| Basic Information | |
|---|---|
| Family ID | F019960 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 226 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 226 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 13.72 % |
| % of genes near scaffold ends (potentially truncated) | 28.76 % |
| % of genes from short scaffolds (< 2000 bps) | 52.65 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (63.274 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (28.761 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.442 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.637 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 61.54% β-sheet: 0.00% Coil/Unstructured: 38.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 226 Family Scaffolds |
|---|---|---|
| PF10721 | DUF2514 | 6.64 |
| PF00959 | Phage_lysozyme | 5.75 |
| PF00182 | Glyco_hydro_19 | 5.31 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.10 |
| PF13884 | Peptidase_S74 | 2.21 |
| PF13385 | Laminin_G_3 | 1.77 |
| PF16778 | Phage_tail_APC | 1.77 |
| PF07460 | NUMOD3 | 1.33 |
| PF03837 | RecT | 1.33 |
| PF10124 | Mu-like_gpT | 1.33 |
| PF00476 | DNA_pol_A | 0.88 |
| PF16080 | Phage_holin_2_3 | 0.88 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.88 |
| PF10926 | DUF2800 | 0.88 |
| PF11651 | P22_CoatProtein | 0.44 |
| PF03592 | Terminase_2 | 0.44 |
| PF09588 | YqaJ | 0.44 |
| PF08241 | Methyltransf_11 | 0.44 |
| PF13469 | Sulfotransfer_3 | 0.44 |
| PF00166 | Cpn10 | 0.44 |
| PF04404 | ERF | 0.44 |
| PF01381 | HTH_3 | 0.44 |
| PF03796 | DnaB_C | 0.44 |
| PF00436 | SSB | 0.44 |
| PF06067 | DUF932 | 0.44 |
| PF13361 | UvrD_C | 0.44 |
| PF06048 | DUF927 | 0.44 |
| PF02839 | CBM_5_12 | 0.44 |
| PF05135 | Phage_connect_1 | 0.44 |
| PF13704 | Glyco_tranf_2_4 | 0.44 |
| PF03906 | Phage_T7_tail | 0.44 |
| PF00271 | Helicase_C | 0.44 |
| PF00386 | C1q | 0.44 |
| PF13489 | Methyltransf_23 | 0.44 |
| PF01242 | PTPS | 0.44 |
| PF13392 | HNH_3 | 0.44 |
| PF04851 | ResIII | 0.44 |
| PF07484 | Collar | 0.44 |
| PF07603 | DUF1566 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 226 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 5.31 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 5.31 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 1.33 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.88 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.44 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.44 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.44 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.44 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.44 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.44 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.63 % |
| Unclassified | root | N/A | 16.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100003436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29646 | Open in IMG/M |
| 3300005525|Ga0068877_10026396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4030 | Open in IMG/M |
| 3300005525|Ga0068877_10508487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 665 | Open in IMG/M |
| 3300005525|Ga0068877_10517369 | Not Available | 658 | Open in IMG/M |
| 3300005527|Ga0068876_10358707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300005581|Ga0049081_10025115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2260 | Open in IMG/M |
| 3300005805|Ga0079957_1004923 | Not Available | 10991 | Open in IMG/M |
| 3300005805|Ga0079957_1100807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1574 | Open in IMG/M |
| 3300006875|Ga0075473_10143035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300007735|Ga0104988_10719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24396 | Open in IMG/M |
| 3300007974|Ga0105747_1036928 | All Organisms → Viruses → Predicted Viral | 1403 | Open in IMG/M |
| 3300008107|Ga0114340_1000293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35093 | Open in IMG/M |
| 3300008107|Ga0114340_1001176 | Not Available | 20414 | Open in IMG/M |
| 3300008107|Ga0114340_1002519 | Not Available | 23488 | Open in IMG/M |
| 3300008107|Ga0114340_1006291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8214 | Open in IMG/M |
| 3300008107|Ga0114340_1044338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1974 | Open in IMG/M |
| 3300008107|Ga0114340_1071840 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
| 3300008107|Ga0114340_1074804 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
| 3300008107|Ga0114340_1184499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300008107|Ga0114340_1189282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300008107|Ga0114340_1191631 | Not Available | 699 | Open in IMG/M |
| 3300008110|Ga0114343_1030475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2258 | Open in IMG/M |
| 3300008110|Ga0114343_1089656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300008110|Ga0114343_1141709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300008110|Ga0114343_1169792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1216 | Open in IMG/M |
| 3300008113|Ga0114346_1000377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 47249 | Open in IMG/M |
| 3300008113|Ga0114346_1001620 | Not Available | 15642 | Open in IMG/M |
| 3300008113|Ga0114346_1046509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2187 | Open in IMG/M |
| 3300008113|Ga0114346_1087115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
| 3300008113|Ga0114346_1225239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300008114|Ga0114347_1001018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36881 | Open in IMG/M |
| 3300008114|Ga0114347_1081440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1294 | Open in IMG/M |
| 3300008114|Ga0114347_1126495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300008116|Ga0114350_1000645 | Not Available | 27269 | Open in IMG/M |
| 3300008116|Ga0114350_1008137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4891 | Open in IMG/M |
| 3300008116|Ga0114350_1010469 | Not Available | 7990 | Open in IMG/M |
| 3300008116|Ga0114350_1013043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4442 | Open in IMG/M |
