFQKTKEK* |
| Ga0066905_1020026072 | 3300005713 | Tropical Forest Soil | MIAGATSTGGILVARIGKFRKFFRTSGLGLFQKTKEK* |
| Ga0070717_102419462 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAGAGCAGGILAVRIGEFRRFFRVNRLGLFQKTKEK* |
| Ga0070717_107188431 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAGAGSTGGILALCIGKFRNFVRVSSLSLFQKRKEK* |
| Ga0070717_109731322 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAAGAGSTGGILAVCIGKFRKLFRASGLGLFQKIKEK* |
| Ga0075432_101836321 | 3300006058 | Populus Rhizosphere | MVAVAGSTGGILAMCIGKFRRFFRANRLGLFQKTKEK* |
| Ga0075427_100273191 | 3300006194 | Populus Rhizosphere | MVAVAGSTGGILAVCIGKFRRFFRANRLGLFQKTKEK* |
| Ga0068871_1016158371 | 3300006358 | Miscanthus Rhizosphere | MTAGAGSTGGILAVYISKFKKVFRANGLGPFHKIKEK* |
| Ga0068871_1020963572 | 3300006358 | Miscanthus Rhizosphere | GGILAVCISRFRKFFSARGFGLFERTKEKRYGNKQ* |
| Ga0075421_1002330014 | 3300006845 | Populus Rhizosphere | VMVAGAGSGGGILVVCIRKFRKFFEANRLGLFQKTEEK* |
| Ga0075420_1015369612 | 3300006853 | Populus Rhizosphere | MHRKHNSDGVGSTGGILAVCIGKFRKFFRANGLGLFQKKKEK* |
| Ga0075424_1025636892 | 3300006904 | Populus Rhizosphere | MAAGAGSAGGILALFIGKCRKFFRANRFGLTHKAKEK* |
| Ga0099794_102242002 | 3300007265 | Vadose Zone Soil | MVAGAGSTGGILAVCIGKFRKVFRANRFGLFQKTKEK* |
| Ga0099795_101847062 | 3300007788 | Vadose Zone Soil | MAAGAGSTGGILAVCIGKFRNFFRTSGLGPFQKIKEK* |
| Ga0104322_1085743 | 3300007819 | Permafrost Soil | MAAGAGSTGGILVACIGKFKKFFRANGLGLFQKMKEK* |
| Ga0099830_100165242 | 3300009088 | Vadose Zone Soil | MVAGAGSAGGILAVCIGKFRKFFRANRLGLFQKTKEK* |
| Ga0099830_118336512 | 3300009088 | Vadose Zone Soil | MVAAAGFTGGILAVYIGKFREFFRARSFGLFQKTKEK* |
| Ga0099828_103278703 | 3300009089 | Vadose Zone Soil | MVAGAGSTGGILAVCIGKFREFFRANRLGLFQKTKE |
| Ga0099828_106890892 | 3300009089 | Vadose Zone Soil | MAAGAGSTGGILAVCIGKFRKFFRANGLSLFQKIKEK* |
| Ga0099827_101435422 | 3300009090 | Vadose Zone Soil | MVAGAGSTGGILAVCIGKFRKFFKANRLGLFQKTKEK* |
| Ga0105245_100058478 | 3300009098 | Miscanthus Rhizosphere | MVAGAGSTGGILAMCIGEFRKVFKANRLGLFQKEKEN* |
| Ga0105245_100629364 | 3300009098 | Miscanthus Rhizosphere | MVAGAGSTGGILAVCIGKFRKIFKANRPGLIQKTREN* |
| Ga0075418_115614382 | 3300009100 | Populus Rhizosphere | MVAGAGSGGGILVVCIRKFRKFFEANRLGLFQKTEEK* |
| Ga0099792_107485812 | 3300009143 | Vadose Zone Soil | MIAGAGSTGGILAVCIGKFRKVFSADRFGLFQKAQEK* |
| Ga0105248_103379892 | 3300009177 | Switchgrass Rhizosphere | MVAGAGSTGGILAMCIGKFRKVFKANRLGLFQKEKEN* |
