| Basic Information | |
|---|---|
| Family ID | F019907 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 227 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MYNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSIYNEFH |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 227 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.44 % |
| % of genes near scaffold ends (potentially truncated) | 40.09 % |
| % of genes from short scaffolds (< 2000 bps) | 75.33 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.877 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.586 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (75.330 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 227 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 2.20 |
| PF00166 | Cpn10 | 1.76 |
| PF01068 | DNA_ligase_A_M | 0.88 |
| PF08279 | HTH_11 | 0.44 |
| PF00268 | Ribonuc_red_sm | 0.44 |
| PF14743 | DNA_ligase_OB_2 | 0.44 |
| PF12684 | DUF3799 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 227 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.20 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.76 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.88 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.88 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.88 % |
| All Organisms | root | All Organisms | 36.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10048036 | All Organisms → Viruses → Predicted Viral | 2158 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10085520 | All Organisms → Viruses → Predicted Viral | 1374 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10090331 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1313 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10141796 | Not Available | 900 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10274014 | Not Available | 518 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10013896 | Not Available | 4437 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1002182 | All Organisms → cellular organisms → Bacteria | 3431 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1037730 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1050805 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300001352|JGI20157J14317_10044128 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300001450|JGI24006J15134_10035866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2136 | Open in IMG/M |
| 3300001450|JGI24006J15134_10165589 | Not Available | 708 | Open in IMG/M |
| 3300001450|JGI24006J15134_10167440 | Not Available | 702 | Open in IMG/M |
| 3300001472|JGI24004J15324_10068596 | Not Available | 995 | Open in IMG/M |
| 3300001472|JGI24004J15324_10071182 | Not Available | 968 | Open in IMG/M |
| 3300001472|JGI24004J15324_10123732 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300001472|JGI24004J15324_10140729 | Not Available | 568 | Open in IMG/M |
| 3300001589|JGI24005J15628_10094320 | Not Available | 1020 | Open in IMG/M |
| 3300001589|JGI24005J15628_10122307 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 835 | Open in IMG/M |
| 3300001589|JGI24005J15628_10225378 | Not Available | 509 | Open in IMG/M |
| 3300001720|JGI24513J20088_1011234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1093 | Open in IMG/M |
| 3300001940|GOS2222_1022660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 907 | Open in IMG/M |
| 3300003580|JGI26260J51721_1071045 | Not Available | 508 | Open in IMG/M |
| 3300004279|Ga0066605_10044223 | All Organisms → cellular organisms → Bacteria → PVC group | 2044 | Open in IMG/M |
| 3300004279|Ga0066605_10054688 | Not Available | 1787 | Open in IMG/M |
| 3300004279|Ga0066605_10112734 | Not Available | 1115 | Open in IMG/M |
| 3300004279|Ga0066605_10180967 | Not Available | 819 | Open in IMG/M |
| 3300004448|Ga0065861_1000708 | Not Available | 3995 | Open in IMG/M |
| 3300004460|Ga0066222_1120280 | Not Available | 517 | Open in IMG/M |
| 3300005239|Ga0073579_1070800 | Not Available | 1446 | Open in IMG/M |
| 3300005239|Ga0073579_1175636 | All Organisms → Viruses → Predicted Viral | 4686 | Open in IMG/M |
| 3300005589|Ga0070729_10723039 | Not Available | 534 | Open in IMG/M |
| 3300005600|Ga0070726_10407443 | Not Available | 685 | Open in IMG/M |
| 3300005609|Ga0070724_10563076 | Not Available | 512 | Open in IMG/M |
| 3300005941|Ga0070743_10219987 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005942|Ga0070742_10072028 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300006164|Ga0075441_10098576 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1122 | Open in IMG/M |
| 3300006164|Ga0075441_10365139 | Not Available | 524 | Open in IMG/M |
| 3300006190|Ga0075446_10040768 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300006190|Ga0075446_10150235 | Not Available | 664 | Open in IMG/M |
| 3300006191|Ga0075447_10104903 | Not Available | 977 | Open in IMG/M |
| 3300006191|Ga0075447_10186016 | Not Available | 687 | Open in IMG/M |
| 3300006191|Ga0075447_10289216 | Not Available | 527 | Open in IMG/M |
| 3300006484|Ga0070744_10146317 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006735|Ga0098038_1008030 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 4215 | Open in IMG/M |
| 3300006735|Ga0098038_1021150 | All Organisms → Viruses → Predicted Viral | 2474 | Open in IMG/M |