| 3300008116|Ga0114350_1013194 | Not Available | 8540 | Open in IMG/M |
| 3300008116|Ga0114350_1026922 | All Organisms → Viruses → Predicted Viral | 2312 | Open in IMG/M |
| 3300008116|Ga0114350_1046728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1600 | Open in IMG/M |
| 3300008116|Ga0114350_1060145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2366 | Open in IMG/M |
| 3300008117|Ga0114351_1008131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7590 | Open in IMG/M |
| 3300008120|Ga0114355_1002231 | Not Available | 22279 | Open in IMG/M |
| 3300008120|Ga0114355_1089356 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
| 3300008120|Ga0114355_1089542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300008120|Ga0114355_1093302 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300008120|Ga0114355_1107682 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300008120|Ga0114355_1109264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300008120|Ga0114355_1125380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300008120|Ga0114355_1136933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300008122|Ga0114359_1262343 | Not Available | 606 | Open in IMG/M |
| 3300008259|Ga0114841_1003509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32055 | Open in IMG/M |
| 3300008263|Ga0114349_1024938 | Not Available | 3007 | Open in IMG/M |
| 3300008263|Ga0114349_1174811 | Not Available | 816 | Open in IMG/M |
| 3300008264|Ga0114353_1219040 | Not Available | 878 | Open in IMG/M |
| 3300008266|Ga0114363_1000217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37328 | Open in IMG/M |
| 3300008266|Ga0114363_1001913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13755 | Open in IMG/M |
| 3300008266|Ga0114363_1013527 | All Organisms → Viruses → Predicted Viral | 3763 | Open in IMG/M |
| 3300008266|Ga0114363_1019135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3045 | Open in IMG/M |
| 3300008266|Ga0114363_1024167 | All Organisms → Viruses → Predicted Viral | 2639 | Open in IMG/M |
| 3300008266|Ga0114363_1026645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2482 | Open in IMG/M |
| 3300008266|Ga0114363_1027249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2448 | Open in IMG/M |
| 3300008266|Ga0114363_1030420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2285 | Open in IMG/M |
| 3300008266|Ga0114363_1060162 | All Organisms → Viruses | 4013 | Open in IMG/M |
| 3300008266|Ga0114363_1064391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
| 3300008266|Ga0114363_1070128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
| 3300008266|Ga0114363_1078543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
| 3300008266|Ga0114363_1089140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
| 3300008266|Ga0114363_1098589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
| 3300008266|Ga0114363_1111935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300008266|Ga0114363_1135402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300008266|Ga0114363_1144691 | Not Available | 795 | Open in IMG/M |
| 3300008266|Ga0114363_1149585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300008266|Ga0114363_1162295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300008266|Ga0114363_1186664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300008266|Ga0114363_1203264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300008448|Ga0114876_1024367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3068 | Open in IMG/M |
| 3300008448|Ga0114876_1095874 | Not Available | 1195 | Open in IMG/M |
| 3300008448|Ga0114876_1136677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300008450|Ga0114880_1003400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8747 | Open in IMG/M |
| 3300008450|Ga0114880_1039465 | All Organisms → Viruses → Predicted Viral | 2059 | Open in IMG/M |
| 3300009081|Ga0105098_10039538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1885 | Open in IMG/M |
| 3300009085|Ga0105103_10110381 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300009165|Ga0105102_10136740 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300009168|Ga0105104_10171249 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300010354|Ga0129333_10000052 | Not Available | 65464 | Open in IMG/M |
| 3300010354|Ga0129333_10002545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17038 | Open in IMG/M |
| 3300010354|Ga0129333_10003319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15062 | Open in IMG/M |
| 3300010354|Ga0129333_10003429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14849 | Open in IMG/M |
| 3300010354|Ga0129333_10014135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7588 | Open in IMG/M |
| 3300010354|Ga0129333_10021865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6073 | Open in IMG/M |
| 3300010354|Ga0129333_10034849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4751 | Open in IMG/M |
| 3300010354|Ga0129333_10182099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1916 | Open in IMG/M |
| 3300010354|Ga0129333_10878673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300010354|Ga0129333_11732848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300010370|Ga0129336_10103853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1664 | Open in IMG/M |
| 3300010370|Ga0129336_10278850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300010370|Ga0129336_10402422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300011113|Ga0151517_1074 | Not Available | 41018 | Open in IMG/M |
| 3300011116|Ga0151516_10040 | Not Available | 63669 | Open in IMG/M |
| 3300012012|Ga0153799_1015694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1582 | Open in IMG/M |
| 3300013004|Ga0164293_10000092 | Not Available | 57760 | Open in IMG/M |
| 3300013004|Ga0164293_10000454 | Not Available | 32470 | Open in IMG/M |
| 3300013004|Ga0164293_10117341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2020 | Open in IMG/M |
| 3300013004|Ga0164293_10367455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300013004|Ga0164293_10619303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300013004|Ga0164293_11067947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300013005|Ga0164292_10011897 | Not Available | 7131 | Open in IMG/M |
