| Basic Information | |
|---|---|
| Family ID | F019900 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 227 |
| Average Sequence Length | 41 residues |
| Representative Sequence | DRANGVTVALGAGGTLSVTYAASTLGPTAQVIFDVTGYFVP |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 227 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.48 % |
| % of genes from short scaffolds (< 2000 bps) | 74.89 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.674 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (29.075 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.123 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.401 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.74% Coil/Unstructured: 78.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 227 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 7.05 |
| PF08486 | SpoIID | 5.29 |
| PF01370 | Epimerase | 3.08 |
| PF00072 | Response_reg | 2.20 |
| PF00041 | fn3 | 2.20 |
| PF02288 | Dehydratase_MU | 1.76 |
| PF00704 | Glyco_hydro_18 | 1.32 |
| PF00282 | Pyridoxal_deC | 1.32 |
| PF16363 | GDP_Man_Dehyd | 1.32 |
| PF07690 | MFS_1 | 1.32 |
| PF00082 | Peptidase_S8 | 0.88 |
| PF06262 | Zincin_1 | 0.88 |
| PF01047 | MarR | 0.88 |
| PF02195 | ParBc | 0.88 |
| PF13570 | PQQ_3 | 0.88 |
| PF00118 | Cpn60_TCP1 | 0.88 |
| PF14697 | Fer4_21 | 0.88 |
| PF04264 | YceI | 0.88 |
| PF05227 | CHASE3 | 0.44 |
| PF08241 | Methyltransf_11 | 0.44 |
| PF02082 | Rrf2 | 0.44 |
| PF13823 | ADH_N_assoc | 0.44 |
| PF01258 | zf-dskA_traR | 0.44 |
| PF13192 | Thioredoxin_3 | 0.44 |
| PF01695 | IstB_IS21 | 0.44 |
| PF03372 | Exo_endo_phos | 0.44 |
| PF00528 | BPD_transp_1 | 0.44 |
| PF04294 | VanW | 0.44 |
| PF00005 | ABC_tran | 0.44 |
| PF08245 | Mur_ligase_M | 0.44 |
| PF03176 | MMPL | 0.44 |
| PF01025 | GrpE | 0.44 |
| PF07883 | Cupin_2 | 0.44 |
| PF00881 | Nitroreductase | 0.44 |
| PF13340 | DUF4096 | 0.44 |
| PF01699 | Na_Ca_ex | 0.44 |
| PF09851 | SHOCT | 0.44 |
| PF07311 | Dodecin | 0.44 |
| PF00132 | Hexapep | 0.44 |
| PF12867 | DinB_2 | 0.44 |
| PF13365 | Trypsin_2 | 0.44 |
| PF13537 | GATase_7 | 0.44 |
| PF03450 | CO_deh_flav_C | 0.44 |
| PF07885 | Ion_trans_2 | 0.44 |
| PF05598 | DUF772 | 0.44 |
| PF00106 | adh_short | 0.44 |
| PF00756 | Esterase | 0.44 |
| PF01557 | FAA_hydrolase | 0.44 |
| PF01555 | N6_N4_Mtase | 0.44 |
| PF13418 | Kelch_4 | 0.44 |
| PF00581 | Rhodanese | 0.44 |
| PF01871 | AMMECR1 | 0.44 |
| PF08239 | SH3_3 | 0.44 |
| PF14257 | DUF4349 | 0.44 |
| PF00534 | Glycos_transf_1 | 0.44 |
| PF14340 | DUF4395 | 0.44 |
| PF13439 | Glyco_transf_4 | 0.44 |
| PF02224 | Cytidylate_kin | 0.44 |
| PF05977 | MFS_3 | 0.44 |
| PF02922 | CBM_48 | 0.44 |
| PF13646 | HEAT_2 | 0.44 |
| PF01243 | Putative_PNPOx | 0.44 |
| PF01738 | DLH | 0.44 |
| PF01138 | RNase_PH | 0.44 |
| PF01402 | RHH_1 | 0.44 |
| PF13620 | CarboxypepD_reg | 0.44 |
| PF04226 | Transgly_assoc | 0.44 |
| PF00908 | dTDP_sugar_isom | 0.44 |
| PF00266 | Aminotran_5 | 0.44 |
| PF02286 | Dehydratase_LU | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 227 Family Scaffolds |
|---|---|---|---|
| COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 5.29 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 1.32 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.88 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.44 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.44 |
| COG2720 | Vancomycin resistance protein YoaR (function unknown), contains peptidoglycan-binding and VanW domains | Defense mechanisms [V] | 0.44 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.44 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.44 |
| COG4909 | Propanediol dehydratase, large subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.44 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.44 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.44 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.44 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.44 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.44 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.44 |
| COG2078 | Predicted RNA modification protein, AMMECR1 domain | General function prediction only [R] | 0.44 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.44 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.44 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.44 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.44 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.44 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.44 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.44 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.44 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.44 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.44 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.44 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.44 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.00 % |
| Unclassified | root | N/A | 37.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918024|NODE_18125_length_607_cov_7.682043 | Not Available | 657 | Open in IMG/M |
| 3300001870|JGI24129J20441_1107827 | Not Available | 500 | Open in IMG/M |
| 3300002066|JGIcombinedJ21911_10046775 | Not Available | 1478 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10051003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1780 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10051230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1776 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10007272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans | 5490 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10099419 | Not Available | 1122 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10203610 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10243280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 584 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10052799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1403 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10106693 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10114561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 815 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10210066 | Not Available | 530 | Open in IMG/M |