| Ga0116221_12997492 | 3300009523 | Peatlands Soil | VSGAGSTGGILAMCIGKFRKFFRANRLGLVQKTKEK* |
| Ga0116225_10834972 | 3300009524 | Peatlands Soil | MAAGAGSMGGILAVCIGKFRNFFRTNGLCHLQKIKEK* |
| Ga0116133_10260522 | 3300009623 | Peatland | MVAGAGSTGGILAVCIGKFRKFFRANLRGLFQKIKEK* |
| Ga0123355_103045231 | 3300009826 | Termite Gut | MVAGAGSMGGILAVYIGKFRKFFTASNLGLFQKIKEN* |
| Ga0126384_105121312 | 3300010046 | Tropical Forest Soil | MVAGAASAGGILAVCIGKFRKFFRANGLGLFQKAKEK* |
| Ga0126384_113074972 | 3300010046 | Tropical Forest Soil | MANTAAMVAGVGFTGGILAVIIGKVRRFFRASGLFQRTKEK* |
| Ga0126382_112512822 | 3300010047 | Tropical Forest Soil | VMIAGAGFTGGILAVSIAKFRRFFRARGLRLVQRTKEK* |
| Ga0126373_105044901 | 3300010048 | Tropical Forest Soil | MVAGVGSTGGILAVAIGKVRKFFRVTGFGLFQKTKEK* |
| Ga0126373_108978412 | 3300010048 | Tropical Forest Soil | MVAGAGSMGGVLALYIGRVRKLFRASSLGLFKKTKEK* |
| Ga0126373_119212331 | 3300010048 | Tropical Forest Soil | MVAGAGTVGGILAVCIGKFGKVFRTSGLVQKTKEK |
| Ga0134071_103816832 | 3300010336 | Grasslands Soil | MVAAAGSTGGILAVCIGKFRTLFRLGLFQKTKEK* |
| Ga0126370_106235902 | 3300010358 | Tropical Forest Soil | MIAGAGSAGGILAVCIGKFRKFFRANRLGLFQKEKEK* |
| Ga0126378_107490622 | 3300010361 | Tropical Forest Soil | MVAGAASTGGILAVCIGKFRKFLRTSGLGLFQKAKEE* |
| Ga0126379_104623811 | 3300010366 | Tropical Forest Soil | MVAADGSTGVCIGKFRKFFRANRLGLFQKTKEKED |
| Ga0126379_123721242 | 3300010366 | Tropical Forest Soil | MVAGAGSAGGILAVFIHKFRRFFRANRLGLIQKAKEK* |
| Ga0126379_126094701 | 3300010366 | Tropical Forest Soil | MVVRAVSTGGFLAVCIGKFRKLFRVSGFGLVQKLKEK* |
| Ga0134125_115717042 | 3300010371 | Terrestrial Soil | MVAGAGSTGGLLALCIGKFRKFFKADRIGLFQKTTEK* |
| Ga0134128_104008812 | 3300010373 | Terrestrial Soil | MVAGAGSTGGLLALCIGKFRKFFRADRIGLLQKTTEK* |
| Ga0134128_112343232 | 3300010373 | Terrestrial Soil | MVAGAGSTGGILALCIGKFRKFFRADRIGLFQKTTEK* |
| Ga0126381_1006433991 | 3300010376 | Tropical Forest Soil | TAVMVAGAVSTGGFLAVCIGKFRKLFRVSLFSLFHKTKEQ* |
| Ga0126381_1032948061 | 3300010376 | Tropical Forest Soil | VMVAGAGSTGGFLAVCIGKFRKFLRASGLGVLQRTKEN* |
| Ga0136449_1000075428 | 3300010379 | Peatlands Soil | MVAGAGSTGGILAVCVGKFRKFFGANRFGLFQKAEEK* |
| Ga0136449_1004627843 | 3300010379 | Peatlands Soil | MAAGAGSTGGILAVCISKFRKFFKASGLGLFQKIKEK* |
| Ga0126383_108956002 | 3300010398 | Tropical Forest Soil | MVAGVTSTGGALAVCIGKFRKFFNFSGLFQKRKEK* |