| 3300006737|Ga0098037_1028032 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300006737|Ga0098037_1029044 | All Organisms → Viruses → Predicted Viral | 2043 | Open in IMG/M |
| 3300006737|Ga0098037_1170513 | Not Available | 723 | Open in IMG/M |
| 3300006750|Ga0098058_1153256 | Not Available | 608 | Open in IMG/M |
| 3300006752|Ga0098048_1031753 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300006752|Ga0098048_1045623 | Not Available | 1387 | Open in IMG/M |
| 3300006789|Ga0098054_1217600 | Not Available | 694 | Open in IMG/M |
| 3300006793|Ga0098055_1045693 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300006793|Ga0098055_1107230 | Not Available | 1089 | Open in IMG/M |
| 3300006802|Ga0070749_10560560 | Not Available | 619 | Open in IMG/M |
| 3300006803|Ga0075467_10548926 | Not Available | 592 | Open in IMG/M |
| 3300006810|Ga0070754_10269541 | Not Available | 772 | Open in IMG/M |
| 3300006916|Ga0070750_10354361 | Not Available | 619 | Open in IMG/M |
| 3300006916|Ga0070750_10483217 | Not Available | 509 | Open in IMG/M |
| 3300006919|Ga0070746_10092497 | Not Available | 1517 | Open in IMG/M |
| 3300006920|Ga0070748_1208272 | Not Available | 712 | Open in IMG/M |
| 3300006920|Ga0070748_1285155 | Not Available | 589 | Open in IMG/M |
| 3300006921|Ga0098060_1031878 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300006947|Ga0075444_10032471 | Not Available | 2593 | Open in IMG/M |
| 3300006947|Ga0075444_10187861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 842 | Open in IMG/M |
| 3300007231|Ga0075469_10151794 | Not Available | 631 | Open in IMG/M |
| 3300007276|Ga0070747_1037277 | Not Available | 1903 | Open in IMG/M |
| 3300007276|Ga0070747_1136299 | Not Available | 888 | Open in IMG/M |
| 3300007954|Ga0105739_1009423 | Not Available | 1909 | Open in IMG/M |
| 3300007992|Ga0105748_10034895 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1923 | Open in IMG/M |
| 3300007992|Ga0105748_10451850 | Not Available | 558 | Open in IMG/M |
| 3300008470|Ga0115371_10679299 | Not Available | 1154 | Open in IMG/M |
| 3300008470|Ga0115371_10859311 | Not Available | 813 | Open in IMG/M |
| 3300008961|Ga0102887_1105610 | Not Available | 887 | Open in IMG/M |
| 3300008964|Ga0102889_1008557 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3366 | Open in IMG/M |
| 3300009001|Ga0102963_1019494 | All Organisms → Viruses → Predicted Viral | 2863 | Open in IMG/M |
| 3300009003|Ga0102813_1013248 | All Organisms → Viruses → Predicted Viral | 3202 | Open in IMG/M |
| 3300009003|Ga0102813_1258102 | Not Available | 538 | Open in IMG/M |
| 3300009071|Ga0115566_10323039 | Not Available | 905 | Open in IMG/M |
| 3300009086|Ga0102812_10324972 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300009086|Ga0102812_10359098 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 792 | Open in IMG/M |
| 3300009086|Ga0102812_10840716 | Not Available | 510 | Open in IMG/M |
| 3300009193|Ga0115551_1046288 | Not Available | 2149 | Open in IMG/M |
| 3300009428|Ga0114915_1204785 | Not Available | 542 | Open in IMG/M |
| 3300009433|Ga0115545_1033831 | All Organisms → Viruses → Predicted Viral | 2041 | Open in IMG/M |
| 3300009467|Ga0115565_10152603 | Not Available | 1077 | Open in IMG/M |
| 3300009512|Ga0115003_10305307 | Not Available | 942 | Open in IMG/M |
| 3300009512|Ga0115003_10331821 | Not Available | 898 | Open in IMG/M |
| 3300009512|Ga0115003_10342073 | Not Available | 883 | Open in IMG/M |
| 3300009512|Ga0115003_10679794 | Not Available | 599 | Open in IMG/M |
| 3300009526|Ga0115004_10528480 | Not Available | 698 | Open in IMG/M |
| 3300009677|Ga0115104_10899410 | Not Available | 694 | Open in IMG/M |
| 3300009705|Ga0115000_10581339 | Not Available | 699 | Open in IMG/M |
| 3300009785|Ga0115001_10025241 | Not Available | 3953 | Open in IMG/M |
| 3300009785|Ga0115001_10407974 | Not Available | 848 | Open in IMG/M |
| 3300010392|Ga0118731_102027992 | Not Available | 828 | Open in IMG/M |
| 3300010392|Ga0118731_106082011 | Not Available | 608 | Open in IMG/M |
| 3300014903|Ga0164321_10202517 | Not Available | 904 | Open in IMG/M |
| 3300017709|Ga0181387_1001539 | Not Available | 4793 | Open in IMG/M |
| 3300017709|Ga0181387_1003793 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3022 | Open in IMG/M |
| 3300017713|Ga0181391_1001140 | Not Available | 7919 | Open in IMG/M |
| 3300017713|Ga0181391_1098810 | Not Available | 660 | Open in IMG/M |
| 3300017724|Ga0181388_1137258 | Not Available | 582 | Open in IMG/M |
| 3300017728|Ga0181419_1090421 | Not Available | 759 | Open in IMG/M |
| 3300017729|Ga0181396_1023147 | Not Available | 1234 | Open in IMG/M |
| 3300017731|Ga0181416_1017723 | Not Available | 1672 | Open in IMG/M |
| 3300017733|Ga0181426_1032260 | Not Available | 1031 | Open in IMG/M |
| 3300017737|Ga0187218_1083922 | Not Available | 772 | Open in IMG/M |
| 3300017738|Ga0181428_1002009 | All Organisms → cellular organisms → Bacteria | 4713 | Open in IMG/M |
| 3300017744|Ga0181397_1005932 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3958 | Open in IMG/M |
| 3300017748|Ga0181393_1040356 | Not Available | 1300 | Open in IMG/M |
| 3300017749|Ga0181392_1127972 | Not Available | 750 | Open in IMG/M |
| 3300017749|Ga0181392_1139014 | Not Available | 714 | Open in IMG/M |
| 3300017764|Ga0181385_1153430 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300017767|Ga0181406_1001084 | Not Available | 10088 | Open in IMG/M |