| 3300013005|Ga0164292_10088633 | All Organisms → Viruses → Predicted Viral | 2352 | Open in IMG/M |
| 3300013087|Ga0163212_1059879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1263 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10066381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2729 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10079204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2333 | Open in IMG/M |
| 3300013372|Ga0177922_11049072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300017707|Ga0181363_1015215 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300017747|Ga0181352_1008701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3316 | Open in IMG/M |
| 3300017747|Ga0181352_1026332 | All Organisms → Viruses → Predicted Viral | 1776 | Open in IMG/M |
| 3300017747|Ga0181352_1039412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1401 | Open in IMG/M |
| 3300017747|Ga0181352_1208514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300017766|Ga0181343_1050444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
| 3300017785|Ga0181355_1178191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300017788|Ga0169931_10371742 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
| 3300019784|Ga0181359_1002729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5217 | Open in IMG/M |
| 3300020159|Ga0211734_10704641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300020183|Ga0194115_10000877 | Not Available | 41244 | Open in IMG/M |
| 3300020190|Ga0194118_10037859 | All Organisms → Viruses → Predicted Viral | 3321 | Open in IMG/M |
| 3300020214|Ga0194132_10151726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
| 3300020221|Ga0194127_10365743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300020578|Ga0194129_10469166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300021093|Ga0194123_10069878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2165 | Open in IMG/M |
| 3300021424|Ga0194117_10034461 | All Organisms → Viruses → Predicted Viral | 3101 | Open in IMG/M |
| 3300021961|Ga0222714_10045303 | All Organisms → Viruses → Predicted Viral | 3103 | Open in IMG/M |
| 3300021961|Ga0222714_10060967 | All Organisms → Viruses → Predicted Viral | 2551 | Open in IMG/M |
| 3300021962|Ga0222713_10064153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2745 | Open in IMG/M |
| 3300021963|Ga0222712_10295171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
| 3300022179|Ga0181353_1000045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24678 | Open in IMG/M |
| 3300022179|Ga0181353_1005307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3026 | Open in IMG/M |
| 3300022179|Ga0181353_1025229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300022179|Ga0181353_1121764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300022190|Ga0181354_1065909 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300024354|Ga0255171_1000169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24103 | Open in IMG/M |
| 3300024481|Ga0256330_1100376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 611 | Open in IMG/M |
| 3300024495|Ga0255164_1030752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300024496|Ga0255151_1056806 | Not Available | 637 | Open in IMG/M |
| 3300024502|Ga0255181_1015748 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
| 3300025283|Ga0208048_1009815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3483 | Open in IMG/M |
| 3300025630|Ga0208004_1067374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
| 3300025889|Ga0208644_1116868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
| 3300026459|Ga0255170_1028643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300027396|Ga0255146_1000871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6824 | Open in IMG/M |
| 3300027467|Ga0255154_1000294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18433 | Open in IMG/M |
| 3300027793|Ga0209972_10003956 | Not Available | 11390 | Open in IMG/M |
| 3300027816|Ga0209990_10009002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6334 | Open in IMG/M |
| 3300027816|Ga0209990_10040653 | All Organisms → Viruses → Predicted Viral | 2425 | Open in IMG/M |
| 3300028025|Ga0247723_1071639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300029930|Ga0119944_1006510 | All Organisms → Viruses → Predicted Viral | 1853 | Open in IMG/M |
| 3300029932|Ga0119933_1023604 | Not Available | 827 | Open in IMG/M |
| 3300031758|Ga0315907_10001256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34708 | Open in IMG/M |
| 3300031758|Ga0315907_10001964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26866 | Open in IMG/M |
| 3300031758|Ga0315907_10106225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2404 | Open in IMG/M |
| 3300031758|Ga0315907_10183936 | Not Available | 1757 | Open in IMG/M |
| 3300031758|Ga0315907_10212251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1618 | Open in IMG/M |
| 3300031758|Ga0315907_10898779 | Not Available | 650 | Open in IMG/M |
| 3300031784|Ga0315899_10048951 | All Organisms → Viruses → Predicted Viral | 4425 | Open in IMG/M |
| 3300031787|Ga0315900_10219838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1657 | Open in IMG/M |
| 3300031787|Ga0315900_10847296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300031857|Ga0315909_10002447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23769 | Open in IMG/M |
| 3300031857|Ga0315909_10004875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15655 | Open in IMG/M |
| 3300031857|Ga0315909_10009862 | Not Available | 10268 | Open in IMG/M |
| 3300031857|Ga0315909_10010639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9808 | Open in IMG/M |
| 3300031857|Ga0315909_10012281 | All Organisms → cellular organisms → Bacteria | 8983 | Open in IMG/M |
| 3300031857|Ga0315909_10026765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5678 | Open in IMG/M |
| 3300031857|Ga0315909_10500079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300031857|Ga0315909_10522928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300031857|Ga0315909_10959534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300031951|Ga0315904_10032256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6083 | Open in IMG/M |