| 3300002179|JGI24141J26756_1003059 | All Organisms → cellular organisms → Bacteria | 4901 | Open in IMG/M |
| 3300002179|JGI24141J26756_1091790 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300002515|JGI24144J35610_10017424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2085 | Open in IMG/M |
| 3300002538|JGI24132J36420_10081276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 924 | Open in IMG/M |
| 3300002549|JGI24130J36418_10098312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300002550|JGI24131J36419_10003889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans | 5490 | Open in IMG/M |
| 3300005445|Ga0070708_100075677 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
| 3300005547|Ga0070693_101440910 | Not Available | 536 | Open in IMG/M |
| 3300005947|Ga0066794_10237916 | Not Available | 546 | Open in IMG/M |
| 3300005947|Ga0066794_10261048 | Not Available | 520 | Open in IMG/M |
| 3300005980|Ga0066798_10003764 | All Organisms → cellular organisms → Bacteria | 5955 | Open in IMG/M |
| 3300005980|Ga0066798_10183702 | Not Available | 573 | Open in IMG/M |
| 3300006041|Ga0075023_100060821 | Not Available | 1211 | Open in IMG/M |
| 3300006047|Ga0075024_100517120 | Not Available | 628 | Open in IMG/M |
| 3300006057|Ga0075026_100356067 | Not Available | 813 | Open in IMG/M |
| 3300006059|Ga0075017_100487817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 933 | Open in IMG/M |
| 3300006172|Ga0075018_10059545 | Not Available | 1612 | Open in IMG/M |
| 3300006172|Ga0075018_10808919 | Not Available | 514 | Open in IMG/M |
| 3300006642|Ga0075521_10184557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 986 | Open in IMG/M |
| 3300006642|Ga0075521_10510057 | Not Available | 589 | Open in IMG/M |
| 3300006795|Ga0075520_1028082 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300006795|Ga0075520_1116693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1194 | Open in IMG/M |
| 3300006795|Ga0075520_1201945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 842 | Open in IMG/M |
| 3300006795|Ga0075520_1268029 | Not Available | 707 | Open in IMG/M |
| 3300006795|Ga0075520_1329350 | Not Available | 624 | Open in IMG/M |
| 3300006795|Ga0075520_1425337 | Not Available | 530 | Open in IMG/M |
| 3300006854|Ga0075425_100132389 | All Organisms → cellular organisms → Bacteria | 2851 | Open in IMG/M |
| 3300006864|Ga0066797_1035214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1762 | Open in IMG/M |
| 3300006864|Ga0066797_1081688 | Not Available | 1132 | Open in IMG/M |
| 3300006864|Ga0066797_1176685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 745 | Open in IMG/M |
| 3300006864|Ga0066797_1208072 | Not Available | 683 | Open in IMG/M |
| 3300006864|Ga0066797_1280985 | Not Available | 581 | Open in IMG/M |
| 3300006864|Ga0066797_1314249 | Not Available | 547 | Open in IMG/M |
| 3300006950|Ga0075524_10206748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 855 | Open in IMG/M |
| 3300007076|Ga0075435_100180383 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300009029|Ga0066793_10241521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1048 | Open in IMG/M |
| 3300009029|Ga0066793_10509541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300009029|Ga0066793_10516860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 682 | Open in IMG/M |
| 3300009029|Ga0066793_10644214 | Not Available | 603 | Open in IMG/M |
| 3300009029|Ga0066793_10668341 | Not Available | 590 | Open in IMG/M |
| 3300009029|Ga0066793_10728614 | Not Available | 563 | Open in IMG/M |
| 3300009029|Ga0066793_10886103 | Not Available | 505 | Open in IMG/M |
| 3300009176|Ga0105242_10381221 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300009549|Ga0116137_1214937 | Not Available | 510 | Open in IMG/M |
| 3300009552|Ga0116138_1002357 | All Organisms → cellular organisms → Bacteria | 9686 | Open in IMG/M |
| 3300009552|Ga0116138_1027396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1724 | Open in IMG/M |
| 3300009614|Ga0116104_1000097 | All Organisms → cellular organisms → Bacteria | 82593 | Open in IMG/M |
| 3300009614|Ga0116104_1005880 | All Organisms → cellular organisms → Bacteria | 4494 | Open in IMG/M |
| 3300014490|Ga0182010_10000030 | All Organisms → cellular organisms → Bacteria | 73109 | Open in IMG/M |
| 3300014490|Ga0182010_10052944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1939 | Open in IMG/M |
| 3300014490|Ga0182010_10199862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1048 | Open in IMG/M |
| 3300014494|Ga0182017_10011476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6263 | Open in IMG/M |
| 3300014494|Ga0182017_10024458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4146 | Open in IMG/M |
| 3300014494|Ga0182017_10136656 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300014494|Ga0182017_10143371 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300014494|Ga0182017_10152879 | Not Available | 1492 | Open in IMG/M |
| 3300014494|Ga0182017_10153086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 1491 | Open in IMG/M |
| 3300014494|Ga0182017_10341333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 933 | Open in IMG/M |
| 3300014494|Ga0182017_10627722 | Not Available | 654 | Open in IMG/M |
| 3300014494|Ga0182017_10635172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 649 | Open in IMG/M |
| 3300014494|Ga0182017_10833003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
| 3300014496|Ga0182011_10019427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4942 | Open in IMG/M |
| 3300014496|Ga0182011_10060141 | All Organisms → cellular organisms → Bacteria | 2679 | Open in IMG/M |