| 3300017767|Ga0181406_1025825 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300017771|Ga0181425_1016566 | Not Available | 2453 | Open in IMG/M |
| 3300017772|Ga0181430_1062631 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300017773|Ga0181386_1221755 | Not Available | 564 | Open in IMG/M |
| 3300017782|Ga0181380_1071065 | All Organisms → Viruses → Predicted Viral | 1226 | Open in IMG/M |
| 3300017782|Ga0181380_1168040 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300017783|Ga0181379_1012084 | Not Available | 3599 | Open in IMG/M |
| 3300017783|Ga0181379_1308605 | Not Available | 537 | Open in IMG/M |
| 3300017786|Ga0181424_10065948 | Not Available | 1564 | Open in IMG/M |
| 3300019938|Ga0194032_1004512 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
| 3300020165|Ga0206125_10252194 | Not Available | 671 | Open in IMG/M |
| 3300020347|Ga0211504_1024257 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300020385|Ga0211677_10154338 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300020438|Ga0211576_10508457 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300021169|Ga0206687_1757198 | Not Available | 1423 | Open in IMG/M |
| 3300021185|Ga0206682_10002021 | Not Available | 19061 | Open in IMG/M |
| 3300021185|Ga0206682_10142314 | Not Available | 1138 | Open in IMG/M |
| 3300021365|Ga0206123_10079179 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1613 | Open in IMG/M |
| 3300021957|Ga0222717_10124478 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300021957|Ga0222717_10557793 | Not Available | 607 | Open in IMG/M |
| 3300021957|Ga0222717_10697845 | Not Available | 519 | Open in IMG/M |
| 3300021958|Ga0222718_10013215 | Not Available | 5993 | Open in IMG/M |
| 3300021959|Ga0222716_10184598 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300021959|Ga0222716_10654844 | Not Available | 564 | Open in IMG/M |
| 3300022218|Ga0224502_10106562 | Not Available | 1065 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10042342 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1406 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10016213 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2955 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10190638 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10400534 | Not Available | 582 | Open in IMG/M |
| 3300024229|Ga0233402_1004700 | All Organisms → cellular organisms → Bacteria | 3537 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10037814 | All Organisms → Viruses → Predicted Viral | 3064 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10416620 | Not Available | 551 | Open in IMG/M |
| 3300024314|Ga0228657_1057663 | Not Available | 826 | Open in IMG/M |
| 3300024322|Ga0228656_1017872 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300024326|Ga0228652_1030141 | Not Available | 1515 | Open in IMG/M |
| 3300024334|Ga0228671_1158509 | Not Available | 510 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10632164 | Not Available | 517 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10438979 | Not Available | 548 | Open in IMG/M |
| 3300025070|Ga0208667_1000451 | Not Available | 17508 | Open in IMG/M |
| 3300025070|Ga0208667_1010252 | All Organisms → Viruses → Predicted Viral | 2165 | Open in IMG/M |
| 3300025071|Ga0207896_1017704 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300025071|Ga0207896_1037309 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 816 | Open in IMG/M |
| 3300025071|Ga0207896_1071112 | Not Available | 542 | Open in IMG/M |
| 3300025071|Ga0207896_1074607 | Not Available | 524 | Open in IMG/M |
| 3300025085|Ga0208792_1020941 | Not Available | 1360 | Open in IMG/M |
| 3300025086|Ga0208157_1037841 | All Organisms → Viruses → Predicted Viral | 1355 | Open in IMG/M |
| 3300025099|Ga0208669_1009632 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300025108|Ga0208793_1064736 | Not Available | 1090 | Open in IMG/M |
| 3300025120|Ga0209535_1039393 | All Organisms → cellular organisms → Bacteria → PVC group | 2131 | Open in IMG/M |
| 3300025137|Ga0209336_10003123 | Not Available | 7706 | Open in IMG/M |
| 3300025137|Ga0209336_10003978 | All Organisms → cellular organisms → Bacteria | 6744 | Open in IMG/M |
| 3300025137|Ga0209336_10042684 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
| 3300025138|Ga0209634_1042121 | All Organisms → Viruses → Predicted Viral | 2317 | Open in IMG/M |
| 3300025168|Ga0209337_1031473 | All Organisms → Viruses → Predicted Viral | 2937 | Open in IMG/M |
| 3300025594|Ga0209094_1041866 | Not Available | 1241 | Open in IMG/M |
| 3300025637|Ga0209197_1070392 | Not Available | 1115 | Open in IMG/M |
| 3300025645|Ga0208643_1067734 | Not Available | 1046 | Open in IMG/M |
| 3300025652|Ga0208134_1102862 | Not Available | 787 | Open in IMG/M |
| 3300025654|Ga0209196_1208681 | Not Available | 503 | Open in IMG/M |
| 3300025658|Ga0209659_1227848 | Not Available | 505 | Open in IMG/M |
| 3300026138|Ga0209951_1016054 | All Organisms → Viruses → Predicted Viral | 1657 | Open in IMG/M |
| 3300026483|Ga0228620_1035283 | Not Available | 1191 | Open in IMG/M |
| 3300026511|Ga0233395_1078454 | Not Available | 895 | Open in IMG/M |
| 3300026511|Ga0233395_1123251 | Not Available | 640 | Open in IMG/M |
| 3300027077|Ga0208941_1001101 | Not Available | 5506 | Open in IMG/M |
| 3300027081|Ga0208954_1009753 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