| 3300031951|Ga0315904_10156881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2296 | Open in IMG/M |
| 3300031951|Ga0315904_10400895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
| 3300031951|Ga0315904_10696358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300031963|Ga0315901_10172365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1904 | Open in IMG/M |
| 3300031963|Ga0315901_10515922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300031963|Ga0315901_10725853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300032050|Ga0315906_10005272 | Not Available | 16330 | Open in IMG/M |
| 3300032093|Ga0315902_10231373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
| 3300032093|Ga0315902_10630361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300032116|Ga0315903_10063631 | All Organisms → Viruses → Predicted Viral | 3678 | Open in IMG/M |
| 3300032116|Ga0315903_10171582 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
| 3300032116|Ga0315903_10487829 | Not Available | 977 | Open in IMG/M |
| 3300032116|Ga0315903_10609542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300032116|Ga0315903_10930611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300033979|Ga0334978_0000213 | Not Available | 37144 | Open in IMG/M |
| 3300033979|Ga0334978_0027033 | All Organisms → Viruses → Predicted Viral | 3018 | Open in IMG/M |
| 3300033981|Ga0334982_0000129 | Not Available | 43433 | Open in IMG/M |
| 3300033981|Ga0334982_0016055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4398 | Open in IMG/M |
| 3300033981|Ga0334982_0021547 | All Organisms → Viruses → Predicted Viral | 3748 | Open in IMG/M |
| 3300033981|Ga0334982_0053156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2233 | Open in IMG/M |
| 3300033981|Ga0334982_0167962 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300033981|Ga0334982_0186191 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
| 3300033981|Ga0334982_0248922 | Not Available | 855 | Open in IMG/M |
| 3300033994|Ga0334996_0076906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1997 | Open in IMG/M |
| 3300033994|Ga0334996_0179748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
| 3300034012|Ga0334986_0000421 | Not Available | 36962 | Open in IMG/M |
| 3300034012|Ga0334986_0001337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21419 | Open in IMG/M |
| 3300034012|Ga0334986_0002196 | Not Available | 16054 | Open in IMG/M |
| 3300034012|Ga0334986_0019388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4665 | Open in IMG/M |
| 3300034021|Ga0335004_0079611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2234 | Open in IMG/M |
| 3300034061|Ga0334987_0002248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18631 | Open in IMG/M |
| 3300034061|Ga0334987_0133674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1845 | Open in IMG/M |
| 3300034061|Ga0334987_0214647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300034073|Ga0310130_0006843 | All Organisms → Viruses → Predicted Viral | 4286 | Open in IMG/M |
| 3300034101|Ga0335027_0016691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6311 | Open in IMG/M |
| 3300034101|Ga0335027_0164326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1614 | Open in IMG/M |
| 3300034101|Ga0335027_0182845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1506 | Open in IMG/M |
| 3300034101|Ga0335027_0472793 | Not Available | 793 | Open in IMG/M |
| 3300034104|Ga0335031_0100306 | All Organisms → Viruses → Predicted Viral | 2042 | Open in IMG/M |
| 3300034106|Ga0335036_0000463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36594 | Open in IMG/M |
| 3300034106|Ga0335036_0001652 | All Organisms → cellular organisms → Bacteria | 19796 | Open in IMG/M |
| 3300034106|Ga0335036_0002074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17660 | Open in IMG/M |
| 3300034106|Ga0335036_0019390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5487 | Open in IMG/M |
| 3300034106|Ga0335036_0826751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300034109|Ga0335051_0306442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300034111|Ga0335063_0123245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1539 | Open in IMG/M |
| 3300034118|Ga0335053_0000486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29756 | Open in IMG/M |
| 3300034200|Ga0335065_0319751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
| 3300034200|Ga0335065_0442238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300034283|Ga0335007_0040466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3631 | Open in IMG/M |
| 3300034283|Ga0335007_0099279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2159 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 28.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 14.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.31% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.77% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.44% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.44% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.44% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.44% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.44% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.44% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.44% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.44% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029932 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_10000343618 | 3300002835 | Freshwater | MAVLLTFFIVMPILAFMYYDMYYAHQAAIIEIRKMKELRREILIERMYRD* |
| Ga0068877_100263961 | 3300005525 | Freshwater Lake | VLLMFFIIMPILAFMYYDMYFATQAAVAEVQKMKELRRDILQERMYGK* |
| Ga0068877_105084871 | 3300005525 | Freshwater Lake | TFFIVMPIIGFMLWDLHIATQAAVHEVRKMKELRRDILIERMYRD* |
| Ga0068877_105173691 | 3300005525 | Freshwater Lake | VVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRREIQTERMYGK* |
| Ga0068876_103587072 | 3300005527 | Freshwater Lake | MFFIVMPVLAFMYYDMYYATQAAVHEIKKMRELRKEIQIERMYDR* |