| 3300014496|Ga0182011_10087596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2177 | Open in IMG/M |
| 3300014496|Ga0182011_10377152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 929 | Open in IMG/M |
| 3300014496|Ga0182011_10401685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. DSM 9736 | 894 | Open in IMG/M |
| 3300014496|Ga0182011_10772408 | Not Available | 603 | Open in IMG/M |
| 3300014498|Ga0182019_10012493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18 | 4490 | Open in IMG/M |
| 3300014498|Ga0182019_10050008 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300014498|Ga0182019_11043165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300014502|Ga0182021_10139144 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
| 3300014502|Ga0182021_10140042 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
| 3300014502|Ga0182021_10152015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2694 | Open in IMG/M |
| 3300014502|Ga0182021_10225184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2194 | Open in IMG/M |
| 3300014502|Ga0182021_10523147 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300014502|Ga0182021_10656119 | Not Available | 1257 | Open in IMG/M |
| 3300014502|Ga0182021_11005142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1004 | Open in IMG/M |
| 3300014502|Ga0182021_11244527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 896 | Open in IMG/M |
| 3300014502|Ga0182021_11870699 | Not Available | 723 | Open in IMG/M |
| 3300014502|Ga0182021_12261474 | Not Available | 654 | Open in IMG/M |
| 3300014502|Ga0182021_12926123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
| 3300014839|Ga0182027_10012574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11880 | Open in IMG/M |
| 3300014839|Ga0182027_10230661 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
| 3300014839|Ga0182027_10467749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1384 | Open in IMG/M |
| 3300014839|Ga0182027_10800268 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300014839|Ga0182027_10817312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 973 | Open in IMG/M |
| 3300014839|Ga0182027_10826651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 966 | Open in IMG/M |
| 3300015203|Ga0167650_1002329 | All Organisms → cellular organisms → Bacteria | 5708 | Open in IMG/M |
| 3300015372|Ga0132256_100037096 | All Organisms → cellular organisms → Bacteria | 4452 | Open in IMG/M |
| 3300017929|Ga0187849_1000095 | All Organisms → cellular organisms → Bacteria | 123115 | Open in IMG/M |
| 3300017929|Ga0187849_1016007 | All Organisms → cellular organisms → Bacteria | 4494 | Open in IMG/M |
| 3300017938|Ga0187854_10045461 | Not Available | 2221 | Open in IMG/M |
| 3300017941|Ga0187850_10019885 | Not Available | 3891 | Open in IMG/M |
| 3300018013|Ga0187873_1065877 | Not Available | 1509 | Open in IMG/M |
| 3300018015|Ga0187866_1017002 | Not Available | 3835 | Open in IMG/M |
| 3300018018|Ga0187886_1000839 | All Organisms → cellular organisms → Bacteria | 32497 | Open in IMG/M |
| 3300018018|Ga0187886_1074920 | Not Available | 1473 | Open in IMG/M |
| 3300018057|Ga0187858_10032386 | Not Available | 3922 | Open in IMG/M |
| 3300018063|Ga0184637_10580136 | Not Available | 639 | Open in IMG/M |
| 3300019788|Ga0182028_1038771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 820 | Open in IMG/M |
| 3300019788|Ga0182028_1139852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella gansuensis | 595 | Open in IMG/M |
| 3300022694|Ga0222623_10028495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2111 | Open in IMG/M |
| 3300023311|Ga0256681_10916919 | Not Available | 598 | Open in IMG/M |
| 3300023311|Ga0256681_11477942 | Not Available | 894 | Open in IMG/M |
| 3300023311|Ga0256681_12231495 | Not Available | 717 | Open in IMG/M |
| 3300025448|Ga0208037_1054819 | Not Available | 756 | Open in IMG/M |
| 3300025477|Ga0208192_1000037 | All Organisms → cellular organisms → Bacteria | 147767 | Open in IMG/M |
| 3300025481|Ga0208079_1023547 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300025495|Ga0207932_1017487 | Not Available | 2005 | Open in IMG/M |
| 3300025495|Ga0207932_1020561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1799 | Open in IMG/M |
| 3300025495|Ga0207932_1027652 | Not Available | 1462 | Open in IMG/M |
| 3300025495|Ga0207932_1041973 | Not Available | 1076 | Open in IMG/M |
| 3300025498|Ga0208819_1034652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1248 | Open in IMG/M |
| 3300025533|Ga0208584_1018794 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300025533|Ga0208584_1064806 | Not Available | 920 | Open in IMG/M |
| 3300025533|Ga0208584_1066955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 902 | Open in IMG/M |
| 3300025650|Ga0209385_1031210 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300025650|Ga0209385_1104088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 914 | Open in IMG/M |
| 3300025692|Ga0209744_1035900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1891 | Open in IMG/M |
| 3300025718|Ga0209123_1113674 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300025725|Ga0209638_1032581 | Not Available | 2312 | Open in IMG/M |
| 3300025725|Ga0209638_1043220 | Not Available | 1901 | Open in IMG/M |
| 3300025725|Ga0209638_1076725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1252 | Open in IMG/M |
| 3300025739|Ga0209745_1007457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfogranum → Desulfogranum japonicum | 5339 | Open in IMG/M |
| 3300025750|Ga0209747_1038966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14 | 1835 | Open in IMG/M |
| 3300025750|Ga0209747_1041442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1766 | Open in IMG/M |
| 3300025750|Ga0209747_1124134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. DSM 9736 | 848 | Open in IMG/M |