| 3300027188|Ga0208921_1041936 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300027522|Ga0209384_1043562 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
| 3300027582|Ga0208971_1053392 | Not Available | 1090 | Open in IMG/M |
| 3300027668|Ga0209482_1019039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3012 | Open in IMG/M |
| 3300027704|Ga0209816_1123975 | Not Available | 965 | Open in IMG/M |
| 3300027753|Ga0208305_10192526 | Not Available | 736 | Open in IMG/M |
| 3300027788|Ga0209711_10030409 | Not Available | 3195 | Open in IMG/M |
| 3300027791|Ga0209830_10065138 | Not Available | 1883 | Open in IMG/M |
| 3300027845|Ga0209271_10025192 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300027852|Ga0209345_10673114 | Not Available | 570 | Open in IMG/M |
| 3300028125|Ga0256368_1054134 | Not Available | 702 | Open in IMG/M |
| 3300031140|Ga0308024_1076961 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 847 | Open in IMG/M |
| 3300031167|Ga0308023_1004950 | Not Available | 3101 | Open in IMG/M |
| 3300031510|Ga0308010_1217594 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 684 | Open in IMG/M |
| 3300031519|Ga0307488_10081802 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2400 | Open in IMG/M |
| 3300031598|Ga0308019_10248444 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 675 | Open in IMG/M |
| 3300031599|Ga0308007_10010190 | All Organisms → cellular organisms → Bacteria | 3747 | Open in IMG/M |
| 3300031601|Ga0307992_1276694 | Not Available | 592 | Open in IMG/M |
| 3300031628|Ga0308014_1064350 | Not Available | 886 | Open in IMG/M |
| 3300031628|Ga0308014_1140634 | Not Available | 549 | Open in IMG/M |
| 3300031629|Ga0307985_10017377 | All Organisms → cellular organisms → Bacteria | 3445 | Open in IMG/M |
| 3300031629|Ga0307985_10073829 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1381 | Open in IMG/M |
| 3300031647|Ga0308012_10010168 | Not Available | 3850 | Open in IMG/M |
| 3300031656|Ga0308005_10216725 | Not Available | 516 | Open in IMG/M |
| 3300031659|Ga0307986_10023320 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3522 | Open in IMG/M |
| 3300031659|Ga0307986_10235179 | Not Available | 799 | Open in IMG/M |
| 3300031659|Ga0307986_10306257 | Not Available | 664 | Open in IMG/M |
| 3300031659|Ga0307986_10437439 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 514 | Open in IMG/M |
| 3300031688|Ga0308011_10104876 | Not Available | 867 | Open in IMG/M |
| 3300031688|Ga0308011_10154980 | Not Available | 694 | Open in IMG/M |
| 3300031689|Ga0308017_1022249 | Not Available | 1418 | Open in IMG/M |
| 3300031689|Ga0308017_1084011 | Not Available | 658 | Open in IMG/M |
| 3300031696|Ga0307995_1240590 | Not Available | 625 | Open in IMG/M |
| 3300031703|Ga0308002_1135195 | Not Available | 518 | Open in IMG/M |
| 3300031721|Ga0308013_10246507 | Not Available | 643 | Open in IMG/M |
| 3300031773|Ga0315332_10211028 | Not Available | 1260 | Open in IMG/M |
| 3300031774|Ga0315331_10009210 | Not Available | 7338 | Open in IMG/M |
| 3300031774|Ga0315331_10023604 | All Organisms → cellular organisms → Bacteria | 4545 | Open in IMG/M |
| 3300032011|Ga0315316_10023571 | Not Available | 4753 | Open in IMG/M |
| 3300032047|Ga0315330_10000515 | Not Available | 24094 | Open in IMG/M |
| 3300032073|Ga0315315_10106981 | Not Available | 2605 | Open in IMG/M |
| 3300032073|Ga0315315_10202245 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300032088|Ga0315321_10073943 | Not Available | 2347 | Open in IMG/M |
| 3300032088|Ga0315321_10188420 | Not Available | 1361 | Open in IMG/M |
| 3300032088|Ga0315321_10728463 | Not Available | 571 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.59% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.33% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.13% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.73% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 5.29% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.96% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.08% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.64% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.64% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.64% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.76% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.32% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.32% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.32% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.88% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.88% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.44% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.44% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.44% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.44% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.44% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.44% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.44% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.44% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300001940 | Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027081 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
| 3300031656 | Marine microbial communities from water near the shore, Antarctic Ocean - #67 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031703 | Marine microbial communities from water near the shore, Antarctic Ocean - #34 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100480364 | 3300000101 | Marine | MYNQSALIRIANKLFPEKNVFNLTNKEQSEVLKVYDKFGY* |