| Ga0049081_100251151 | 3300005581 | Freshwater Lentic | VMAVLLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR* |
| Ga0079957_10049232 | 3300005805 | Lake | LIVTVLAIILMFFIVMPILAFMYYDMYFATQAAVQEVRKMRELRREIQIERMYGQ* |
| Ga0079957_11008071 | 3300005805 | Lake | LLMFFIIMPILAFMYYDMYNATQAAIHEVRKMRELRKEIQIERMYGK* |
| Ga0075473_101430353 | 3300006875 | Aqueous | MAVLLTFFIVMPVVGFMLWDMHVVTQAAMHEVKKMKQLRREILEERMYGQ* |
| Ga0104988_107197 | 3300007735 | Freshwater | MAVLLMFFIIMPILGFMYYDLYYAHQAAIIEIKKMQQLRREILEERMYGR* |
| Ga0105747_10369282 | 3300007974 | Estuary Water | MAVLLTFFIVMPIIGFMLWDLHIATQAAVYEVRKMKELRRDILIERMYRD* |
| Ga0114340_100029352 | 3300008107 | Freshwater, Plankton | LIVVVLAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVKKMRELRREIQVERMYGQ* |
| Ga0114340_100117612 | 3300008107 | Freshwater, Plankton | MFFIVMPVLAFMYYDMYFATQAAVSEVKKMRELRKEIQIERMYGK* |
| Ga0114340_100251933 | 3300008107 | Freshwater, Plankton | LIVVVMAVVLMFFIVMPIMAFMYYDMYFATQAAVSEVKKMRELRKEIQIERMYGK* |
| Ga0114340_10062914 | 3300008107 | Freshwater, Plankton | MAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVKKMKQLRREILEERSTEPNRRY* |
| Ga0114340_10443383 | 3300008107 | Freshwater, Plankton | LIVTVLAVLLTFFIVMPVLGFMYVDLMNLREAMQIEIRKMKELRRDVLIERMYGQ* |
| Ga0114340_10718403 | 3300008107 | Freshwater, Plankton | LITVVMAVLLMFFIIMPVLAFMYYDMYYATQAAVTEVKKMKELRREILEERMYGR* |
| Ga0114340_10748043 | 3300008107 | Freshwater, Plankton | MFFIVMPVLAFMYYDMYYATQAAVSEVKKMKQLRREILEERMYGK* |
| Ga0114340_11844991 | 3300008107 | Freshwater, Plankton | ILAFMYYDMYYATQAAVHEVRKMRELRKEIQLERMYDR* |
| Ga0114340_11892822 | 3300008107 | Freshwater, Plankton | MAVLLCFFIVMPIIGYMLYDLHFATQAAVHEVKKMRQLRREILEERMYKQ* |
| Ga0114340_11916311 | 3300008107 | Freshwater, Plankton | FFIVMPIVGFMLWDAHVVTQAAMHEVKKMKQLRREILEERMYGR* |
| Ga0114343_10304754 | 3300008110 | Freshwater, Plankton | VMAVLLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQLERMYDR* |
| Ga0114343_10896562 | 3300008110 | Freshwater, Plankton | MAVLLTFFIVMPIVGFMLWDAHVVTQAAMHEVKKMKQLRREILEERMYGR* |
| Ga0114343_11417092 | 3300008110 | Freshwater, Plankton | LITVVMAVLLMFFIIMPVLAFMYYDMYFATQAAVTEIKKMKELRREILEERMYGR* |
| Ga0114343_11697923 | 3300008110 | Freshwater, Plankton | IVVVMAVLLMFFIVMPILAFMYYDMYFATQAAVHEVKKMRELRKEILIERMYDR* |
| Ga0114346_100037720 | 3300008113 | Freshwater, Plankton | MAVLLMFFIIMPILAFMYYDMYYATQAAVTEVKKMRELRKEILIERMYGQ* |
| Ga0114346_100162018 | 3300008113 | Freshwater, Plankton | MAVLLCFFIVMPIMAFMYWDMYNATEAAVVEIKKMKQLRHEIQIERMYGQ* |
| Ga0114346_10465093 | 3300008113 | Freshwater, Plankton | MAVLLTFFIVMPILAFMYYDMYVATQAAVQEVKKMRELRREIQVERMYGR* |
| Ga0114346_10871152 | 3300008113 | Freshwater, Plankton | MAVLLCFFIVMPVMAFMYWDMYNATQAAVAEVKRMKQLRREIQIERMYGQ* |
| Ga0114346_12252392 | 3300008113 | Freshwater, Plankton | LIVVVMAVLLMFFVIMPILAFMYYDMYYATQAAVQEVKKMKELRREILEERLYGR* |
| Ga0114347_100101846 | 3300008114 | Freshwater, Plankton | LITVVLAVILMFFIVMPVLAFMYYDMYYATQAAVIEVRKMKELRKEIQIERMYSK* |
| Ga0114347_10814403 | 3300008114 | Freshwater, Plankton | MAVLLTFFIVMPILAFMYYDMYVATQAAVQEVRKMRELRREIQVERMYGR* |
| Ga0114347_11264951 | 3300008114 | Freshwater, Plankton | LITVMAVLLTFFIVMPIIGFMLWDMHIATQAAVHEVRKMKELRRDILIERMYRD* |
| Ga0114350_100064532 | 3300008116 | Freshwater, Plankton | MAVLLTFFIVMPVLAFMYYDMYFATQAAVQEVRKMKELRREILEERLYGK* |
| Ga0114350_10081377 | 3300008116 | Freshwater, Plankton | MAVLLTFFIVMPIIGYMILDVHFATQAAVHEVKKMRQLRKEILEERLYGK* |
| Ga0114350_10104692 | 3300008116 | Freshwater, Plankton | LIVVVLAVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMKELRKEIQIERMYDR* |
| Ga0114350_10130435 | 3300008116 | Freshwater, Plankton | MFFIVMPVLAFMYYDMYFATQAAVHEVKKMRELRKEIQIERMYGQ* |
| Ga0114350_10131947 | 3300008116 | Freshwater, Plankton | MAVLLCFFIVMPIIGYMLYDLHFATQAAVYEVKKMKQLRREILEERNLYRGN* |
| Ga0114350_10269222 | 3300008116 | Freshwater, Plankton | LIVVVMSVILMFFIVMPVLAFMYYDMYYATQAAVHEVKRMKQLRQEIQEERQYYRGN* |
| Ga0114350_10467283 | 3300008116 | Freshwater, Plankton | LIVVVLTVVLMFFIIMPILAFMYYDMYFATEAAVQEVRKMRELRREIQVERMYGK* |
| Ga0114350_10601453 | 3300008116 | Freshwater, Plankton | MAVLLMFFIIMPILAFMYYDMYFATQAAVTEVRKMRELRKEIQIERMYGK* |
| Ga0114351_10081312 | 3300008117 | Freshwater, Plankton | VLAVVLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEILIERMYDR* |
| Ga0114355_100223117 | 3300008120 | Freshwater, Plankton | VLAVLLTFFIALPLMAFMYWDMYNATEAAVAEVKRMKQLRREIQIERMYGQ* |
| Ga0114355_10893562 | 3300008120 | Freshwater, Plankton | MVVLLMFFIVMPLLAFMYHDMFYATRAAMYEVRKMKELRREIQIERLNRD* |
| Ga0114355_10895423 | 3300008120 | Freshwater, Plankton | MAVLLTFFIVMPIIGFMIYDMHYATQAAVYEAKKMRQLRKEILEERLYGK* |
| Ga0114355_10933022 | 3300008120 | Freshwater, Plankton | MFFIIMPVLAFMYYDMYYAHQAAIIEIRKMKELRREILIERMYRD* |
| Ga0114355_11076822 | 3300008120 | Freshwater, Plankton | LIVVVLTVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEILIERMYDK* |
| Ga0114355_11092642 | 3300008120 | Freshwater, Plankton | MAVLLCFFIVMPIMAFMYWDMYNATEAAVTEVRKMKQLRREIQIERMYGQ* |
| Ga0114355_11253802 | 3300008120 | Freshwater, Plankton | MALLLTFFIVMPILGVMYYDMFIVHQAAVHEVKKMKQLRREILEERMYGK* |
| Ga0114355_11369332 | 3300008120 | Freshwater, Plankton | VLAVLLTFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ* |
| Ga0114359_12623431 | 3300008122 | Freshwater, Plankton | TFFIVMPILGVMYYDMFIVHQAAVHEVKKMKQLRREILEERNLYRGN* |
| Ga0114841_100350924 | 3300008259 | Freshwater, Plankton | MFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ* |
| Ga0114349_10249381 | 3300008263 | Freshwater, Plankton | MAVLLCFFIVMPIIGYMLYDLHFATQAAVYEVKKMKQLRREILEE |
| Ga0114349_11748112 | 3300008263 | Freshwater, Plankton | LITVVLAVILMFFIVMPVLAFMYYDMYYATQAAVSEVKKMKQLRREILEERMYGK* |
| Ga0114353_12190402 | 3300008264 | Freshwater, Plankton | MFFIVMPVLAFMYYDMYYATQAAVSEVKKMKQLRREILEE |
| Ga0114363_100021716 | 3300008266 | Freshwater, Plankton | MFFIIMPILAFMYYDMYFATQAAVAEVQKMKELRRDILQERMYGK* |
| Ga0114363_10019134 | 3300008266 | Freshwater, Plankton | VLAVLLTFFIVMPVLAFMYYDMYFATQAAVQEVKKMKELRREILEERLYGR* |
| Ga0114363_10135273 | 3300008266 | Freshwater, Plankton | VLAVLLMFFIVMPILAFMYYDMYYATQAAVHEVKKMRELRREIQVERMYGQ* |
| Ga0114363_10191352 | 3300008266 | Freshwater, Plankton | MAVVLTFFIVMPLLAFMYYDMWFATQAAVHEVKKMKDLRRQILEERRQETIRSE* |