| 3300025764|Ga0209539_1089986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1254 | Open in IMG/M |
| 3300025764|Ga0209539_1236305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
| 3300025764|Ga0209539_1284940 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025764|Ga0209539_1314306 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales | 531 | Open in IMG/M |
| 3300025812|Ga0208457_1005910 | All Organisms → cellular organisms → Bacteria | 4502 | Open in IMG/M |
| 3300025846|Ga0209538_1116465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1063 | Open in IMG/M |
| 3300025846|Ga0209538_1190964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 769 | Open in IMG/M |
| 3300025857|Ga0209014_10213967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 660 | Open in IMG/M |
| 3300025864|Ga0209429_10067755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1623 | Open in IMG/M |
| 3300025864|Ga0209429_10121138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1126 | Open in IMG/M |
| 3300025864|Ga0209429_10246363 | Not Available | 706 | Open in IMG/M |
| 3300025864|Ga0209429_10278103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 651 | Open in IMG/M |
| 3300025865|Ga0209226_10111998 | Not Available | 1238 | Open in IMG/M |
| 3300025878|Ga0209584_10038106 | Not Available | 1678 | Open in IMG/M |
| 3300025878|Ga0209584_10260953 | Not Available | 664 | Open in IMG/M |
| 3300025878|Ga0209584_10385514 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025878|Ga0209584_10443639 | Not Available | 501 | Open in IMG/M |
| 3300025888|Ga0209540_10016898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfogranum → Desulfogranum japonicum | 4513 | Open in IMG/M |
| 3300025888|Ga0209540_10100225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1774 | Open in IMG/M |
| 3300025888|Ga0209540_10411513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 735 | Open in IMG/M |
| 3300025888|Ga0209540_10656441 | Not Available | 519 | Open in IMG/M |
| 3300025927|Ga0207687_10418318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300026223|Ga0209840_1098187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300026271|Ga0209880_1008329 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| 3300026271|Ga0209880_1018088 | Not Available | 1753 | Open in IMG/M |
| 3300026271|Ga0209880_1049762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 921 | Open in IMG/M |
| 3300026271|Ga0209880_1082538 | Not Available | 666 | Open in IMG/M |
| 3300026272|Ga0209913_1005884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4156 | Open in IMG/M |
| 3300027674|Ga0209118_1150109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 643 | Open in IMG/M |
| 3300027896|Ga0209777_10001391 | All Organisms → cellular organisms → Bacteria | 35196 | Open in IMG/M |
| 3300028679|Ga0302169_10089803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
| 3300028743|Ga0302262_10346291 | Not Available | 504 | Open in IMG/M |
| 3300028865|Ga0302291_10336456 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300029980|Ga0302298_10260165 | Not Available | 574 | Open in IMG/M |
| 3300029984|Ga0311332_10603362 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300029984|Ga0311332_11272280 | Not Available | 594 | Open in IMG/M |
| 3300029990|Ga0311336_10087861 | Not Available | 2450 | Open in IMG/M |
| 3300029990|Ga0311336_10939616 | Not Available | 749 | Open in IMG/M |
| 3300030000|Ga0311337_11960012 | Not Available | 514 | Open in IMG/M |
| 3300030002|Ga0311350_10013061 | All Organisms → cellular organisms → Bacteria | 7172 | Open in IMG/M |
| 3300030002|Ga0311350_11547910 | Not Available | 588 | Open in IMG/M |
| 3300030047|Ga0302286_10496435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13 | 619 | Open in IMG/M |
| 3300030114|Ga0311333_10957012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
| 3300030114|Ga0311333_11878704 | Not Available | 521 | Open in IMG/M |
| 3300030294|Ga0311349_10611144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1030 | Open in IMG/M |
| 3300030294|Ga0311349_10616677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18 | 1025 | Open in IMG/M |
| 3300030294|Ga0311349_11258937 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300030339|Ga0311360_10247704 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300030339|Ga0311360_11526459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300031232|Ga0302323_100310172 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300031232|Ga0302323_102506176 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031239|Ga0265328_10445766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 511 | Open in IMG/M |
| 3300031521|Ga0311364_10384408 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300031713|Ga0318496_10768256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300031722|Ga0311351_10634176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 813 | Open in IMG/M |
| 3300031722|Ga0311351_10879071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300031726|Ga0302321_100207662 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300031726|Ga0302321_102045525 | Not Available | 665 | Open in IMG/M |
| 3300031726|Ga0302321_102477820 | Not Available | 605 | Open in IMG/M |
| 3300031726|Ga0302321_103274290 | Not Available | 527 | Open in IMG/M |
| 3300031902|Ga0302322_100871992 | Not Available | 1078 | Open in IMG/M |
| 3300031902|Ga0302322_102074307 | Not Available | 699 | Open in IMG/M |
| 3300031902|Ga0302322_103567877 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031918|Ga0311367_10797424 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300031918|Ga0311367_11490425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| 3300031965|Ga0326597_10479673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1360 | Open in IMG/M |
| 3300032008|Ga0318562_10397248 | Not Available | 801 | Open in IMG/M |
| 3300032060|Ga0318505_10599419 | Not Available | 518 | Open in IMG/M |