| DelMOSum2010_100855204 | 3300000101 | Marine | MYNQSALIRISKQLFPDKNVFQLTRQEQSKVLAIYNEFH* |
| DelMOSum2010_100903313 | 3300000101 | Marine | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLSIYREYN* |
| DelMOSum2010_101417962 | 3300000101 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQSQVLAIYNEFH* |
| DelMOSum2010_102740142 | 3300000101 | Marine | MYNQSALIRISKNLFPNKNVFQLTKEEQKKVLAIYNEFH* |
| DelMOWin2010_1001389612 | 3300000117 | Marine | MYNQSALIRIAKQLFPEKNVFQLTKSEQRKVLSIYNEFH* |
| LPaug08P2610mDRAFT_10021825 | 3300000159 | Marine | MYNQSALIRIAKQLFPEKNVFQLTKLEQREVLAIYNEFH* |
| LP_A_09_P04_10DRAFT_10377301 | 3300000265 | Marine | MYNHSALIRISXXLXPNKNVFNLTKEEQRKVLEIYNEFH* |
| LP_A_09_P04_10DRAFT_10508051 | 3300000265 | Marine | VLSITFKYNNMYNHSALIRISKNLFPNKNVFNLTKEEQRKVLAIYNEFH* |
| JGI20157J14317_100441283 | 3300001352 | Pelagic Marine | MYNQSALIRIAKQLFPEKNVFQLTKLEQRKVLSIYNEFH* |
| JGI24006J15134_100358661 | 3300001450 | Marine | MYNQSALIRIAARLFPEKNVFQLTKQEQSQVLSIYREFH* |
| JGI24006J15134_101655892 | 3300001450 | Marine | MYNQSALIRIAARLFPEKNVFQLTKQEQSQVLSIYNEFH* |
| JGI24006J15134_101674402 | 3300001450 | Marine | MYNQSALIRIAARLFPEKNVFQLTKQEQSKVLAIYNEFH* |
| JGI24004J15324_100685963 | 3300001472 | Marine | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLAIYREYN* |
| JGI24004J15324_100711822 | 3300001472 | Marine | MYNQSALIRIAARLFPEKNVFXLTKQEQSKVLAIYNEFH* |
| JGI24004J15324_101237324 | 3300001472 | Marine | NNMYNHSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH* |
| JGI24004J15324_101407294 | 3300001472 | Marine | INKYNTMYNHSALIRISKQLFPDKNVFQLTKQEQSKVLSIYNEFH* |
| JGI24005J15628_100943201 | 3300001589 | Marine | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLAIYNEFH* |
| JGI24005J15628_101223072 | 3300001589 | Marine | MYNQTQLIMISKRLFPDKNVFNLTKQEQQQVLSIYNEFN* |
| JGI24005J15628_102253784 | 3300001589 | Marine | QSALIRIAARLFPEKNVFQLTKQEQSQVLSIYNEFH* |
| JGI24513J20088_10112341 | 3300001720 | Marine | LNNMYNQSALIRIAARLFPXKNVFQLTKQEQSQVLSIYREFH* |
| GOS2222_10226606 | 3300001940 | Marine | NINMYNQSALIRIAKQLFPDKNVFQLTKLEQRKVLSIYNEFH* |
| JGI26260J51721_10710451 | 3300003580 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSIYNEFH* |
| Ga0066605_100442233 | 3300004279 | Marine | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLSIYNEFH* |
| Ga0066605_100546881 | 3300004279 | Marine | MYNHSALIRISKQLFPDKNVFQLTKQEQSKVLAIYNEFH* |
| Ga0066605_101127343 | 3300004279 | Marine | MYNHSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH* |
| Ga0066605_101809673 | 3300004279 | Marine | MYNHSALIRISKNLFPNKNVFNLTKEEQRKVLEIYNEFH* |
| Ga0065861_10007081 | 3300004448 | Marine | MYNQSALIRIAKQLFPDKNVFNLTKQEQQQVLSIYNEFH* |
| Ga0066222_11202801 | 3300004460 | Marine | NMYNQSALIRIAKQLFPDKNVFNLTKQEQQQVLSIYNEFH* |
| Ga0073579_10708004 | 3300005239 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKLEQRKVLSIYNEFH* |
| Ga0073579_11756366 | 3300005239 | Marine | MYNQSALIRIAKQLFPEKNVFQLTKLEQQKVLSIYNEFH* |
| Ga0070729_107230391 | 3300005589 | Marine Sediment | MYNQSALIRISKQLFPDKNVFQLTKKEQSKVLSIYNEFH* |
| Ga0070726_104074433 | 3300005600 | Marine Sediment | MYNQTQLIMISRKLFPDKNVFNLTKQEQRQVLSIYNEYN* |
| Ga0070724_105630762 | 3300005609 | Marine Sediment | MYNQTQLIMISRRLFPDKNVFNLTKQEQRQVLSIYNEYN* |
| Ga0070743_102199871 | 3300005941 | Estuarine | VLSITFKYNNMYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH* |
| Ga0070742_100720282 | 3300005942 | Estuarine | MYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH* |
| Ga0075441_100985766 | 3300006164 | Marine | NNMYNQSALIRISKQIFPEKNVFQLTKQEQSKVLEVYYDTN* |
| Ga0075441_103651391 | 3300006164 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYNE |
| Ga0075446_100407687 | 3300006190 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQSQVLSIYNEYN* |
| Ga0075446_101502351 | 3300006190 | Marine | MYNQSALIRISKQIFPDKNVFQLTKQEQSQVLEVYYNTN* |
| Ga0075447_101049035 | 3300006191 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSLYYDTN* |
| Ga0075447_101860162 | 3300006191 | Marine | MYNQSALIRISKQLFPEKNVFQLTKQEQSQVLEVYYDTN* |
| Ga0075447_102892163 | 3300006191 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQSQVLSLYYDTN* |
| Ga0070744_101463173 | 3300006484 | Estuarine | MYNHSALIRISHKLYPNKNVFNLTKEEQSKVLAIYREFH* |
| Ga0098038_10080305 | 3300006735 | Marine | MYNQSALIRIAKKLFPNKNVFQLTKQEQQQVLSIYNEFH* |
| Ga0098038_10211505 | 3300006735 | Marine | MYNHSALIRIAHKLFPDKNVFSLTKQEQQEVLAIYNEFY* |
| Ga0098037_10280325 | 3300006737 | Marine | MYNHSALIRIAHKLFPDKNVFSLTKQEQQEVLAIYNEFH* |
| Ga0098037_10290449 | 3300006737 | Marine | NNMYNQSALIRIAKQLFPEKNVFQLTKSEQREVLAIYNEYN* |
| Ga0098037_11705131 | 3300006737 | Marine | NLNNMYNQSALIRIAKQLFPEKNVFQLTKSEQREVLAIYNEFH* |
| Ga0098058_11532564 | 3300006750 | Marine | ALIRISKQLFPDKNVFQLTKQEQSQVLSIYNEFH* |
| Ga0098048_10317532 | 3300006752 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQQQVLSIYNEFH* |
| Ga0098048_10456231 | 3300006752 | Marine | MYNQSALIRIAKNLYPNKNVFQLTKEEQREVLAIYNEFH* |
| Ga0098054_12176002 | 3300006789 | Marine | VLSITFKYNNMYNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSIYNEFY* |
| Ga0098055_10456931 | 3300006793 | Marine | NMYNQSALIRISKQLFPDKNVFQLTKQEQQQVLSIYNEFH* |
| Ga0098055_11072306 | 3300006793 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSIYNEFY* |
| Ga0070749_105605601 | 3300006802 | Aqueous | MYNQSALIRIAKQLFPEKNVFQLTKQEQSKVLAIYNEFH* |