| Ga0137392_106561182 | 3300011269 | Vadose Zone Soil | MAAGAESTGGILAVCIGKFRKFFKANGLGLFQKIKEK* |
| Ga0120182_10029642 | 3300011993 | Terrestrial | MVTGAGITGGILAVYIGRFRKFFSARGFGLFEKTKEKRYGNKQ* |
| Ga0120191_100203682 | 3300012022 | Terrestrial | MVTGAGVTGAILAVYIGRFRKFFRARRLGLFQKTKEK* |
| Ga0137388_108743672 | 3300012189 | Vadose Zone Soil | MMAAGVGSTGGILAVCIGKFRKFFKANGLGLFQKIKEK* |
| Ga0137363_105743962 | 3300012202 | Vadose Zone Soil | MIAGAGSTGGILAVCIGKFRKLFRANRLGLFQKTKEK* |
| Ga0137363_106559662 | 3300012202 | Vadose Zone Soil | MAAGAGSTGGILAVCIGKFRKLFRTNGLGLFQKIKEK* |
| Ga0137363_108455142 | 3300012202 | Vadose Zone Soil | MAAGAGSTGGILAVCIGKFRKFFRAIGLGLFQKIKEK* |
| Ga0137363_111599012 | 3300012202 | Vadose Zone Soil | MAAGAGSTGGILAVCIGKFRKFFRANGLGLFQKIKEK* |
| Ga0137380_114377172 | 3300012206 | Vadose Zone Soil | MAAAATSSGGILVVCIGKLRRVFKSSGLGLFHKTKEK* |
| Ga0137360_100018564 | 3300012361 | Vadose Zone Soil | MVAAATSSGGILAVCIGKFRKFFRASGLGLFQKTKEK* |
| Ga0137361_100126902 | 3300012362 | Vadose Zone Soil | MAAGAGSTGGILAACIGKLRKFFRANGLGLLQKIKEK* |
| Ga0137361_100158752 | 3300012362 | Vadose Zone Soil | MVAGAASTGGILAACIGKFREFFKASGLSLFQGRKEK* |
| Ga0137361_100652036 | 3300012362 | Vadose Zone Soil | MVAGAGSAGGILAVCIGKFRKFFRANRLGLFQKTK |
| Ga0137390_113579742 | 3300012363 | Vadose Zone Soil | VMVAAAGSTGGILAVCIGKFREFFKASGLSLFQGRKEK* |
| Ga0137397_101250472 | 3300012685 | Vadose Zone Soil | MIAGAGSTGGILAVCIGKFRKVFRADRFGLFQKAQEK* |
| Ga0137397_105307221 | 3300012685 | Vadose Zone Soil | MVAGAGFTGGILAVYIGKFRKFFRASLGLFQKTKEK |
| Ga0137359_106629872 | 3300012923 | Vadose Zone Soil | MAAGAGSTGGILALCIGKFRNFRANGLGLFQRIKEKSKEK* |
| Ga0137404_122296612 | 3300012929 | Vadose Zone Soil | MAAGAESPGGILAVCIGKSRKFFRANGLGLFQKIKEK* |
| Ga0137407_100266856 | 3300012930 | Vadose Zone Soil | MAAGAGSPGGILAVCIGKFRNFFRANGLGLFQKIKEKSKEK* |
| Ga0137410_102312853 | 3300012944 | Vadose Zone Soil | MVAGAGSTGGVLVLCIGKFRKVFKVHRLGLFQKKEK |
| Ga0126375_103416722 | 3300012948 | Tropical Forest Soil | MVAGAGFTGGILAVCIGKVRKFFRARGLGLFQRAKEK* |
| Ga0126375_112415862 | 3300012948 | Tropical Forest Soil | MVAGAGCTGGILAVCIGRVKKLFIAYRLGLLERTKEK* |
| Ga0164300_108426882 | 3300012951 | Soil | AATSSGGILAVCIGKFRKSFRASDLGLIHKTKEK* |
| Ga0126369_114191242 | 3300012971 | Tropical Forest Soil | MVAGAGFTGGILAVCIGKIRRFFSANDLFKRAKEK* |
| Ga0134110_103066111 | 3300012975 | Grasslands Soil | AGARRTGGILSVCIGKFRKFFRPNPDLFRKAKEK* |