| 3300032173|Ga0315268_10576388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1115 | Open in IMG/M |
| 3300032275|Ga0315270_10123498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1536 | Open in IMG/M |
| 3300033480|Ga0316620_11316406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300033798|Ga0334821_039035 | Not Available | 951 | Open in IMG/M |
| 3300033819|Ga0334816_000997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5209 | Open in IMG/M |
| 3300033819|Ga0334816_009298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1980 | Open in IMG/M |
| 3300033819|Ga0334816_068309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
| 3300033820|Ga0334817_097992 | Not Available | 565 | Open in IMG/M |
| 3300034070|Ga0334822_040465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1026 | Open in IMG/M |
| 3300034123|Ga0370479_0085300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 822 | Open in IMG/M |
| 3300034195|Ga0370501_0200620 | Not Available | 703 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 29.07% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 18.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 13.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 7.05% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.08% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 3.08% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.64% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.32% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.88% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.44% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
| 3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
| 3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
| 3300002179 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A | Environmental | Open in IMG/M |
| 3300002515 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A | Environmental | Open in IMG/M |
| 3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300002550 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009614 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025718 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-31A (SPAdes) | Environmental | Open in IMG/M |
| 3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025750 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033798 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-S | Environmental | Open in IMG/M |
| 3300033819 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-M | Environmental | Open in IMG/M |
| 3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
| 3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B_all_v_01566110 | 2140918024 | Soil | DDRANGVTVALGAGGTLSVTYAASTLGPVAQVIFDVTGYFTP |
| JGI24129J20441_11078272 | 3300001870 | Arctic Peat Soil | LNFPLGDDRANAVTVALSGTGTLSITYVAVPGATAQVIFDVTGYFTP* |
| JGIcombinedJ21911_100467751 | 3300002066 | Arctic Peat Soil | FPVRDDRANGVTVALGAGGTLSATYVATTAGPTAQVIFDVTGYFQ* |
| JGIcombinedJ21913_100510033 | 3300002068 | Arctic Peat Soil | TVALGAGGTLSATYVAATLGPTTQVIFDVTGYFR* |
| JGIcombinedJ21913_100512301 | 3300002068 | Arctic Peat Soil | TVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFQ* |
| JGIcombinedJ21912_100072726 | 3300002069 | Arctic Peat Soil | FPVGDDRANGVTVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFVP* |
| JGIcombinedJ21912_100994191 | 3300002069 | Arctic Peat Soil | TVALGAGGTLSATYVAATAGPTAQVIFDVTGYFQ* |
| JGIcombinedJ21912_102036101 | 3300002069 | Arctic Peat Soil | TVALGGSNLSATYAAATLGKTAQVIFDVTGYFVP* |
| JGIcombinedJ21912_102432802 | 3300002069 | Arctic Peat Soil | TVALGAGGPLSATYVAATAGPTAQVIFDVTGYFVP* |
| JGIcombinedJ21914_100527991 | 3300002072 | Arctic Peat Soil | NFPVGDNRANGVTVALGAGGTLSATYAAATLGPTAQVIFDVTGYFVR* |
| JGIcombinedJ21914_101066933 | 3300002072 | Arctic Peat Soil | VALSGTGTLSATYASPVGGATAQVLFDVTGYFVP* |
| JGIcombinedJ21914_101145611 | 3300002072 | Arctic Peat Soil | RDDRANGVTVALGAGGTLSATYVAATAGPTTQVIFDVTGYFQ* |
| JGIcombinedJ21914_102100662 | 3300002072 | Arctic Peat Soil | TVALGAGGTLSATYVAATLGPTTQVIFDVTGYFQ* |
| JGI24141J26756_10030591 | 3300002179 | Arctic Peat Soil | FPLRDDRANGVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFQ* |
| JGI24141J26756_10917901 | 3300002179 | Arctic Peat Soil | TVALGAGGTLSATYVAATLGPTTQVIFDVTGYFLP* |
| JGI24144J35610_100174242 | 3300002515 | Arctic Peat Soil | LNFPLRDDRANGVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFQ* |
| JGI24132J36420_100812761 | 3300002538 | Arctic Peat Soil | PLRDDRANGVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFLP* |
| JGI24130J36418_100983121 | 3300002549 | Arctic Peat Soil | TVALGGGGTLSVTYAAPTPGPTAHVIFDVTGYFVPTATSQ* |
| JGI24131J36419_100038896 | 3300002550 | Arctic Peat Soil | FPVGDDRAXGVTVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFVP* |
| Ga0070708_1000756774 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | NRANGVTVALSGTGTLSVTYAAGGGNTTQVIFDVTGYFTP* |
| Ga0070693_1014409101 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RANGVTVALGTTGTPGRLSVTWVSSAGATAQVIFDVTGYFG* |
| Ga0066794_102379162 | 3300005947 | Soil | ANGVTVALSGTGTLSVTYAAPTLGPTAQVLFDVTGYFQ* |
| Ga0066794_102610482 | 3300005947 | Soil | VALGAGGSLSATYVAGTAGPTAQVIFDVTGYFLP* |
| Ga0066798_100037641 | 3300005980 | Soil | NFPLADNRANGVTVALGGGGTLSVTYVAVPGATAQVIFDVTGYFVP* |
| Ga0066798_101837022 | 3300005980 | Soil | GDDRANGVTVALGGTGTLSVTYVAVPGATAQVIFDVTGYFTPDSSG* |
| Ga0075023_1000608211 | 3300006041 | Watersheds | GDNRANGVTVALGAGGTLSITYVATAGATTNLIFDVTGYFTP* |
| Ga0075024_1005171201 | 3300006047 | Watersheds | NRANGVTVALGAGGTLSITYVATAGATTNVIFDVTGYFTP* |
| Ga0075026_1003560672 | 3300006057 | Watersheds | NFPLGDNRANGVTVALSGSGSLSVTYAAAAGRTAHVLFDVTGYFVP* |
| Ga0075017_1004878171 | 3300006059 | Watersheds | SRANGVTVALGAGGTLSITYVAHAGKTTQVIFDVTGYFTP* |
| Ga0075018_100595451 | 3300006172 | Watersheds | NFPKADNRANGVTVALGGGGTLSLTSTTTSQAIFDVTGYFQ* |
| Ga0075018_108089192 | 3300006172 | Watersheds | DNRANGVTVALGAGGTLSITYVATAGATTNVIFDVTGYFTP* |