| Ga0075467_105489261 | 3300006803 | Aqueous | MYNQSALIRISKQLFPDKNVFQLTKQEQQQVLAIYNEFH* |
| Ga0070754_102695412 | 3300006810 | Aqueous | MYNQSALIRISKQLFPDKNVFQLTKQEQSKVLAIYNEFH* |
| Ga0070750_103543611 | 3300006916 | Aqueous | KILIRINNQQFPKKNVFQLTKLEQQEVLSIYREYN* |
| Ga0070750_104832173 | 3300006916 | Aqueous | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLSIYR |
| Ga0070746_100924975 | 3300006919 | Aqueous | MYNQSALIRIAKKLFPDKNVFNLTKQEQSQVLSIYNEFH* |
| Ga0070748_12082722 | 3300006920 | Aqueous | MYNQSALIRIAKKLFPDKNVFQLTKQEQSEVLSIYNEFH* |
| Ga0070748_12851551 | 3300006920 | Aqueous | MYNHSALIRISKNLFPNKNVFQLTKEEQREVLKIYNEFH* |
| Ga0098060_10318782 | 3300006921 | Marine | MYNQSALIRIAKQLFPEKNVFQLTKSEQREVLAIYNEYN* |
| Ga0075444_100324711 | 3300006947 | Marine | NMYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYNEYN* |
| Ga0075444_101878615 | 3300006947 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYNEYN* |
| Ga0075469_101517943 | 3300007231 | Aqueous | MYNQSALIRIAKQLFPEKNVFQLTKQEQSEVLSIYNEFH* |
| Ga0070747_10372774 | 3300007276 | Aqueous | MYNQSALIRIAKKLFPDKNVFNLTKQEQSQVLAIYNEFH* |
| Ga0070747_11362992 | 3300007276 | Aqueous | MYNQSALIRIAKQLFPDKNVFQLTKQEQSEVLSIYNEFH* |
| Ga0105739_10094232 | 3300007954 | Estuary Water | MYNQSALIRISKQLFPDKNVFQLSKEEQRKVLAIYNEFH* |
| Ga0105748_100348955 | 3300007992 | Estuary Water | MYNQSALIRIANKLFPEKNVFNLTRKEQSEVLKVYDKFGY* |
| Ga0105748_104518503 | 3300007992 | Estuary Water | MYNQSALIRIGKQLFPEKNVFQLTKLEQREVLAIYNEFH* |
| Ga0115371_106792992 | 3300008470 | Sediment | MYNQSALIRISKQIFPDKNVFQLTKQEQSQVLEVYYDTN* |
| Ga0115371_108593113 | 3300008470 | Sediment | MYNQSALIRISKQIFPEKNVFQLTKQEQSQVLEVYYDTN* |
| Ga0102887_11056101 | 3300008961 | Estuarine | ITMYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH* |
| Ga0102889_10085575 | 3300008964 | Estuarine | MYNQSALIRISKQLFPDKNVFNLTKQEQQQVLSIYNEFH* |
| Ga0102963_10194949 | 3300009001 | Pond Water | MYNQSALIRIAKNLYPNKNVFQLTKDEQREVLAIYNEFH* |
| Ga0102813_101324810 | 3300009003 | Estuarine | MYNHSALIRISKNLFPNKNVFNLTKEEQRKVLAIYNEFH* |
| Ga0102813_12581022 | 3300009003 | Estuarine | VLSITNKYNNMYNHSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYN |
| Ga0115566_103230394 | 3300009071 | Pelagic Marine | MYNQSALIRIAKQLFPEKNVFQLTKLEQREVLSIYNEFH* |
| Ga0102812_103249721 | 3300009086 | Estuarine | LTMSTNKINNNNMYNQSALIRISKQLFPDKNVFNLTKKEQQQVLSIYNEFH* |
| Ga0102812_103590981 | 3300009086 | Estuarine | NMYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH* |
| Ga0102812_108407163 | 3300009086 | Estuarine | FKYNNMYNQSALIRISKQLFPDKNVFQLTKQEQSQVLSIYNEFH* |
| Ga0115551_10462883 | 3300009193 | Pelagic Marine | MMYNQSALIRIAKQLFPEKNVFQLTKLEQREVLSIYNEFH* |
| Ga0114915_12047852 | 3300009428 | Deep Ocean | MYNQSALIRIAKQLFPEKNVFQLTRQEQSKVLSIYNE |
| Ga0115545_10338311 | 3300009433 | Pelagic Marine | MYNQSTLIRIAKNLYPNKNVFQLTKDEQKEVLAIYNEFH* |
| Ga0115565_101526033 | 3300009467 | Pelagic Marine | MYNQSALIRIAKKLFPEKNVFQLTKLEQREVLSIYNEFH* |
| Ga0115003_103053073 | 3300009512 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQQKVLAIYNEFH* |
| Ga0115003_103318211 | 3300009512 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKLEQRKVLSIY |
| Ga0115003_103420734 | 3300009512 | Marine | MYNQTQLIMISRRLFPDKNVFNLTKQEQQQVLSIYNEFN* |
| Ga0115003_106797944 | 3300009512 | Marine | MYNQTQLIMISKRLFPDKNVFNLTKQEQSQVLSIYNEYN* |
| Ga0115004_105284801 | 3300009526 | Marine | NMYNQSALIRIAHKLFPDKNVFNLTKQEQQQVLSIYNEFH* |
| Ga0115104_108994101 | 3300009677 | Marine | ALIRIAKQLFPEKNVFQLTKLEQREVLAIYNEFH* |
| Ga0115000_105813395 | 3300009705 | Marine | IMYNQSALIRIALRLFPEKNVFQLTKSEQQEVLSIYNEFH* |
| Ga0115001_100252411 | 3300009785 | Marine | MYNQTQLIMISKRLFPDKNVFNLTKQEQSQVLSIY |
| Ga0115001_104079745 | 3300009785 | Marine | KYNNMYNQSALIRIAKQLFPDKNVFQLTKLEQRKVLSIYNEFH* |
| Ga0118731_1020279921 | 3300010392 | Marine | KYNNMYNQSALIRISKQLFPDKNVFQLTKQEQQQVLSIYNEFH* |
| Ga0118731_1060820113 | 3300010392 | Marine | MYNQSALIRIAKKLFPDKNVFNLTKQEQSKVLAIYNEFH* |
| Ga0164321_102025175 | 3300014903 | Marine Sediment | MYNQSALIRIAKKLFPEKNVFSLTKQEQQKVLAIYNEFH* |
| Ga0181387_10015395 | 3300017709 | Seawater | MYNHSALIRIAHKLFPEKNVFSLTKQEQQKVLAIYNEFH |
| Ga0181387_10037933 | 3300017709 | Seawater | MYNQSALIRISKQLFPDKNVFQLTKQEQQQVLAIYNEFH |
| Ga0181391_10011408 | 3300017713 | Seawater | MYNQSALIRIAAKLFPEKNVFQLTKSEQREVLSIYNEFH |
| Ga0181391_10988103 | 3300017713 | Seawater | MYNQSALIRIAKKLFPEKNVFQLTKSEQREVLSIYNEF |
| Ga0181388_11372584 | 3300017724 | Seawater | IKMYNQSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH |
| Ga0181419_10904211 | 3300017728 | Seawater | IITMYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH |
| Ga0181396_10231473 | 3300017729 | Seawater | MYNQSALIRIAKKLFPEKNVFQLTKLEQREVLAIYNEFH |
| Ga0181416_10177234 | 3300017731 | Seawater | MYNQSALIRISKQLFPDKNVFQLTKEEQREVLAIYNEFH |
| Ga0181426_10322602 | 3300017733 | Seawater | MYNQSALIRISKQLFPDKNVFQLTKLEQQKVLAIYREYN |
| Ga0187218_10839224 | 3300017737 | Seawater | LSITFKYNNMYNQSALIRIAHKLFPDKNVFQLTKQEQSQVLAIYNEFH |
| Ga0181428_100200911 | 3300017738 | Seawater | MYNQSALIRISKKLYPSKNVFQLTKEEQRKVLAIYREFY |
| Ga0181397_10059328 | 3300017744 | Seawater | MYNQSALIRIAHKLFPDKNVFQLTKQEQSQVLSIYNEFH |
| Ga0181393_10403561 | 3300017748 | Seawater | MYNQSALIRIAKQLFPEKNVFQLTKLEQRKVLAIYNEFH |
| Ga0181392_11279721 | 3300017749 | Seawater | MYNQSALIRIAHKLFPDKNVFQLTKQEQSQVLSIYNEF |