| Ga0164309_115637662 | 3300012984 | Soil | MAAGAGSTGGILAVYIGKFKKVFRANGLGLFHKIKEK* |
| Ga0182018_100257601 | 3300014489 | Palsa | MVAEAGSTGGILAVCIGKFRKGFRVNRLGLFQKT* |
| Ga0182015_100693852 | 3300014495 | Palsa | MVTGAGSAGGILAVCIGKFKNFFRANGLGLFQKIKEQ* |
| Ga0182024_1000227110 | 3300014501 | Permafrost | MAAGAGSTGGILAVYIGKLRNFFRASGLGLFQKIKEK* |
| Ga0182024_101473094 | 3300014501 | Permafrost | MAAGAGSTGGILVAWIGKFRKIFRASGLGLFQKIKEK* |
| Ga0182024_101798246 | 3300014501 | Permafrost | MAAGAGSTGGVLAVCIGKLRNFFRANRLGLDQKAKEK* |
| Ga0182024_104137012 | 3300014501 | Permafrost | MVAGAGSTGGILAACIGKFRKYFRANRFGLFQETEEQ* |
| Ga0182024_107997983 | 3300014501 | Permafrost | MAAGAGSTGGILAACIGKFKNFFRANGRGLFQKIKEK* |
| Ga0157376_113645762 | 3300014969 | Miscanthus Rhizosphere | MVAGAGSTGGILAVFLGRFRKVFAVNRLGLVQKAKEK* |
| Ga0157376_127306272 | 3300014969 | Miscanthus Rhizosphere | IANTVAMVAGAGSAGGILAVCFGKVRNLFRANQLSPNHRTKEN* |
| Ga0167638_10796852 | 3300015197 | Glacier Forefield Soil | VMAAGAGSTGGILAVCISKFRKVFRANGLGLFQKIKEK* |
| Ga0137418_100569674 | 3300015241 | Vadose Zone Soil | MVAGAGSTGGILVVCIGKFRRFFRANRLGLFQKTKEK* |
| Ga0132258_134802482 | 3300015371 | Arabidopsis Rhizosphere | GAGSTGGLLAVCIGKFRRFFRANRLGLFQKTKEK* |
| Ga0182037_118186322 | 3300016404 | Soil | MVAGVGSTGGILAVAIGKVRKFYRVTGFGLFQKTKEK |
| Ga0187879_100709693 | 3300017946 | Peatland | MVAGAGSTGGILAVCIGKFRKFFRANLRGLFQKIKEK |
| Ga0187816_102350001 | 3300017995 | Freshwater Sediment | MVAGAGSTGGILAVYIGKVREFFRASGLGLFQKTKEK |
| Ga0184634_103831521 | 3300018031 | Groundwater Sediment | AVAVMVAGAGSTGGILAVCIGKFRRFFRANRLGLFQKTKEK |
| Ga0193713_11398882 | 3300019882 | Soil | MVAGVGSTGGILAVCIGKFRELFKGKRLGLFQKIKEK |
| Ga0193755_11287491 | 3300020004 | Soil | AGAGSTGGILAVCIGKFRKLFGAHRLGLFQKTKEK |
| Ga0193726_12144642 | 3300020021 | Soil | MAAGAGSAGGILAVCIGKFRKFFRANGLGLFQKIKEK |
| Ga0210403_1000033711 | 3300020580 | Soil | MAAGAGSTGGILAVCIGKFREFLRANGLGLFQKIKEK |
| Ga0210403_114903872 | 3300020580 | Soil | MAAGAGSTGGILAVCIGQIRKLFREFFSASGPGLFQKIKVKWKEK |
| Ga0210399_100139597 | 3300020581 | Soil | MAAGAGSTGGILAVCVGKFRKFFKMNGFGLFQKTKEK |
| Ga0210399_100389032 | 3300020581 | Soil | MAVGAGSTGGILVLCIGKFRKFFKANGLGLFHKIKEK |
| Ga0210399_103322503 | 3300020581 | Soil | MAAGAGSTGGILAVYIGKFRKFFRANGLFQKIKDKWKEK |
| Ga0210401_106331382 | 3300020583 | Soil | MVAGAGSTGGILAACVGKFRKFFTTNHINLFQKTKEK |
| Ga0179596_102025542 | 3300021086 | Vadose Zone Soil | MAAGAGSTGGILAVCIGKFRKFFRANGLGLFQKIKEK |