| Ga0074054_100198582 | 3300006579 | Soil | DNRATGVTVALRAGGTPGSLSVTYVASPATATTQVIFDVTGYYQ* |
| Ga0075521_101845571 | 3300006642 | Arctic Peat Soil | PLGDDRANAVTVALGSGTLSATYAAPTLGQSAQVIFDATGYFAP* |
| Ga0075521_105100571 | 3300006642 | Arctic Peat Soil | ANGVTVALSGSGTLSVTYVASTLTPTTQVIFDVTGYFTP* |
| Ga0075520_10280823 | 3300006795 | Arctic Peat Soil | LGTGGTLSITFVAPSNGPSTHAIFDVTGYFVPAVG* |
| Ga0075520_11166933 | 3300006795 | Arctic Peat Soil | ANAVAVALGGGGTLSITYAAPTSGKTAHVIFDVTGYFTP* |
| Ga0075520_12019452 | 3300006795 | Arctic Peat Soil | DDRANGVTVALGSGTLSVTYAAPTLGPTAHVIFDVTGYFAP* |
| Ga0075520_12680292 | 3300006795 | Arctic Peat Soil | AVTVALGAGGTLSVTYAAPTLGQSAQVIFDVTGYFVP* |
| Ga0075520_13293503 | 3300006795 | Arctic Peat Soil | NFPLNDDRANAVTVALGGGGTLSITYAAPTSGKTAHVIFDVTGYFTP* |
| Ga0075520_14253371 | 3300006795 | Arctic Peat Soil | LNFPVRADRANGVTVALGAGGTLSATYVAATAGPTAQVIFDVTGYFQ* |
| Ga0075425_1001323891 | 3300006854 | Populus Rhizosphere | RANGVTVALGTTGTPGRLSVTWVSSAGATTQVIFDVTGYFG* |
| Ga0066797_10352141 | 3300006864 | Soil | RDDRANGVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFLP* |
| Ga0066797_10816882 | 3300006864 | Soil | VTVALGGTGTLSVTYVAVPGATAQVIFDVTGYFTP* |
| Ga0066797_11766852 | 3300006864 | Soil | RANGVTVALGGTGTLSVTYVAVPGATAQVIFDVTGYFTPDSSG* |
| Ga0066797_12080722 | 3300006864 | Soil | VTVALGAGGTLSVTYVAVPGATAQAIFDVTGYFTP* |
| Ga0066797_12809851 | 3300006864 | Soil | VTVALGGGGTLSVTYAAPVSGKTAHVIFDVTGYFTP* |
| Ga0066797_13142492 | 3300006864 | Soil | GGLGAGGILSVTYVAPTSGPTAHAIFDVTGYFVVTG* |
| Ga0075524_102067482 | 3300006950 | Arctic Peat Soil | GVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFQ* |
| Ga0075435_1001803831 | 3300007076 | Populus Rhizosphere | ALGTTGTPGRLSVTWVSSAGATTQVIFDVTGYFG* |
| Ga0066793_102415211 | 3300009029 | Prmafrost Soil | DTRANGVTVALGASGTLSITYVAGAGRRAQVIFDVTGYFTR* |
| Ga0066793_105095411 | 3300009029 | Prmafrost Soil | NFPLRDDRANGVTVALGAGGTLSATYVAATLGPTVQVIFDVTGYFQ* |
| Ga0066793_105168601 | 3300009029 | Prmafrost Soil | TLNFPVGDDRANGVTVALGTGGTLAVTYAAPTLGPTAQVIFDVTGYFTP* |
| Ga0066793_106442142 | 3300009029 | Prmafrost Soil | AVTVALSGTGTLSVTYAAPTSGSTAQVIFDVTGYFTP* |
| Ga0066793_106683411 | 3300009029 | Prmafrost Soil | AVTVALSGTGTLSITYAAPTSGATAQVIFDVTGYFVSAGG* |
| Ga0066793_107286141 | 3300009029 | Prmafrost Soil | DRANAVTVALSGTGTLSINYAAATSGPTAQVIFDVTGYFTP* |
| Ga0066793_108861032 | 3300009029 | Prmafrost Soil | VTVALGAGTLSVTYAPPTSGTADAVFDVTGYFVP* |
| Ga0105242_103812211 | 3300009176 | Miscanthus Rhizosphere | PAGDNRANGVTVALGTTGTPGRLSVTWVSSAGATAQVIFDVTGYFG* |
| Ga0116137_12149371 | 3300009549 | Peatland | RANAVTVALSNTGTLSVTFVAPSNGPSAQAIFDVTGYFVPAGG* |
| Ga0116138_10023571 | 3300009552 | Peatland | ANGVTVALSGTGSLSFTFVAPTPGQSTQAIFDVTGYFMP* |
| Ga0116138_10273961 | 3300009552 | Peatland | AALGTGGVLWVTFVAPTGGNSAQAIFDVTGYFQP* |
| Ga0116104_10000971 | 3300009614 | Peatland | DRANGVTVALSGTGSLSFTFVAPTPGQSTQAIFDVTGYFMP* |
| Ga0116104_10058805 | 3300009614 | Peatland | GDDRANAVTVALGAGGTLSVTMVAPSSGNSAYVIFDVTGYFVPAT* |
| Ga0182010_1000003062 | 3300014490 | Fen | AVTVALGTGGTLSVTYAAPTLGPTAQVIFDVTGYFVPGTSG* |
| Ga0182010_100529441 | 3300014490 | Fen | DRANAVTVALGTGGTLSVTYAAPTLGPTAQVIFDVTGYFVP* |
| Ga0182010_101998621 | 3300014490 | Fen | NGVTVAIGSGCTLSITYVAPSTGPTAHVIFDVTGYFVP* |
| Ga0182017_100114767 | 3300014494 | Fen | DRANGVTVAIGSGGGLSVTFVAPTLGPTAYVIFDVTGYFAP* |
| Ga0182017_100244586 | 3300014494 | Fen | GVTVAVGAGATLGVTFVAPHPGPTAHVIFDVTGYFVH* |
| Ga0182017_101366561 | 3300014494 | Fen | LGSGGTLSVTYVANSSSATTHVVFDVTGYFTPAG* |
| Ga0182017_101433713 | 3300014494 | Fen | AVTVGTGGTLSVTFVAPAPGPTAHAIFDVTGFFVP* |
| Ga0182017_101528792 | 3300014494 | Fen | VTVALGSGGTLSVTYVASASSASAHVIFDVTGYFVP* |
| Ga0182017_101530861 | 3300014494 | Fen | VGDDRANAVTVALGAGVTLSITFVAPSSGPTAHAIFDVTGYFTP* |
| Ga0182017_103413331 | 3300014494 | Fen | DRANAVTVALGSGGTLSVTYVANSSSATTHVVFDVTGYFTQ* |
| Ga0182017_106277222 | 3300014494 | Fen | DRANGVTVAIGSGGGLSVTFVAPTLGPTAYVIFDVTGYFAPAASSS* |
| Ga0182017_106351722 | 3300014494 | Fen | LNFPVGDDRANAVTVALGAGGTLSVTYAAGTLGPTAQVIFDVTGYFTP* |
| Ga0182017_108330031 | 3300014494 | Fen | VTVALGTGGTLSVTYAAPTLGPTAQVIFDVTGYFVP* |
| Ga0182011_100194271 | 3300014496 | Fen | AVTVALGTGGTLSITFVAPSNGPSAQAIFDLTGYFVPAGS* |
| Ga0182011_100601411 | 3300014496 | Fen | GDDRANAVTVALGTGGTLSITFVAPSNGPSAQAIFDLTGYYQ* |
| Ga0182011_100875964 | 3300014496 | Fen | TVALGSGGTLSVTYVDPWPGHSAQAVFDVTGYFTPDASGARRTKSS* |
| Ga0182011_103771522 | 3300014496 | Fen | DRANAVTVALGSGGTLSVTYVSNNSSATTHVVFDVTGYFTPAG* |
| Ga0182011_104016852 | 3300014496 | Fen | DRANAVTVALGSGGTLSVTYVSNNSSATTHVVFDVTGYFTP* |
| Ga0182011_107724081 | 3300014496 | Fen | VALGSGGTLSVTYVANSSSATTHVVFDVTGYFTQ* |
| Ga0182019_100124932 | 3300014498 | Fen | DRANAVTVALGTGGTLSVTYAAPTLGPTAQVIFDVTGYFVPGTSG* |
| Ga0182019_100500081 | 3300014498 | Fen | AVTVALGAGGTLSVTYAAGTLGPTAQVIFDVTGYFTP* |
| Ga0182019_110431651 | 3300014498 | Fen | DRANGVTVALGAGGTLSATYAAPTLGPTAAVIFDVTGYFVH* |
| Ga0182021_101391445 | 3300014502 | Fen | VALGAGGTLSATYAAPTLGPTAAVIFDVTGYFVH* |
| Ga0182021_101400424 | 3300014502 | Fen | LGDDRANGVTVAIGTAGTLSITYVAPSAGPIAHVIFDVTGYFVP* |
| Ga0182021_101520153 | 3300014502 | Fen | DRANGVTVALGAGGTLSVTYAASTLGPTAQVIFDVTGYFVP* |
| Ga0182021_102251841 | 3300014502 | Fen | DRANGVTVAIGSGGTLSITYVAPSTGPTAHVIFDVTGYFVP* |
| Ga0182021_105231472 | 3300014502 | Fen | DDRANAVTVALGSGGTLSVTYVANSSSATTHVVFDVTGYFTPAG* |
| Ga0182021_106561192 | 3300014502 | Fen | AGDDRANGVTVALSATGTLSITFVAPSNGPTAQAIFDVTGYYL* |
| Ga0182021_110051421 | 3300014502 | Fen | SDDRANGVTVALGSGGTLSVTYVASASSASTHVIFDVTGYFVP* |
| Ga0182021_112445272 | 3300014502 | Fen | TVALNASGTLAVTFVAPYSGPTAQVVFDVTGYFTQ* |
| Ga0182021_115070512 | 3300014502 | Fen | TVALGSGGSLSVTYVANSSSATTHVVFDVTGYFVPAG* |
| Ga0182021_118706992 | 3300014502 | Fen | NFPINDDRANAVTVALFTDGSLSVTYGAPVAGPSAHVIFDVSGYFSS* |
| Ga0182021_122614742 | 3300014502 | Fen | LGSGGTLSVTYVDPWPGHSAQAVFDVTGYFTPAS* |
| Ga0182021_129261231 | 3300014502 | Fen | NAVTVALGSGTLSITFVAPSNGPTAQGIFDVTGYFVPSGG* |