| Ga0181392_11390141 | 3300017749 | Seawater | YNNMYNQSALIRIAHKLFPDKNVFQLTKQEQSQVLSIYNEFH |
| Ga0181385_11534302 | 3300017764 | Seawater | MYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNE |
| Ga0181406_100108413 | 3300017767 | Seawater | MYNQSALIRIAKQLFPEKNVFQLTKSEQREVLAIY |
| Ga0181406_102582510 | 3300017767 | Seawater | SALIRIAKQLFPEKNVFQLTKSEQREVLAIYNEFH |
| Ga0181425_10165665 | 3300017771 | Seawater | MYNQSALIRIAKQLFPEKNVFQLTKLEQREVLAIYNEYN |
| Ga0181430_10626312 | 3300017772 | Seawater | MYNQSALIRIAHKLFPDKNVFNLTKQEQQEVLSIYNEFH |
| Ga0181386_12217553 | 3300017773 | Seawater | MYNQSALIRIAKKLFPEKNVFQLTKLEQRKVLAIYNEFH |
| Ga0181380_10710651 | 3300017782 | Seawater | SALIRIAKQLFPEKNVFQLTKSEQREVLSIYNEFH |
| Ga0181380_11680401 | 3300017782 | Seawater | FNIITMYNHSALIRIAHKLFPEKNVFSLTKQEQQKVLAIYNEFH |
| Ga0181379_10120845 | 3300017783 | Seawater | MYNQSALIRISKQLFPDKNVFNLTKKEQQQVLSIYNEFH |
| Ga0181379_13086051 | 3300017783 | Seawater | NNMYNQSALIRIAKQLFPEKNVFQLTKLEQRKVLAIYNEFH |
| Ga0181424_100659483 | 3300017786 | Seawater | MYNQSALIRIAKQLFPEKNVFQLTKSEQREVLAIYNEFN |
| Ga0194032_10045127 | 3300019938 | Freshwater | MYNQSALIRIAKQLFPEKNVFQLTKSEQRKVLSIYNEFH |
| Ga0206125_102521943 | 3300020165 | Seawater | MMYNQSALIRIAKQLFPEKNVFQLTKLEQREVLSIYNEFH |
| Ga0211504_10242578 | 3300020347 | Marine | INMYNQSALIRISKQLFPDKNVFQLTKQEQSQVLSIYNKFY |
| Ga0211677_101543382 | 3300020385 | Marine | MYNQSTLIRIAKNLYPNKNVFQLTKEEQREVLAIYNEFH |
| Ga0211576_105084571 | 3300020438 | Marine | MYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH |
| Ga0206687_17571986 | 3300021169 | Seawater | LSITFKYNNMYNQSALIRISKQLFPDKNVFQLTKQEQSKVLAIYNEFH |
| Ga0206682_1000202143 | 3300021185 | Seawater | MYNHSALIRISNKLYPNKNVFNLTKEEQRKVLEIYNEFH |
| Ga0206682_101423142 | 3300021185 | Seawater | MYNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSIYNEFH |
| Ga0206123_100791798 | 3300021365 | Seawater | MYNQSALIRIANKLFPEKNVFNLTNKEQSEVLKVYDKFGY |
| Ga0222717_101244786 | 3300021957 | Estuarine Water | MYNQSALIRISKQLFPDKNVFQLTKQEQSQVLAIYNEFH |
| Ga0222717_105577931 | 3300021957 | Estuarine Water | SITFKYNNMYNQSALIRIAHKLFPDKNVFQLTKQEQSQVLSIYNEFH |
| Ga0222717_106978451 | 3300021957 | Estuarine Water | MYNQSALIRIAKQLFPEKNVFQLTKLEQREVLAIYNEFH |
| Ga0222718_100132154 | 3300021958 | Estuarine Water | MYNQSALIRISKQLFPDKNVFQLTKQEQSQVLAIYNKFH |
| Ga0222716_101845987 | 3300021959 | Estuarine Water | NNMYNHSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH |
| Ga0222716_106548441 | 3300021959 | Estuarine Water | TFKYKNMYNQSALIRIAHKLFPEKNVFSLTKQEQQEVLAIYNEFH |
| Ga0224502_101065621 | 3300022218 | Sediment | MYNQSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH |
| (restricted) Ga0233411_100423422 | 3300023112 | Seawater | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLSIYNEFH |
| (restricted) Ga0233412_100162137 | 3300023210 | Seawater | MYNQSALIRIAARLFPEKNVFQLTKLEQRKVLSIYNEFH |
| (restricted) Ga0233412_101906386 | 3300023210 | Seawater | NNMYNHSALIRIAHKLFPDKNVFNLTKQEQQQVLSIYNEFH |
| (restricted) Ga0255040_104005342 | 3300024059 | Seawater | MSTNKNNNMYNQSALIRIANKLFPEKNVFNLNKKEQSQVLKVYDKFGY |
| Ga0233402_10047003 | 3300024229 | Seawater | MYNQSALIRISKQLFPDKNVFQLSKEEQRKVLAIYNEFH |
| (restricted) Ga0233444_1003781413 | 3300024264 | Seawater | MYNHSALIRISKNLFPNKNVFNLTKEEQRKVLAIYNEFH |
| (restricted) Ga0233444_104166202 | 3300024264 | Seawater | MYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIY |
| Ga0228657_10576631 | 3300024314 | Seawater | SITNKYNNMYNHSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH |
| Ga0228656_10178721 | 3300024322 | Seawater | MYNQSALIRIAHKLFPEKNVFSLTKQEQQKVLAIYNEFH |
| Ga0228652_10301418 | 3300024326 | Seawater | YNNMYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH |
| Ga0228671_11585091 | 3300024334 | Seawater | KVLSITFKYNNMYNQSALIRIAHKLFPEKNVFSLTKQEQQKVLAIYNEFH |
| (restricted) Ga0255048_106321643 | 3300024518 | Seawater | DNKVLSITNKYNNMYNHSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH |
| (restricted) Ga0255044_104389792 | 3300024529 | Seawater | MYNQSALIRISKQLFPDKNVFQLTKQEQQQVLSIYNEF |
| Ga0208667_100045128 | 3300025070 | Marine | MYNQSALIRIAKNLYPNKNVFQLTKEEQREVLAIYNEFH |
| Ga0208667_10102521 | 3300025070 | Marine | MYNHSALIRIAHKLFPDKNVFSLTKQEQQEVLAIYNEFH |
| Ga0207896_10177046 | 3300025071 | Marine | NNMYNQSALIRIAARLFPEKNVFQLTKQEQSKVLAIYNEFH |
| Ga0207896_10373094 | 3300025071 | Marine | NMYNQSALIRIANKLFPEKNVFNLTRKEQSEVLKVYDKFGY |
| Ga0207896_10711123 | 3300025071 | Marine | QLINKYNTMYNHSALIRISKQLFPDKNVFQLTKQEQSKVLAIYNEFH |
| Ga0207896_10746072 | 3300025071 | Marine | MYNQSALIRIAARLFPEKNVFQLTKQEQSQVLSIYNEFH |
| Ga0208792_10209413 | 3300025085 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQQQVLSIYNEFH |
| Ga0208157_10378411 | 3300025086 | Marine | MYNQSALIRIAKQLFPEKNVFQLTKSEQREVLAIYNEYN |
| Ga0208669_10096322 | 3300025099 | Marine | MYNQSALIRIAKKLFPEKNVFQLTKSEQREVLSIYNEFH |
| Ga0208793_10647363 | 3300025108 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSIYNEFY |
| Ga0209535_10393934 | 3300025120 | Marine | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLSIYREYN |
| Ga0209336_100031238 | 3300025137 | Marine | MYNQSALIRIAARLFPEKNVFQLTKLEQREVLAIYREYN |
| Ga0209336_100039784 | 3300025137 | Marine | MYNQSALIRIAARLFPDKNVFQLTKLEQREVLAIYNEFH |
| Ga0209336_100426846 | 3300025137 | Marine | MYNQSALIRIAAKLFPEKNVFNLTRKEQSEVLKVYDKFGY |
| Ga0209634_10421212 | 3300025138 | Marine | MYNQTQLIMISKRLFPDKNVFNLTKQEQQQVLSIYNEFN |