| Ga0179596_106806722 | 3300021086 | Vadose Zone Soil | MVAGAGSTGGILAAYIGKFRKVFRANRFGLFQKTKEK |
| Ga0210406_104931673 | 3300021168 | Soil | MAAGAGSTGGILAVCIDKFRKFFSASGLGLFQKIKEKQNGNQ |
| Ga0210405_112413652 | 3300021171 | Soil | ASAGSTGGILAVCIGKLRKVFRANPLGLFQRTKES |
| Ga0210408_114018982 | 3300021178 | Soil | MVAGAASTGGILAMCIGKLRNIFRANRLGLFQKEKEK |
| Ga0210388_101306024 | 3300021181 | Soil | MAVGAGSTGGIMAVYIGRFREFFRANGLGLFQKIKEK |
| Ga0210388_108841972 | 3300021181 | Soil | MAAGAGSTGGILAVCIGKFREFFRASGLGLFQKIKEK |
| Ga0210388_114249291 | 3300021181 | Soil | AAGAGSTGGILAVCIGKFRKFFKARGFGLLRKAVEK |
| Ga0213876_102232552 | 3300021384 | Plant Roots | AGAGSTGGVLAVCIGKFKKFFRANRSGLFQKTKEK |
| Ga0213875_100135613 | 3300021388 | Plant Roots | MVAEAASAGGILAVCIGKIRKVFGANRLGRIQQGREK |
| Ga0213875_102195853 | 3300021388 | Plant Roots | MVAGAGSTGGILAVCIGKFRKFLRAIHLVLFEKTKEK |
| Ga0210389_109704272 | 3300021404 | Soil | AAAVIAGTGSAGGILAVCIGKFRKFFGGNPLSLFPRAKEE |
| Ga0210389_112318351 | 3300021404 | Soil | MVAGAGSTGGILAVCVGKIRKIFKANRLGLFQKTSISENKEN |
| Ga0210387_106233722 | 3300021405 | Soil | MVAAAGSTGGILAVYIGKFRKFFRANRLGLFQKTKEK |
| Ga0210383_106920492 | 3300021407 | Soil | MAAGAGSTGGILAVCIDKFRKFFGASGLGLFQKIKEK |
| Ga0210394_104901693 | 3300021420 | Soil | SAAMTAAGAGSTGGVLVVWIGKFRKVFSASGLCLFHKIKEK |
| Ga0210394_110712052 | 3300021420 | Soil | MAAGAGSTGGILAVCIGKFRRFFTANGLSLFQKIKEK |
| Ga0210394_115954961 | 3300021420 | Soil | VMAAGAGSTGGILAVCISKFRKFFKANGLNLFQKTKEK |
| Ga0210384_100372942 | 3300021432 | Soil | MAAGAGSTGGILAVYVGKFRNFFTANGLGLFQKIKEKWKEK |
| Ga0210384_103349211 | 3300021432 | Soil | AGAGSTGGILAVCIDKFRKVFRASGLGLFQKIKEKQNGNQ |
| Ga0210391_1000002277 | 3300021433 | Soil | MAAGAGSAGGILAVGIGAFRNFFRTNGLGLFQKIKEK |
| Ga0210402_116308321 | 3300021478 | Soil | MVAGAGSTGGILAVCIGKFRKVFKPNRLGLFQKAKEK |
| Ga0210410_108003832 | 3300021479 | Soil | MIAGVGSTGGILAVCIGKFRKLLRASVLGLFQKTKEK |
| Ga0126371_116480102 | 3300021560 | Tropical Forest Soil | MIAGAGSAVGILAVCIGKFRKFFRANRLGLFLKEKEK |
| Ga0224548_10051723 | 3300022518 | Soil | AGAGSTEGILAVCIGKFRKFFTANRLGLFQKREEK |
| Ga0242663_11138732 | 3300022523 | Soil | MAAGAGSTGGILAVCIGQFRKLSRKFFKANGLGLFQKIKEK |
| Ga0224545_10042572 | 3300022881 | Soil | MVAGAGSTGGILAVCIGKFRKVFRADHLSLFQKIKEK |
| Ga0224572_10661942 | 3300024225 | Rhizosphere | MVAGAASTGGILAVCIGKFRKFFGANLFDLFQKTKEK |
| Ga0224556_10769792 | 3300024295 | Soil | MAAGAASTAGILAVCIGKFRNFFRTNGLGLFQKIKEN |