| Ga0114363_10241675 | 3300008266 | Freshwater, Plankton | MAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR* |
| Ga0114363_10266453 | 3300008266 | Freshwater, Plankton | MAVLLTFFIVMPVLAFMYYDMYTATQAAVVEVKKMKQLRREILEERLYGK* |
| Ga0114363_10272492 | 3300008266 | Freshwater, Plankton | MAVLLCFFIVMPILGFMYFDLWYLKQAATVEIKKMKELRRDILTERMYRND* |
| Ga0114363_10304203 | 3300008266 | Freshwater, Plankton | LAVLLTFFIVMPVLAFMYYDMYNATQAAVSEVKKMKQLRREILEERMYGR* |
| Ga0114363_10601628 | 3300008266 | Freshwater, Plankton | MALLLTFFIVMPILGVMYYDMFIVHQAAVHEVKKMKQLRREILEERNLYRGN* |
| Ga0114363_10643911 | 3300008266 | Freshwater, Plankton | LIVVVMAVLLMFFIVMPILAFMYYDMYFATQAAVHEVKKMRELRKEILIERMYDR* |
| Ga0114363_10701282 | 3300008266 | Freshwater, Plankton | MVVLLMFFIVMPVLAFMYHDMYYATQAAVHEVRKMKELRREIQIERLYRD* |
| Ga0114363_10785432 | 3300008266 | Freshwater, Plankton | MAVLLTFFIVMPVLAFMYYDMYVATQAAVAEVRKMKELRREILEERLYGK* |
| Ga0114363_10891402 | 3300008266 | Freshwater, Plankton | MAVLLTFFIVMPVLAFMYYDMYVATQAAVVEVKKMKQLRREILEERMYGR* |
| Ga0114363_10985892 | 3300008266 | Freshwater, Plankton | LIVVVMAVLLMFFIIMPILAFMYYDMYFATQAAVTEVRKMRELRKEIQIERMYGK* |
| Ga0114363_11119353 | 3300008266 | Freshwater, Plankton | MAVILMFFIVMPVLAFMYYDMVMATNAAVHEVKKMQQLRREILEERMYGR* |
| Ga0114363_11354022 | 3300008266 | Freshwater, Plankton | MAVVLMFFIVMPLLAFMYYDMWFATQAAVHEVKKMKQLRREILEERRQETIRSE* |
| Ga0114363_11446912 | 3300008266 | Freshwater, Plankton | IPWTLLITVMAVLLTFFIVMPILAFMYYDMYYAHQAAIIEIRKMKELRREILIERMYRD* |
| Ga0114363_11495852 | 3300008266 | Freshwater, Plankton | VLAVLLTFFIALPLMAFMYWDMYNATEAAVQEVKRMKQLRREIQIERMYGQ* |
| Ga0114363_11622951 | 3300008266 | Freshwater, Plankton | VVVLAVVLMFFIVMPLLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR* |
| Ga0114363_11866642 | 3300008266 | Freshwater, Plankton | MFFIVMPIMAFMYYDMYFATQAAITEVRKMRELRKEIQVERMYGK* |
| Ga0114363_12032642 | 3300008266 | Freshwater, Plankton | VLAVLLTFFIVMPILAFMYYDMYYATQAAIHEVKKMRELRRE |
| Ga0114876_10243675 | 3300008448 | Freshwater Lake | LIATVLGLLLMFFIIMPILAFMYYDMYNATQAAIHEVRKMRELRKEILIERMYGQ* |
| Ga0114876_10958742 | 3300008448 | Freshwater Lake | MAVILMFFIVMPILAFMYYDMYYATQAAIHEVKKMRELRKEIQIERMYDR* |
| Ga0114876_11366771 | 3300008448 | Freshwater Lake | MAVLLTFFIVMPLLAFMYYDMFYAHQAAIIEIRKMKELRREILIERMYRD* |
| Ga0114880_100340010 | 3300008450 | Freshwater Lake | VVLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMKELRKEIQIERMYGQ* |
| Ga0114880_10394652 | 3300008450 | Freshwater Lake | LITVVMAVLLMFFIIMPVLAFMYYDMYFATQAAVTEVKKMKELRREILEERMYGR* |
| Ga0105098_100395382 | 3300009081 | Freshwater Sediment | MAVLLTFFIVMPVLAFMYYDMYYATQAAVTEVKKMKQLRREIQEERLYGR* |
| Ga0105103_101103812 | 3300009085 | Freshwater Sediment | MAVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRREIQVERMYDR* |
| Ga0105102_101367402 | 3300009165 | Freshwater Sediment | LITVVLAVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEILIERMYDK* |
| Ga0105104_101712492 | 3300009168 | Freshwater Sediment | LITVVLAVVLMFFIVMPILAFMYYDMYFATQEAVHEVRKMREIRREIQVERMYDR* |
| Ga0129333_1000005256 | 3300010354 | Freshwater To Marine Saline Gradient | VVLAVLLTFFIVMPVLAFMYYDMYYATQAAVQEVKKMRELRKEIQIERMYGK* |
| Ga0129333_1000254521 | 3300010354 | Freshwater To Marine Saline Gradient | LIVVVLAVLLTFFIVMPVLAFMYYDMYFATQAAVQEVKKMKELRREILEERLYGR* |
| Ga0129333_1000331911 | 3300010354 | Freshwater To Marine Saline Gradient | MAVLLTFFIVMPVLAFMYYDMYFATQAAVHEVKKMRELRKEILEERMYGK* |
| Ga0129333_1000342910 | 3300010354 | Freshwater To Marine Saline Gradient | MFFIVMPVLAFMYYDMYFATQAAVVEVKKMRELRKEIQIERMYGK* |
| Ga0129333_1001413514 | 3300010354 | Freshwater To Marine Saline Gradient | MAVLLTFFIALPIMAFMYWDMYNATQAAVVEVKRMKQLRREIQIERMYGQ* |
| Ga0129333_100218654 | 3300010354 | Freshwater To Marine Saline Gradient | LIVTVMAVLLMFFIIMPVLAVMYHDMYFATQAAVHEVKKMKQLRREILEERSTEPNRRY* |
| Ga0129333_100348495 | 3300010354 | Freshwater To Marine Saline Gradient | MAVLLTFFIVMPIIGFMLYDLHYATQAAVYEAKKMRQLRKEILEERLYGK* |
| Ga0129333_101820994 | 3300010354 | Freshwater To Marine Saline Gradient | MAVVLMFFIVMPVLAFMYYDMWFATQAAVHEVKKMKDLRRQIQEERRQETIRSE* |
| Ga0129333_108786732 | 3300010354 | Freshwater To Marine Saline Gradient | VLAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ* |
| Ga0129333_117328482 | 3300010354 | Freshwater To Marine Saline Gradient | VLAVLLTFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGK* |
| Ga0129336_101038531 | 3300010370 | Freshwater To Marine Saline Gradient | MPILAFMYYDMYVATQAAVQEVRKMRELRREIQVERMYGR* |
| Ga0129336_102788502 | 3300010370 | Freshwater To Marine Saline Gradient | IIMPILAFMYYDMYNATQAAIHEVRKMRELRKEILIERMYGQ* |
| Ga0129336_104024222 | 3300010370 | Freshwater To Marine Saline Gradient | MAVILMFFIIMPVLAFMYYDMVMATNAAVHEVKKMQQLRREILEERMYGR* |
| Ga0151517_107432 | 3300011113 | Freshwater | MTVLLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGK* |
| Ga0151516_100403 | 3300011116 | Freshwater | MTVLLMFFIIMPILAFMYYDMYYATQAAIHEVRKMRELRKEIQIERMYDR* |
| Ga0153799_10156942 | 3300012012 | Freshwater | LAVLLTFFIVMPVLAFMYYDMYNATQAAVSEVKKMKELRREILEERMYGR* |
| Ga0164293_1000009226 | 3300013004 | Freshwater | LIVVVLAVLLMFFIVMPVLAFMYYDMYFATQAAVTEVKKMKELRREILEERLYGR* |
| Ga0164293_100004542 | 3300013004 | Freshwater | MAVVLMFFIVMPILAFMYYDMWFATQAAVHEVRKMRELRREIQSERMYGK* |
| Ga0164293_101173412 | 3300013004 | Freshwater | LIVVVLTVVLMFFIVMPILAFMYYDMYFATQAAVHEVRKMRELRKEIQIERMYDK* |
| Ga0164293_103674551 | 3300013004 | Freshwater | MAVLLTFFVVMPVLAFMYYDMYYATQAAMTEVKKMKQLRREIQ |
| Ga0164293_106193032 | 3300013004 | Freshwater | MAVLLCFFIVMPIIGFMLYDLHYATQAAVYEAKKMRQLRKEILEERLYGK* |
| Ga0164293_110679471 | 3300013004 | Freshwater | LIVVVLAVVLMFFIVMPILAFMYYDMYFATQAAVHEIRKMTELWREIQVER |
| Ga0164292_100118971 | 3300013005 | Freshwater | VPWSLIATVMAVVLMFFIVMPILAFMYYDMWFATQAAVHEVRKMRELRREIQSERMYGK* |
| Ga0164292_100886332 | 3300013005 | Freshwater | MAVLLTFFIVMPIIGFMLWDMHIATQAAVHEVRRMKELRRDILIERMYRD* |
| Ga0163212_10598792 | 3300013087 | Freshwater | VVVLAVLLMFFIIMPVLAFMYYDMYYATQAAVHEIRKMRELRKEIQIERMYGN* |
| (restricted) Ga0172367_100663812 | 3300013126 | Freshwater | VLAVLLMFFIVMPILAFMYYDMYYATQAAVTEVRKMRELRKEIQIERMLGN* |
| (restricted) Ga0172363_100792042 | 3300013130 | Sediment | VVVLAVLLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ* |