| Ga0209337_10314733 | 3300025168 | Marine | MYNHSALIRISKQLFPDKNVFQLTKQEQSKVLSIYNEFH |
| Ga0209094_10418663 | 3300025594 | Pelagic Marine | MYNQSALIRIAKQLFPEKNVFQLTKQEQSEVLSIYNEFH |
| Ga0209197_10703924 | 3300025637 | Pelagic Marine | MYNQSALIRIAKQLFPEKNVFQLTKLEQREVLSIY |
| Ga0208643_10677344 | 3300025645 | Aqueous | MYNQSALIRIAKQLFPEKNVFQLTKQEQSKVLAIYNEFH |
| Ga0208134_11028623 | 3300025652 | Aqueous | MYNQSALIRIAKKLFPDKNVFNLTKQEQSQVLAIYNEFH |
| Ga0209196_12086811 | 3300025654 | Pelagic Marine | YNQSALIRIAKQLFPEKNVFQLTKLEQREVLSIYNEFH |
| Ga0209659_12278482 | 3300025658 | Marine | MYNQSALIRISKQLFPDKNVFNLTKQEQQQVLSIYNEF |
| Ga0209951_10160543 | 3300026138 | Pond Water | MYNQSALIRIAKNLYPNKNVFQLTKDEQREVLAIYNEFH |
| Ga0228620_10352831 | 3300026483 | Seawater | TMYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH |
| Ga0233395_10784545 | 3300026511 | Seawater | NIITMYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEFH |
| Ga0233395_11232511 | 3300026511 | Seawater | KVLSITFKYNNMYNQSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH |
| Ga0208941_100110119 | 3300027077 | Marine | MYNHSALIRIAHKLFPDKNVFNLTKQEQSQVLSIYNEFH |
| Ga0208954_10097534 | 3300027081 | Marine | MYNHSALIRISNKLYPNKNVFNLTKEEQRKVLAIYNEF |
| Ga0208921_10419362 | 3300027188 | Estuarine | KYNNMYNHSALIRISKNLFPNKNVFNLTKEEQRKVLAIYNEFH |
| Ga0209384_10435627 | 3300027522 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYNEYN |
| Ga0208971_10533922 | 3300027582 | Marine | MYNQSALIRIANKLFPEKNVFNLTRKEQSEVLKVYDKFGY |
| Ga0209482_10190395 | 3300027668 | Marine | MYNQSALIRISKQIFPDKNVFQLTKQEQSQVLEVYYNTN |
| Ga0209816_11239755 | 3300027704 | Marine | NMYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYNEYN |
| Ga0208305_101925263 | 3300027753 | Estuarine | NQSALIRISKQLFPDKNVFQLSKEEQRKVLAIYNEFH |
| Ga0209711_100304096 | 3300027788 | Marine | MYNQTQLIMISKRLFPDKNVFNLTKQEQSQVLSIYNEYN |
| Ga0209830_100651384 | 3300027791 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKLEQRKVLSIYNEFH |
| Ga0209271_100251926 | 3300027845 | Marine Sediment | MYNQSALIRISKQLFPDKNVFQLTKQEQSKVLSIYNEFH |
| Ga0209345_106731143 | 3300027852 | Marine | NNNMYNQSALIRIAAKLFPEKNVFQLTKSEQREVLSIYNEFH |
| Ga0256368_10541341 | 3300028125 | Sea-Ice Brine | MYNQSALIRIALKLFPDKNVFQLTKQEQQKVLAIYNEFH |
| Ga0308024_10769611 | 3300031140 | Marine | NQSALIRISKQLFPDKNVFQLTKQEQSQVLSLYYDTN |
| Ga0308023_10049506 | 3300031167 | Marine | MYNHSALIRIAKQLFPEKNVFQLTKQEQSKVLSIYNEYN |
| Ga0308010_12175941 | 3300031510 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQSQVLSLYYDTN |
| Ga0307488_100818021 | 3300031519 | Sackhole Brine | MIYNQSALIRIALRLFPEKNVFQLTKSEQREVLSIYNEF |
| Ga0308019_102484444 | 3300031598 | Marine | KYNNMYNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSLYYDTN |
| Ga0308007_100101908 | 3300031599 | Marine | MYNHSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYNEYN |
| Ga0307992_12766942 | 3300031601 | Marine | NQSALIRISKQIFPEKNVFQLTKQEQSQVLEVYYDTN |
| Ga0308014_10643501 | 3300031628 | Marine | YNQSALIRIAKQLFPDKNVFQLTKQEQSQVLSLYYDTN |
| Ga0308014_11406341 | 3300031628 | Marine | MYNQSALIRISKQLFPEKNVFQLTKQEQSKVLEVYYDTN |
| Ga0307985_1001737714 | 3300031629 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQSKVLSIYNEYN |
| Ga0307985_100738293 | 3300031629 | Marine | MYNQSALIRISKQIFPDKNVFQLTKQEQSQVLEVYYDTN |
| Ga0308012_100101687 | 3300031647 | Marine | MYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYHEYN |
| Ga0308005_102167251 | 3300031656 | Marine | MYNQSALIRISKQLFPDKNVFQLTKKEQSQVLSIY |
| Ga0307986_100233204 | 3300031659 | Marine | MYNKSALIRISKQIFPDKNVFQLTKQEQSQVLEVYYDTN |
| Ga0307986_102351791 | 3300031659 | Marine | MYNQSALIRISKQLFPDKNVFQLTKQEQSQVLEVYYNTN |
| Ga0307986_103062571 | 3300031659 | Marine | MYNQSALIRISKQIFPEKNVFQLTKQEQSKVLEVY |
| Ga0307986_104374394 | 3300031659 | Marine | SALIRIAKQLFPDKNVFQLTKQEQSKVLSIYHEYN |
| Ga0308011_101048761 | 3300031688 | Marine | YNQSALIRISKQIFPDKNVFQLTKQEQSQVLEVYYNTN |
| Ga0308011_101549805 | 3300031688 | Marine | LINKYNNMYNQSALIRIAKQLFPDKNVFQLTRQEQSKVLSIYNEYN |
| Ga0308017_10222497 | 3300031689 | Marine | NQSALIRIAKQLFPEKNVFQLTKKEQSKVLSIYNEYN |
| Ga0308017_10840111 | 3300031689 | Marine | NNMYNQSALIRIAKQLFPDKNVFQLTKQEQSKVLSIYNEYN |
| Ga0307995_12405901 | 3300031696 | Marine | NQSALIRISKQLFPDKNVFQLTKQEQSQVLSIYHEYN |
| Ga0308002_11351953 | 3300031703 | Marine | SALIRIAKQLFPDKNVFQLTKQEQSQVLSLYYDTN |
| Ga0308013_102465075 | 3300031721 | Marine | INKYNNMYNQSALIRIAKQLFPDKNVFQLTRQEQSKVLSIYNEYN |
| Ga0315332_102110281 | 3300031773 | Seawater | MYNQSALIRISKKLYPSKNVFQLTKEEQRKVLAIYREF |
| Ga0315331_1000921015 | 3300031774 | Seawater | MYNHSALIRIAHKLFPEKNVFSLTKKEQQKVLAIYKEFY |
| Ga0315331_100236044 | 3300031774 | Seawater | MYNQSALIRISKKLYPSKNVFQLTKEEQRKVLAIYREFH |
| Ga0315316_100235717 | 3300032011 | Seawater | MYNHSALIRIAHKLFPEKNVFSLTKKEQQEVLAIYKEFY |
| Ga0315330_1000051533 | 3300032047 | Seawater | MYNHSALIRISKKLYPNKNVFNLTKEEQRKVLAIYNEFH |
| Ga0315315_101069817 | 3300032073 | Seawater | MYNQSALIRIAARLFPEKNVFQLTKLEQKEVLAIYREYN |
| Ga0315315_102022458 | 3300032073 | Seawater | QSALIRIAKQLFPEKNVFQLTKSEQREVLAIYNEFH |
| Ga0315321_100739433 | 3300032088 | Seawater | MYNQSALIRISKQLFPDKNVFQLTKQEQSKVLAIYNEFH |
| Ga0315321_101884201 | 3300032088 | Seawater | IKINNMYNQSALIRISKQLFPDKNVFQLSKEEQRKVLAIYNEFH |
| Ga0315321_107284632 | 3300032088 | Seawater | MYNQSALIRISKQLFPDKNVFQLSKEEQRKVLAIYN |
| ⦗Top⦘ |