| Ga0137417_13396263 | 3300024330 | Vadose Zone Soil | MVAAATSSGGILAVCIGKFRKFFRASGLGLFQKTKEK |
| Ga0208715_10376432 | 3300025482 | Arctic Peat Soil | MVAGAGTSGGFLAVCIGKFRKLFTANRIGVLQKTKET |
| Ga0207685_103856842 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAGAGSGGGILVVCIRKFRKFFEANRLGLFQKTE |
| Ga0207646_106611171 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAGAGSTGGILAMCIGKFKKFFRANGLDLFQKIKEK |
| Ga0207703_100307684 | 3300026035 | Switchgrass Rhizosphere | MVAGAGSTGGILAMCIGKFRKVFKANRLGLFQKEKEN |
| Ga0209838_10214081 | 3300026214 | Soil | MVTGAGSAGGILAACIGKFRRFFRANGLDLFQKIKEK |
| Ga0209236_11182452 | 3300026298 | Grasslands Soil | MVAGAGSTGGILAVYIGKFRKFFRANRLGLFQKTKEK |
| Ga0209647_10503461 | 3300026319 | Grasslands Soil | MVAGAGSTGGILAVCIGKFRKVFRANRFGLFQKTKEK |
| Ga0257157_10277951 | 3300026496 | Soil | MAAGAGSTGGILAVCIGKFRKFFRANALGLFQKIKEK |
| Ga0209056_101810151 | 3300026538 | Soil | VMVAGAASTGGILAVFVGKFRKFFRANGVQKTKEK |
| Ga0207746_10160381 | 3300026865 | Tropical Forest Soil | ISNTAVMIAGAGSTGGILVAFIAKFRKFFTPTILGPFQKRKEK |
| Ga0207855_10448991 | 3300027039 | Tropical Forest Soil | MIAGAGSTGGILVAFIAKFRKFFTPTILGPFQKRKEK |
| Ga0208098_10206132 | 3300027172 | Forest Soil | MVAGAGSTGEILAVCIGKFRKVLRASVLGLFQKTKEK |
| Ga0207777_10238592 | 3300027330 | Tropical Forest Soil | GAASAGGILAVCIGKARRFFRANGLSLFWKASENQEK |
| Ga0209004_10623762 | 3300027376 | Forest Soil | MVAGAASTGGILAVCIGKFRKLFRAIGLGLFQKTKEN |
| Ga0208995_10216551 | 3300027388 | Forest Soil | MVAGAGSTGGILVVCIGKFRKFFRPDRLGLFQKTKEK |
| Ga0208199_10309792 | 3300027497 | Peatlands Soil | MAAGAGSMGGILAVCIGKFRNFFRTNGLSHLQKIKEK |
| Ga0209735_10581161 | 3300027562 | Forest Soil | AGAGSTGGILAVCIGKFRKVFRANRLGLFQKAKEK |
| Ga0208827_11122282 | 3300027641 | Peatlands Soil | MAAGAGSMGGILAVCIGKFRNFFRTNGLCHLQKIKEK |
| Ga0209217_10711302 | 3300027651 | Forest Soil | MVAGAGSTGGILAVCIGKFRKVFRANRLGLFQKTKEK |
| Ga0209736_10041109 | 3300027660 | Forest Soil | MVAGAGSTGGILAVCIGKFRKVFRANRLGPFQKTKEK |
| Ga0209011_10150272 | 3300027678 | Forest Soil | MAAGAGSTGGILAVCISKFRKFFKANGLNLFQKTKEK |
| Ga0209446_10273092 | 3300027698 | Bog Forest Soil | MVAAAGSTGGILAVCIGKLRKIFANRLGLFWKTKEK |
| Ga0209248_101565942 | 3300027729 | Bog Forest Soil | MAAGAGTTGGILAVYIGKFRKFFRANDPGLFQKIKEK |
| Ga0209448_102572472 | 3300027783 | Bog Forest Soil | MVAAAGSTGGILAVCIGKLRNIFANRLGLFCKTKEK |
| Ga0209773_103154682 | 3300027829 | Bog Forest Soil | AVMVAGAGSTGGILAVYIGKFVNYFRANRPGLFEKAKEQ |