| Ga0177922_110490722 | 3300013372 | Freshwater | MAVLLTFFIVMPVVGFMLWDMHVVTQAAMHEVKKMKQLRREILQERMYGQ* |
| Ga0181363_10152154 | 3300017707 | Freshwater Lake | MAVLLTFFIVMPILAFMYYDMYYAHQAAIIEIRKMKELRREILIERMYRD |
| Ga0181352_10087011 | 3300017747 | Freshwater Lake | ITVVLAVILTFFIVMPILAFMYYDMYYATQAAVIEVRKMRELRKEIQIERMYSK |
| Ga0181352_10263325 | 3300017747 | Freshwater Lake | LAFMYYDMYYATQAAVHEVRKMRELRKEILIERMYDK |
| Ga0181352_10394122 | 3300017747 | Freshwater Lake | MAVLLTFFIVMPVVGFMLWDMHVITQAAMHEVKKMKQLRREIQEERMYGQ |
| Ga0181352_12085141 | 3300017747 | Freshwater Lake | IVGFMLWDLYVVKEAAIHEIRKMKELRKEILIERMYDK |
| Ga0181343_10504442 | 3300017766 | Freshwater Lake | MAVLLCFFIVMPIMAFMYWDMYNATEAAVVEIKKMKQLRHEIQIERMYGQ |
| Ga0181355_11781913 | 3300017785 | Freshwater Lake | MFFAVMPVLAFMYYDMYYATQAAVTEVKKMKQLRREIQEERLYGR |
| Ga0169931_103717422 | 3300017788 | Freshwater | MAVLLMFFIIMPVLAFMYYDMLTATNAAVIEVKKMQQLRREIQLERMYGQ |
| Ga0181359_10027294 | 3300019784 | Freshwater Lake | LIATVMAVVLMFFIVMPVLSFMYYDMWFATQAAVHEVKKMKELRRQILEERRQETIRSE |
| Ga0211734_107046413 | 3300020159 | Freshwater | TVMALLLTFFIVMPILGVMYYDMFIVHQAAVHEVKKMKQLRREILEERMYGK |
| Ga0194115_1000087754 | 3300020183 | Freshwater Lake | MAVLLTFFVLLPVMAFMYWDMYNATQAAVNEVRKMRELRREIQVERMYGQ |
| Ga0194118_100378593 | 3300020190 | Freshwater Lake | MAVLLMFFIIMPILAFMYYDMYYATQAAVTEVRKMRELRKEIQIERMYGQ |
| Ga0194132_101517261 | 3300020214 | Freshwater Lake | IVMPVLAFMYYDMYYATQAAIHEVKKMRELRLEILRERQYGN |
| Ga0194127_103657433 | 3300020221 | Freshwater Lake | FIVVVMAVLLMFFIIMPILAFMYYDMYYATQAAVTEVRKMRELRKEIQIERMYGQ |
| Ga0194129_104691662 | 3300020578 | Freshwater Lake | VLLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDK |
| Ga0194123_100698783 | 3300021093 | Freshwater Lake | MAVLLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDK |
| Ga0194117_100344611 | 3300021424 | Freshwater Lake | AFMYYDMYYATQAAVTEVRKMRELRKEIQIERMYGQ |
| Ga0222714_100453034 | 3300021961 | Estuarine Water | MAVLLMFFIIMPILGFMYYDLYYAHQAAIIEIKKMQQLRREILEERMYGR |
| Ga0222714_100609674 | 3300021961 | Estuarine Water | LIVVVMAVLLMFFIIMPILAFMYYDMYYATQAAVQEVKKMKELRRDILIERMYRD |
| Ga0222713_100641531 | 3300021962 | Estuarine Water | LIVVVLTVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0222712_102951711 | 3300021963 | Estuarine Water | LLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0181353_100004522 | 3300022179 | Freshwater Lake | MAVVLMFFIVMPVLSFMYYDMWFATQAAVHEVKKMKELRRQILEERRQETIRSE |
| Ga0181353_10053075 | 3300022179 | Freshwater Lake | MTVLLMFFIVMPVLAFMYHDMFYATRAAMYEVRKMKELRREIQIERLNRD |
| Ga0181353_10252295 | 3300022179 | Freshwater Lake | VLLTFFIVMPIIGFMLWDMHVATQAAVHEVRRMKELRRDILLERMYRD |
| Ga0181353_11217642 | 3300022179 | Freshwater Lake | LIVVVMAVLLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR |
| Ga0181354_10659092 | 3300022190 | Freshwater Lake | LITVVLAVILTFFIVMPILAFMYYDMYYATQAAVIEVRKMRELRKEIQIERMYSK |
| Ga0255171_10001699 | 3300024354 | Freshwater | VVVLAVLLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0256330_11003761 | 3300024481 | Freshwater | MPILAFMYYDMYYATQAAIHEVRKMRELRKEIQIERMYGQ |
| Ga0255164_10307523 | 3300024495 | Freshwater | VPWSLIVVVLAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0255151_10568061 | 3300024496 | Freshwater | LITVVMAVILMFFIVMPVLAFMYYDMYFATQAAVQEVKKMKELRREILEERMYGR |
| Ga0255181_10157484 | 3300024502 | Freshwater | FMYYDMYYATQAAIHEVRKMRELRKEIQIERMYGQ |
| Ga0208048_10098154 | 3300025283 | Freshwater | VVVLAVLLMFFIIMPVLAFMYYDMYYATQAAVHEIRKMRELRKEIQIERMYGN |
| Ga0208004_10673742 | 3300025630 | Aqueous | MAVLLTFFIVMPVVGFMLWDMHVITQAAMHEVKKMKQLRREILQERMYGQ |
| Ga0208644_11168684 | 3300025889 | Aqueous | FIVMPLLAFMYYDMWFTTQAAVHEVKKMKELRRQILEERRQETIRSE |
| Ga0255170_10286431 | 3300026459 | Freshwater | WSLIVVVLAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0255146_10008719 | 3300027396 | Freshwater | PWSLIVVVLAVLLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0255154_10002946 | 3300027467 | Freshwater | VLAVLLMFFIIMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0209972_1000395614 | 3300027793 | Freshwater Lake | MAVLLCFFIVMPIIGYMLYDLHFATQAAVYEVKKMKQLRREILEERNLYRGN |
| Ga0209990_100090021 | 3300027816 | Freshwater Lake | LIVTVMALLLTFFIVMPILGVMYYDMFIVHQAAVYEVKKMKQLRREILEERNLYRGN |
| Ga0209990_100406534 | 3300027816 | Freshwater Lake | MFFIIMPVLAFMYYDMYYAHQAAIIEIRKMKELRREILIERMYRD |
| Ga0247723_10716391 | 3300028025 | Deep Subsurface Sediment | LLTFFIVMPVLAFMYYDMYYATQAAVTEVKKMKQLRREILEERLYGR |
| Ga0119944_10065101 | 3300029930 | Aquatic | FIVMPVLAFMYYDMVMATNAAVHEVKKMQQLRREILEERMYGR |
| Ga0119933_10236041 | 3300029932 | Drinking Water Treatment Plant | ITVVMAVLLTFFIVMPILAFMYYDMVMATNAAVHEVRKMRELRKEILEERMYGK |
| Ga0315907_1000125641 | 3300031758 | Freshwater | LIVTVMALLLTFFIVMPILGVMYYDMFIVHQAAVHEVKKMKQLRREILEERNLYRGN |
| Ga0315907_1000196421 | 3300031758 | Freshwater | LITVVLAVILMFFIVMPVLAFMYYDMYYATQAAVIEVRKMKELRKEIQIERMYSK |
| Ga0315907_101062257 | 3300031758 | Freshwater | LLITVMAVLLTFFIVMPIIGFMLWDLHIATQAAVHEVRKMKELRRDILIERMYRD |
| Ga0315907_101839363 | 3300031758 | Freshwater | MAVLLTFFIVMPVLAFMYYDMYTATQAAVVEVKKMKQLRREILEERLYGK |
| Ga0315907_102122511 | 3300031758 | Freshwater | ALLLTFFIVMPILGVMYYDMFIVHQAAVHEVKKMKQLRREILEERMYGK |
| Ga0315907_108987792 | 3300031758 | Freshwater | MVVLLMFFIVMPLLAFMYHDMFYATRAAMYEVRKMKELRREIQIERLNRD |
| Ga0315899_100489517 | 3300031784 | Freshwater | MAVLLTFFIVMPVIGFMLWDMHVATQAAVHEVRRMKELRRDILIERMYRD |
| Ga0315900_102198381 | 3300031787 | Freshwater | MFFIVMPVLAFMYYDMYYATQAAVHEIKKMRELRKEIQIERMYDR |
| Ga0315900_108472961 | 3300031787 | Freshwater | FIIMPILAFMYYDMYYATQAAIHEVRKMRELRKEIQLERMYDR |
| Ga0315909_100024475 | 3300031857 | Freshwater | VVLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMKELRKEIQIERMYGQ |
| Ga0315909_100048757 | 3300031857 | Freshwater | MGVLLCFFIVMPILGFMYFDLWYLKQAATVEIKKMKELRRDILIERMYRND |
| Ga0315909_1000986223 | 3300031857 | Freshwater | MVVLLMFFIVMPVLAFMYHDMYYATQAAVHEVRKMKELRREIQIERLYRD |
| Ga0315909_1001063910 | 3300031857 | Freshwater | MAVILMFFIVMPILAFMYYDMYYATQAAIHEVKKMRELRKEIQIERMYDR |
| Ga0315909_100122812 | 3300031857 | Freshwater | LIATVLGLLLMFFIIMPILAFMYYDMYNATQAAIHEVRKMRELRKEILIERMYGQ |