| Ga0182027_1001257411 | 3300014839 | Fen | NDDRANAVTVALGAGGTLSVTYVDPWTDQSAQAIFDASGYYQ* |
| Ga0182027_102306612 | 3300014839 | Fen | AVTVALGTGGTLSITFVAPSNGPSAQAIFDLTGYYQ* |
| Ga0182027_104677492 | 3300014839 | Fen | ALGAGGTLSITYVAPSAGPTTQVILDVTGYFAPGS* |
| Ga0182027_108002681 | 3300014839 | Fen | AVTVALGSGGTLSVTYVANSSSATTHVVFDVTGYFTPAG* |
| Ga0182027_108173122 | 3300014839 | Fen | NDDRANAVTVALGAGGTLSVTYVDPWTDQSAQAIFDASGYFVPGS* |
| Ga0182027_108266511 | 3300014839 | Fen | DRANGVTVAVGPGGTLSATYVAPTSGKTTQVIFDVTGYFTP* |
| Ga0167650_10023297 | 3300015203 | Glacier Forefield Soil | TVLLGPGGTLGITYVATTGRTAQVVFDVTGYFLP* |
| Ga0132256_1000370961 | 3300015372 | Arabidopsis Rhizosphere | NRANGVTVALGTTGTPGRLSVTWVSAAGATTEVIFDVTGYFG* |
| Ga0132257_1033804401 | 3300015373 | Arabidopsis Rhizosphere | RATGVTVALRAGGTPGSLSVTYVAGPSSATTHVVFDVTGYFQ* |
| Ga0132255_1012641322 | 3300015374 | Arabidopsis Rhizosphere | ALRAGGTPGSLSVTYVAGPSSATTHVVFDVTGYFQ* |
| Ga0187849_10000951 | 3300017929 | Peatland | DRANGVTVALSGTGSLSFTFVAPTPGQSTQAIFDVTGYFMP |
| Ga0187849_10160075 | 3300017929 | Peatland | GDDRANAVTVALGAGGTLSVTMVAPSSGNSAYVIFDVTGYFVPAT |
| Ga0187854_100454612 | 3300017938 | Peatland | LGSGGTLATTYAASDLSTTAHVIFDVAGYFTPATSQ |
| Ga0187850_100198852 | 3300017941 | Peatland | DRANAVTVALGAGGTLSVTMVAPSSGSSAYAIFDVTGYFTPAGG |
| Ga0187873_10658773 | 3300018013 | Peatland | NGVTVALSGTGSLSFTFVAPTPGQSTQAIFDVTGYFMP |
| Ga0187866_10170022 | 3300018015 | Peatland | TVALGAGGTLSVTMVAPSSGSSAYAIFDVTGYFTPAGG |
| Ga0187886_100083926 | 3300018018 | Peatland | DDRANAVTVALSDDGKLYVTYAAPVPNTPTAHVIFDVTGYFLK |
| Ga0187886_10749203 | 3300018018 | Peatland | FPLGDDRANAVTVALSGTGTLSVTYAAPTLGPTAHVIFDVTGYFTT |
| Ga0187858_100323861 | 3300018057 | Peatland | AVTVALGAGGTLSVTMVAPSSGSSAYAIFDVTGYFTPAGG |
| Ga0184637_105801362 | 3300018063 | Groundwater Sediment | RANGVTVAVVSGATLSVSYLALGGTTDFIFDVTGYFVD |
| Ga0182028_10387712 | 3300019788 | Fen | NFPVGDDRANGVTVAVGPGGTLSATYVAPTSGKTTQVIFDVTGYFTP |
| Ga0182028_11398521 | 3300019788 | Fen | AVAVQLGAGGTLSITFVAPSTGPTAQAIFDLTGYFAPAGG |
| Ga0222623_100284951 | 3300022694 | Groundwater Sediment | RANGVTLALGNGGTLSGTFLPAWGNGGSQLIFDVTGYFIP |
| Ga0256681_109169191 | 3300023311 | Freshwater | LGTGGTLSITFVAPSNGPRAHAIFDVTGYFVPAGS |
| Ga0256681_114779421 | 3300023311 | Freshwater | VTVALGAGGSLSVTYAASTLGPTAQVIFDVTGYFTP |
| Ga0256681_122314952 | 3300023311 | Freshwater | PVGDDRANAGTVALGTGGTLSVTYAASTLGPTAQVIFDVTGYFTP |
| Ga0208037_10548192 | 3300025448 | Peatland | LWSTVALGAGGPLSITFVAPNNGPTAHAIFDVTGYFVPAGG |
| Ga0208192_1000037129 | 3300025477 | Peatland | DDRANGVTVALSGTGSLSFTFVAPTPGQSTQAIFDVTGYFMP |
| Ga0208079_10235474 | 3300025481 | Arctic Peat Soil | TVALGAGGTLSATYVAATLGPTTQVIFDVTGYFLP |
| Ga0207932_10174871 | 3300025495 | Arctic Peat Soil | NFPVGDDRANGVTVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFVP |
| Ga0207932_10205611 | 3300025495 | Arctic Peat Soil | NFPVGDDRANGVTVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFQ |
| Ga0207932_10276521 | 3300025495 | Arctic Peat Soil | FPVRDDRANGVTVALGAGGTLSATYVAATAGPTTQVIFDVTGYFQ |
| Ga0207932_10419732 | 3300025495 | Arctic Peat Soil | GVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFQ |
| Ga0208819_10346522 | 3300025498 | Peatland | TAALGTGGVLWVTFVAPTGGNSAQAIFDVTGYFQP |
| Ga0208584_10187942 | 3300025533 | Arctic Peat Soil | NGVTVALGAGGTLSATYVATTLGPTAQVIFDVTGYFVP |
| Ga0208584_10648063 | 3300025533 | Arctic Peat Soil | REIRGSLPSSVGDDRANGVTVALGAGGALSVTFVAPYSGPTTQVIFDVTGYYMP |
| Ga0208584_10669552 | 3300025533 | Arctic Peat Soil | LRDDRANGVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFQ |
| Ga0209385_10312104 | 3300025650 | Arctic Peat Soil | GDDRANAVTVALGGGGTLSVTYVAVPGATAQVIFDVTGYFTP |
| Ga0209385_11040882 | 3300025650 | Arctic Peat Soil | VTVALGSAGTLSVTYAPPTPGTTHAVFDVTGYFAP |
| Ga0209744_10359003 | 3300025692 | Arctic Peat Soil | ANGVTVALGAGGTLSATYVAATAGPTTQVIFDVTGYFQ |
| Ga0209123_11136743 | 3300025718 | Arctic Peat Soil | GVTVALGAGGTLSATYVAATAGPTTQVIFDVTGYFVP |
| Ga0209638_10325814 | 3300025725 | Arctic Peat Soil | NAVTVALSGSGALSVTYAAPTLSPTAHVIFDVTGYFVPAAS |
| Ga0209638_10432201 | 3300025725 | Arctic Peat Soil | ANAVTVALSGTGTLSITYVAVPGATAQVIFDVTGYFTP |
| Ga0209638_10767251 | 3300025725 | Arctic Peat Soil | RANAVTVALSGTGTLSITYVAVPGATAQVIFDVTGYFTP |
| Ga0209745_10074571 | 3300025739 | Arctic Peat Soil | PVGDDRATGVTVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFVP |
| Ga0209747_10389664 | 3300025750 | Arctic Peat Soil | NGVTVALSGTGTLSATYASPVGGATAQVLFDVTGYFVP |
| Ga0209747_10414421 | 3300025750 | Arctic Peat Soil | VTVALGAGGTLSVTFVAPTPGPTVHVIFDATGYFQS |
| Ga0209747_11241341 | 3300025750 | Arctic Peat Soil | NGVTVALGAGGTLSVTYVAPAQGPIAHVIFDVTGYFGFF |
| Ga0209539_10899861 | 3300025764 | Arctic Peat Soil | NFPVGDDRANAVTLALGGGGTLSVTYAAPAFGPTAQVIFDVTGYFRP |
| Ga0209539_12363051 | 3300025764 | Arctic Peat Soil | GDDRATGVTVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFQ |
| Ga0209539_12849401 | 3300025764 | Arctic Peat Soil | VTAALGGGNLSVTYAAATSGPTAQVIFDVTGYFTP |
| Ga0209539_13143061 | 3300025764 | Arctic Peat Soil | TVALDAGGTLSVTYAASTLGPTAQVIFDVTGYFTP |
| Ga0208457_10059105 | 3300025812 | Peatland | AGDDRANAVTVALGAGGTLSVTMVAPSSGNSAYVIFDVTGYFVPAT |
| Ga0209538_11164652 | 3300025846 | Arctic Peat Soil | GDTRANGVTVALGASGTLSITYVAGVGRRAQVIFDVTGYFTP |
| Ga0209538_11909641 | 3300025846 | Arctic Peat Soil | GVTVALGAGGTLSATYVVSTLGPTAHVIFDVTGYFQ |
| Ga0209014_102139672 | 3300025857 | Arctic Peat Soil | AVTVALGGGGTLSVTYVAVPGATAQVIFDVTGYFAP |
| Ga0209429_100677551 | 3300025864 | Arctic Peat Soil | ANGVTVALSAKGTLSATYAAATLGPTTQVIFDVTGYFVR |
| Ga0209429_101211381 | 3300025864 | Arctic Peat Soil | NGVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFVP |
| Ga0209429_102463631 | 3300025864 | Arctic Peat Soil | DDRANGVTVALSGTGTLSVTYAAPTLGPTAQVLFDVTGYFQ |
| Ga0209429_102781031 | 3300025864 | Arctic Peat Soil | ALSGTGTLSVTYAAPTLGPTAQVLFDVTGYFVPSGTATGG |
| Ga0209226_101119981 | 3300025865 | Arctic Peat Soil | GVTVALGAGGTLSATYASPVGGATAQVLFDVTGYFVP |