| Ga0209693_101550853 | 3300027855 | Soil | MAAGAGSTGGILAVYIGKFRKFFRANGLGLLQKIKEK |
| Ga0209701_100181779 | 3300027862 | Vadose Zone Soil | MVAGAGSAGGILAVCIGKFRKFFRANRLGLFQKTKEK |
| Ga0209488_107748362 | 3300027903 | Vadose Zone Soil | MVAGAASTGGILAACIGKFREFFKASGLSLFQGRKEK |
| Ga0209006_109267552 | 3300027908 | Forest Soil | MLAGAGSTGGILALCIGKFRNLFRANNIGLLQNEKEK |
| Ga0209382_104520472 | 3300027909 | Populus Rhizosphere | MVAGAGFTGGILAVYIGRFRKFFRARRLGLFQKTKEK |
| Ga0209382_104566263 | 3300027909 | Populus Rhizosphere | MVAVAGSTGGILAMCIGKFRRFFRANRLGLFQKTKEK |
| Ga0209698_100603022 | 3300027911 | Watersheds | MAAGAGSTGGILAVCIGKLRKFFKASGLSLFQKIKEK |
| Ga0137415_105947401 | 3300028536 | Vadose Zone Soil | MIAGAGSTGGILAVCIGKFRTFFRANRLGLFQKTTEK |
| Ga0302233_102183832 | 3300028746 | Palsa | MAAGVASTGGILAVCIGKFRKFLRANGLGLFQKIKEK |
| Ga0302224_100777661 | 3300028759 | Palsa | AGVASTGGILAVCIGKFRKFLRANGLGLFQKIKEK |
| Ga0302266_102532821 | 3300028779 | Bog | AGAGSTGGVLAVCIGKLKKFVTANRICLFPKTKQD |
| Ga0308309_106159603 | 3300028906 | Soil | MAAGAGSTGGVLAVCIGKFKKAFQDGLGLFHKIKEK |
| Ga0308309_108088322 | 3300028906 | Soil | MMAAGAGSTGGILAVCISKFRSFFRANGLDLFQKIKEK |
| Ga0311359_100289984 | 3300029914 | Bog | MVAGAGSTGGVLAVCIGKLKRFFTVNRPGLLQKTKER |
| Ga0311371_116776042 | 3300029951 | Palsa | MAAGAGSTGGILAVCIGKFRKVFRANGLGLFLKIKEK |
| Ga0311338_100975917 | 3300030007 | Palsa | AIVAGAGSAGGILAVCIGKFKDLFTANRLSRFQKVQEK |
| Ga0302281_102762672 | 3300030044 | Fen | AAMAAGAGSTGGVLAVCIGKLRNFFRANRLGLDQKAKEK |
| Ga0311372_125329222 | 3300030520 | Palsa | SAVVVAAGVGSSGGILAVYIGKFTKFLRANRLGLFQNAEEK |
| Ga0311356_104871453 | 3300030617 | Palsa | IATTAILVTGTGSAGGFLAVCITRFRKFFRANRFGQFQNAKEI |
| Ga0265461_120792431 | 3300030743 | Soil | AGAGSTGGILAVCIGKFRKVFKVNRFSLFQKTKEK |
| Ga0265762_10547642 | 3300030760 | Soil | ALMVAGVGSAGGVLAVCIGKFRSFFRASGLGLFQKTKEK |
| Ga0265746_10624761 | 3300030815 | Soil | VMAAGAGSTGGILAVCIGKFKKVFRANGLGLFLKITEK |
| Ga0265753_10084132 | 3300030862 | Soil | MVAGAGSTGGFLAVCIAKFRKFFRANRLGQFQKAQEK |
| Ga0265773_10162761 | 3300031018 | Soil | AVMVAGAGSTGGFLAVCIAKFRKFFRANRLGQFQKAQEK |
| Ga0302308_100253161 | 3300031027 | Palsa | AGAGSTGGILAACIGKFRKLFRENHFGLSQQTNEK |
| Ga0302180_102412072 | 3300031028 | Palsa | MVAGAGSTGGILAMCMDKFRDLFRAKSAGLFQTTKEK |
| Ga0170834_1131338322 | 3300031057 | Forest Soil | MAAGAGSTGGILAVCIGKFREFFRANGLGLFQKVKEK |