| Ga0315909_100267659 | 3300031857 | Freshwater | MAVLLTFFIALPIMAFMYWDMYNATQAAVVEVKRMKQLRREIQIERMYGQ |
| Ga0315909_105000791 | 3300031857 | Freshwater | VPWSLIIVVMAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVKKMRELRKEIQIERMYDR |
| Ga0315909_105229282 | 3300031857 | Freshwater | MTVLLMFFIIMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR |
| Ga0315909_109595342 | 3300031857 | Freshwater | FFIVMPVLAFMYYDMWFATQAAVQEVKKMKELRREILEERLYGR |
| Ga0315904_100322567 | 3300031951 | Freshwater | MAVLLCFFIVMPIMAFMYWDMYNATEAAVTEVRKMKQLRREIQIERMYGQ |
| Ga0315904_101568814 | 3300031951 | Freshwater | VVVLAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0315904_104008952 | 3300031951 | Freshwater | MAVLLCFFIVMPVMAFMYWDMYNATQAAVAEVKRMKQLRREIQIERMYGQ |
| Ga0315904_106963581 | 3300031951 | Freshwater | DVPWGLLITVMAVLLTFFIVMPIIGFMIYDMHYATQAAVYEAKKMRQLRKEILEERLYGK |
| Ga0315901_101723656 | 3300031963 | Freshwater | IPWSLLITVMAVLLTFFIALPLMAFMYWDMYNATQAAIVEVKKMKELRRQIQLERAYDQ |
| Ga0315901_105159223 | 3300031963 | Freshwater | FFIVMPIIGFMLWDMHIATQAAVHEVRRMKELRRDILLERMYRD |
| Ga0315901_107258532 | 3300031963 | Freshwater | MFFIVMPIMAFMYYDMYFATQAAVSEVKKMRELRKEIQIERMYGK |
| Ga0315906_1000527217 | 3300032050 | Freshwater | MFFIVMPVLAFMYYDMYYATQAAVHEVKRMKQLRQEIQEERQYYRGN |
| Ga0315902_102313735 | 3300032093 | Freshwater | FMYYDMYYATQAAVHEVRKMRELRREIQSERMYGK |
| Ga0315902_106303613 | 3300032093 | Freshwater | ILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYGQ |
| Ga0315903_100636311 | 3300032116 | Freshwater | ENIPWSLLITVMAVLLTFFIVMPILAFMYYDMYYAHQAAIIEIRKMKELRREILIERMYR |
| Ga0315903_101715824 | 3300032116 | Freshwater | MAVLLTFFIVMPLLAFMYYDMFYAHQAAIIEIRKMKELRREILIERMYRD |
| Ga0315903_104878292 | 3300032116 | Freshwater | MAVVLMFFIVMPVVGFMLWDLYVVKEAAIYEIKKMKQLRRQILEERRQETIRSE |
| Ga0315903_106095421 | 3300032116 | Freshwater | LMFFIVMPLLAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR |
| Ga0315903_109306112 | 3300032116 | Freshwater | MFFIIMPILAFMYYDMYFATQAAVTEVRKMRELRKEIQIERMYGK |
| Ga0334978_0000213_9160_9312 | 3300033979 | Freshwater | MAVLLTFFIVMPILAFMYYDMYVATQAAVQEVKKMRELRREIQVERMYGR |
| Ga0334978_0027033_2857_3009 | 3300033979 | Freshwater | MAVLLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQLERMYDR |
| Ga0334982_0000129_6856_7008 | 3300033981 | Freshwater | MAVLLMFFIIMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQLERMYDR |
| Ga0334982_0016055_2323_2475 | 3300033981 | Freshwater | MAVLLMFFIIMPVLMFMYWDMFHATNAAVREVKKMQELRKEIQIERMYGK |
| Ga0334982_0021547_1_153 | 3300033981 | Freshwater | MAVVLMFFIVMPILAFMYYDMWFATQAAVHEVRKMRELRREIQSERMYGK |
| Ga0334982_0053156_5_127 | 3300033981 | Freshwater | MPILAFMYYDMWFATQAAVHEVRKMRELRREIQSERMYGK |
| Ga0334982_0167962_835_987 | 3300033981 | Freshwater | MAVLLMFFIIMPVLAFMYYDMYFATQAAVTEVKKMKELRREILEERMYGR |
| Ga0334982_0186191_550_705 | 3300033981 | Freshwater | VLTVVLMFFIVMPILAFMYYDMYFATQAAVHEVRKMRELRKEIQIERMYDK |
| Ga0334982_0248922_669_854 | 3300033981 | Freshwater | ENIPWTLLITVMAVLLTFFIVMPILAFMYYDMYYAHQAAIIEIRKMKELRREILIERMYR |
| Ga0334996_0076906_1453_1608 | 3300033994 | Freshwater | VLTVVLMFFIVMPILAFMYYDMYFATQAAVHEVRKMRELRKEIQIERMYDR |
| Ga0334996_0179748_447_614 | 3300033994 | Freshwater | LIVVVLTVVLMFFIVMPILAFMYYDMYFATQAAVHEVRKMRELRKEILIERMYDR |
| Ga0334986_0000421_29532_29684 | 3300034012 | Freshwater | MAVLLTFFIVMPVLAFMYYDMYVATQAAVAEVRKMKELRREILEERLYGK |
| Ga0334986_0001337_2883_3035 | 3300034012 | Freshwater | MAVLLMFFIIMPVLAFMYYDMYYATQAAVTEVKKMKELRREILEERMYGR |
| Ga0334986_0002196_9849_10007 | 3300034012 | Freshwater | VVLTVVLMFFIIMPILAFMYYDMYFATEAAVQEVRKMRELRREIQVERMYGK |
| Ga0334986_0019388_1882_2034 | 3300034012 | Freshwater | MAVLLTFFIVMPVLAFMYYDMYYATQAAVTEVKKMKQLRREILEERLYGR |
| Ga0335004_0079611_402_569 | 3300034021 | Freshwater | LIVVVLTVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEILIERMYDK |
| Ga0334987_0002248_2259_2414 | 3300034061 | Freshwater | VLAVVLMFFIVMPILAFMYYDMYFATQAAVHEVRKMKELRKEIQIERMYDR |
| Ga0334987_0133674_714_866 | 3300034061 | Freshwater | MAVVLTFFIVMPVLAFMYHDMYYATQAAIQEVRKMKELRRDILIERMYRD |
| Ga0334987_0214647_1088_1240 | 3300034061 | Freshwater | MAVLLTFFVVMPVLAFMYYDMYYATQAAVTEVRKMKQLRREIQEERLYGR |
| Ga0310130_0006843_1504_1641 | 3300034073 | Fracking Water | MFFIVMPVLAFMYYDMYYATQAAVSEVKKMKQLRREILEERMYGK |
| Ga0335027_0016691_6024_6146 | 3300034101 | Freshwater | MPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR |
| Ga0335027_0164326_440_592 | 3300034101 | Freshwater | MAVLLTFFIVMPIIGFMLWDLHITNQAAIHEVRKMRELRREIQTERMYGK |
| Ga0335027_0182845_5_151 | 3300034101 | Freshwater | VVLMFFIVMPILAFMYYDMYFATQAAVSEVKKMRELRKEIQIERMYGK |
| Ga0335027_0472793_20_172 | 3300034101 | Freshwater | MAVILMFFIVMPILAFMYYDMYYATQAAVTEVKKMKELRREILEERMYGR |
| Ga0335031_0100306_3_116 | 3300034104 | Freshwater | IGFMLWDMHIATQAAVHEVRRMKELRRDILIERMYRD |
| Ga0335036_0000463_12791_12913 | 3300034106 | Freshwater | MPVLAFMYYDMYYATQAAVSEVKKMRELRKEIQIERMYGK |
| Ga0335036_0001652_10007_10162 | 3300034106 | Freshwater | VLAVLLTFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDK |
| Ga0335036_0002074_17003_17155 | 3300034106 | Freshwater | MAVLLTFFIVMPVLAFMYYDMYYATQAAVTEVRKMKQLRREIQEERLYGR |
| Ga0335036_0019390_2680_2847 | 3300034106 | Freshwater | LIVVVLTVVLMFFIVMPILAFMYYDMYFATQAAVHEVRKMRELRKEIQIERMYDK |
| Ga0335036_0826751_347_499 | 3300034106 | Freshwater | MAVLLMFFVIMPILAFMYYDMYFATQAAVQEVKKMKELRREILEERLYGR |
| Ga0335051_0306442_571_723 | 3300034109 | Freshwater | MAVLLTFFIVMPVLAFMYYDMYVATQAAVAEVKKMKQLRREILEERLYGK |
| Ga0335063_0123245_707_865 | 3300034111 | Freshwater | VVLTVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEILIERMYDR |
| Ga0335053_0000486_26496_26648 | 3300034118 | Freshwater | MAVLLMFFIIMPILAFMYYDMLIATNAAVYEVKKMRELRKEIQIERMYGK |
| Ga0335065_0319751_813_968 | 3300034200 | Freshwater | VLAVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMRELRKEIQIERMYDR |
| Ga0335065_0442238_584_742 | 3300034200 | Freshwater | VVLAVVLMFFIVMPILAFMYYDMYYATQAAVHEVRKMKELRREIQIERMYDR |
| Ga0335007_0040466_1660_1812 | 3300034283 | Freshwater | MAVLLMFFIVMPVLAFMYYDMYYATQAAVHEVRKMKELRKEIMIERMYEK |
| Ga0335007_0099279_1190_1342 | 3300034283 | Freshwater | MAVLLTFFIVMPIIGFMIYDMHYATQAAVYEAKKMRQLRKEILEERLYGK |
| ⦗Top⦘ |