| Ga0265760_101105652 | 3300031090 | Soil | VAGAGSTGGILAVCIGKFRKVFIANRLGLFKETKEKQDGNK |
| Ga0265760_102326822 | 3300031090 | Soil | MVAGAGSTGGFLAVCITKFRKFFRSNRLGQFQKAQEY |
| Ga0170822_158240562 | 3300031122 | Forest Soil | MVAGAGSTGGILAVCIGKFRNFFKTNRLGLFQKGKEK |
| Ga0265316_109842212 | 3300031344 | Rhizosphere | IANAAEMAAGAGSTGGVLAECIGKLKKFFTTNRRGQFQQTKEN |
| Ga0302326_128071603 | 3300031525 | Palsa | VMVAGAGSTGGILAVCIGSSEKFSVANRLGLFQKTKEK |
| Ga0310686_1002633392 | 3300031708 | Soil | MAAGAGSTGGILAVCIGKFRNFFRAIGLGLFQKIEEK |
| Ga0307476_111882371 | 3300031715 | Hardwood Forest Soil | AAGAGSTGGVLAVCIGKLRKFVRANRLGLFQKIKEK |
| Ga0310813_103679152 | 3300031716 | Soil | MAAGAGSTGGILAVYIGKFKKVFRANGLGLFHKIKEK |
| Ga0307469_112389932 | 3300031720 | Hardwood Forest Soil | MAAGAGSTGGVLTVCIGKFRRFFRDGLGLFHKIKEK |
| Ga0307477_110163971 | 3300031753 | Hardwood Forest Soil | MVAGAGSTGGVLAVCIGKFREFVRANRLGRIQKAKEK |
| Ga0307475_100429343 | 3300031754 | Hardwood Forest Soil | AMAAGAGSTGGILAVCIGKFKKFFKANGLGLFQKIKEK |
| Ga0307475_103445342 | 3300031754 | Hardwood Forest Soil | MAAGAGSTGGILAVYIGKFRRFFRDGLGLFHKIKEK |
| Ga0307475_109944682 | 3300031754 | Hardwood Forest Soil | MAAGAGSTGGILAVCVGKFKKLFKANGLGLFQKIKEKEKET |
| Ga0307478_105361332 | 3300031823 | Hardwood Forest Soil | MVAGAGSTGGILALCIGKLRKLFRANRFDLVKKTKEKQYGNK |
| Ga0306923_124729721 | 3300031910 | Soil | MVAGAGSMGGVLALYIGKVRKLFRASSLGLFKKTKEK |
| Ga0307479_101935103 | 3300031962 | Hardwood Forest Soil | MAAGAGSTGGILAVYIGKFRRFFRASGLGLFQKIKEK |
| Ga0318525_105934612 | 3300032089 | Soil | MVTAAGSTGGILAVYIGKFRTFFGANRLDLLHNTKEK |
| Ga0311301_107225822 | 3300032160 | Peatlands Soil | MMAAGAGSTGGILAVCISKFRKFFKASGLGLFQKIKEK |
| Ga0307470_106461742 | 3300032174 | Hardwood Forest Soil | MRRKRSSLMAAGAGSTGGILAVCIGKFRKFFRANGLGLFQKIKEK |
| Ga0307470_113241292 | 3300032174 | Hardwood Forest Soil | MAAGAGSTGGILAVCIGKFRKFFRAISLGPFQKIKEK |
| Ga0307471_1004204642 | 3300032180 | Hardwood Forest Soil | EMAAVAGSTGGILAVCIDKFRKLFRANGLGLFQKIKEK |
| Ga0306920_1036827921 | 3300032261 | Soil | MVAGAGSAGGILAVCIGKFGKFFRASGLGLFQNRKEK |
| Ga0335079_100112584 | 3300032783 | Soil | MVAGAGSTGGILAVCIGRFRKFLRTSGVGLFQKTKEK |
| Ga0335081_100411968 | 3300032892 | Soil | MVAAAGSTGGILAVCIGRFRNFFRATGLGLFHKAKEK |
| Ga0316212_10231402 | 3300033547 | Roots | MAAGAGSTGGILAVCIGKFKKVFRANGLGLFLKITEK |
| Ga0370515_0227617_82_195 | 3300034163 | Untreated Peat Soil | MIAGAGSTGGILAVCIGSSEKFSVANRLGLFQKTKEK |
| ⦗Top⦘ |