| Ga0209584_100381062 | 3300025878 | Arctic Peat Soil | AVTVALGGGGTLSITYAAPTSGKTAHVIFDVTGYFTP |
| Ga0209584_102609532 | 3300025878 | Arctic Peat Soil | ANAVTVALSGTGTLSVTYAAPTSGPTAQVIFDVTGYFTP |
| Ga0209584_103855142 | 3300025878 | Arctic Peat Soil | TADAWPRLALGGGTLSITYAAPTLGKTAHAIFDVTGYFVP |
| Ga0209584_104436391 | 3300025878 | Arctic Peat Soil | NDDRANAVTVALGAGGSLSVTYAAPTLGKTAHVIFDVTGYFAG |
| Ga0209540_100168985 | 3300025888 | Arctic Peat Soil | VGDDRANGVTVALGAGGTLSATYVAATLGPTAQVVFDVTGYFVP |
| Ga0209540_101002252 | 3300025888 | Arctic Peat Soil | LRDDRANGVTVALGAGGTLSATYVAATLGPTTQVIFDVTGYFR |
| Ga0209540_104115132 | 3300025888 | Arctic Peat Soil | PLGDDRANGVTVALGPTGTLSITYVAPSAGPIAHVIFDVTGYFVP |
| Ga0209540_106564411 | 3300025888 | Arctic Peat Soil | ADDRANGVTVALSSGGTLSATYAAASTSSTAQILFDVTGYFVP |
| Ga0207687_104183182 | 3300025927 | Miscanthus Rhizosphere | GVTVALGTTGTPGRLSVTWVSAAGATAQVIFDVTGYFG |
| Ga0209840_10981872 | 3300026223 | Soil | FPLRDDRANGVTVALGAGGTLSATYVAATLGPTVQVIFDVTGYFQ |
| Ga0209880_10083293 | 3300026271 | Soil | NFPLADNRANGVTVALGGTGTLSVTYVAVPGATAQVIFDVTGYFVAAG |
| Ga0209880_10180881 | 3300026271 | Soil | NFPLADNRANGVTVALGGTGTLSVTYVAVPGATAQVIFDVTGYFTP |
| Ga0209880_10497621 | 3300026271 | Soil | NGVTVALGGGGTLSVTYVAAPGATAQVIFDVTGYFTP |
| Ga0209880_10825382 | 3300026271 | Soil | NRANGVTVALGAGGTLSATYVAATAGPTAQVIFDVTGYFQ |
| Ga0209913_10058844 | 3300026272 | Soil | NFPLADNRANGVTVALGGGGTLSVTYVAVPGATAQVIFDVTGYFVP |
| Ga0209118_11501092 | 3300027674 | Forest Soil | VGDNRANGVTVALGAGGTLSATYLASTGASTQLIFDVTGYFVP |
| Ga0209777_100013911 | 3300027896 | Freshwater Lake Sediment | GVSVALGPGGSLSVTYVASTLGPTAQVIFDVTGYFAP |
| Ga0302169_100898031 | 3300028679 | Fen | VGDDRANAVTVALGAGGTLSVTYAAATQGPTAQVIFDVTGYFTP |
| Ga0302262_103462911 | 3300028743 | Fen | GLTVALGSGGKLSATYVAPAGNTTQVIFDVTGYFTP |
| Ga0302291_103364561 | 3300028865 | Fen | TVALNTTDKPGTLSVTYVASAGKTTQVLFDVTGYFTP |
| Ga0302298_102601651 | 3300029980 | Fen | PLGDDRANAVTVQLGAGGTLSITFVAPSNGPTAHAIFDGTGYFVAAGG |
| Ga0311332_106033622 | 3300029984 | Fen | AVSVALGAGGTLSVTYAAPTLGPTAQEIFDVTGYFVP |
| Ga0311332_112722801 | 3300029984 | Fen | DRANAVTVALGTGGTLSVTYAASTLGPTAQVIFDVTGYFVP |
| Ga0311336_100878611 | 3300029990 | Fen | VALGTGGIGGILSVTYAAPTLGPTAQVIFDVTGYFTS |
| Ga0311336_109396162 | 3300029990 | Fen | PVGDDRANAVTVALGTGGTLSVTYVSDPGATSHVVFDVTGYFIH |
| Ga0311337_119600121 | 3300030000 | Fen | RANGLTVALGSGGKLSATYVAPAGNTTQVIFDVTGYFTP |
| Ga0311350_100130616 | 3300030002 | Fen | ANGVTVGLGSGGTLSATYAATPGATVEVILDVTGYFAPGP |
| Ga0311350_115479101 | 3300030002 | Fen | RANAVTGALSPSGTLSVTYAAPVLGKTADAIFDVTGYFVI |
| Ga0302286_104964351 | 3300030047 | Fen | RANAVTVALGTGGTLSVTYAASTLGPTAHVLFDVTGYFMP |
| Ga0311333_109570123 | 3300030114 | Fen | LNFPVGDDRANAVTVALGAGGTLSVTYAAGTLGPTAQVIFDVTGYFTP |
| Ga0311333_118787042 | 3300030114 | Fen | VAVAVGSDGRLWVTFVAPYNGPTAHAIFDVTGYFAIG |
| Ga0311349_106111443 | 3300030294 | Fen | LADDRANAVTVALGTGGTLSVTYAAATLGPTAQVIFDVTGYFAP |
| Ga0311349_106166771 | 3300030294 | Fen | VTVALGTGGTLSVTYAAPTLGPTAQVIFDVTGYFVPGTSG |
| Ga0311349_112589372 | 3300030294 | Fen | GDDRANAVTVSLSGDGRLFVTYAAPTGPPTSHAILDVTGYFVH |
| Ga0311360_102477043 | 3300030339 | Bog | NDDRANAVSVALAGDGRLSVTYAAPKGATAQVIFDVTGYFLK |
| Ga0311360_115264591 | 3300030339 | Bog | NFPVGDDRANGVTVALGAGGTLSVTYVGPNSSAYAHVIFDVTGYFVP |
| Ga0302323_1003101721 | 3300031232 | Fen | DDRANAVTVALGTGGTLSVTYAASTLGPTAQVIFDVTGYFTP |
| Ga0302323_1025061761 | 3300031232 | Fen | NAVTVALGAGTLSVTYAAPVAGKTAHAIFDVTGYFAP |
| Ga0265328_104457661 | 3300031239 | Rhizosphere | ANAVTVALGIGGTLSVTYAAPTLGPSAQVIFDVTGYFVP |
| Ga0311364_103844081 | 3300031521 | Fen | VTVALGAGGKLSVTYVAPSGRTANVIFDVTGYFLP |
| Ga0318496_107682562 | 3300031713 | Soil | TLNFPLGDNRANGVTVALSNTGTLSITYVSAAGRTAHVIFDVTGYFTH |
| Ga0311351_106341761 | 3300031722 | Fen | VGLGSGGTLSATYAATPGATVEVILDVTGYFAPGP |
| Ga0311351_108790712 | 3300031722 | Fen | LNFPLADDRANAVTVALGTGGTLSVTYAAGTLGPTAQVIFDVTGYFAP |
| Ga0302321_1002076622 | 3300031726 | Fen | AVTVALNATDKPGTLSVTYVASAGKTTQVLFDVTGYFTP |
| Ga0302321_1020455252 | 3300031726 | Fen | FPVGDDRANAVTVALSPGGTLSVTYAASTLGPTAQVIFDVTGYFVP |
| Ga0302321_1024778202 | 3300031726 | Fen | LNFPLGDDRANGVTVALGSGGTLSVTYAAGTLGPTAHLIFDVTGYFAH |
| Ga0302321_1032742901 | 3300031726 | Fen | DNRANGLTVALGSGGKLSATYVAPAGNTTQVIFDVTGYFTP |
| Ga0318564_104862411 | 3300031831 | Soil | DTRANGVIVPLAASGTPGSLSVVYMAAGGATTQVIFDVTGYYD |
| Ga0302322_1008719921 | 3300031902 | Fen | ANAVTVQLGAGGTLSITFVAPSNGPTAQAIFDVTGYFVAAGG |
| Ga0302322_1020743072 | 3300031902 | Fen | AVTVALGAGGTLSITFVAPSNGPTAQAIFDGTGYFVAAGG |
| Ga0302322_1035678771 | 3300031902 | Fen | TVGLCAAGTLSITFVAPSNGPTAQAIFDGTGYFVPAG |
| Ga0311367_107974242 | 3300031918 | Fen | NRANGLTVALGSGGKLSATYVAPAGNTTQVIFDVTGYFTP |
| Ga0311367_114904251 | 3300031918 | Fen | VTVALGTGGTLSVTFVAPTAGPTTQAIFDVTGYFVAKG |
| Ga0326597_104796731 | 3300031965 | Soil | PLADNRATGVTVALGAGGTLSATYVAAAAGGTTQLLFDVTGYFVD |
| Ga0318562_103972482 | 3300032008 | Soil | VTVALSNTGTLSITYVSAAGRTAHVIFDVTGYFTH |
| Ga0318533_112583631 | 3300032059 | Soil | GDTRANGVIVPLAASGTPGSLSVVYMAAGGATTQVIFDVTGYYD |
| Ga0318505_105994191 | 3300032060 | Soil | GDNRANGVTVALSNTGTLSITYVSAAGRTAHVIFDVTGYFTH |
| Ga0318524_107325421 | 3300032067 | Soil | PKGDTRANGVTVPLAASGTPGSLSVVYMAAGGATTQVIFDVTGYYD |
| Ga0315268_105763882 | 3300032173 | Sediment | TLNVPLGDNRANGVTVALGAGGKLSVTFVAATGKKAHAIFDVTGYFTP |
| Ga0315270_101234981 | 3300032275 | Sediment | RDNRANGLTVALSRLGTLSITSTAAKTHVIFDVTGYFQ |
| Ga0310914_114939171 | 3300033289 | Soil | DTRANGVTVPLAASGTPGSLSVVYMAAGGATTQVIFDVTGYYD |
| Ga0316620_113164061 | 3300033480 | Soil | NFPVNDDRANAVIVRHDGGHLSVTYAAPTLGPSAHVIIDVTGYFGSY |
| Ga0334821_039035_3_122 | 3300033798 | Soil | ANAVTVALGTGGTLSVTYAASTLGPTAQVIFDVTGYFTP |
| Ga0334816_000997_3_137 | 3300033819 | Soil | PAGDDRANAVTVALSATGTLSITFVAPSSGPTAHAIFDVTGYYQ |
| Ga0334816_009298_1_135 | 3300033819 | Soil | VADDRANGVTVAIGAGGTLSVTFVAPAAGPTAHVIFDVTGYFVP |
| Ga0334816_068309_524_658 | 3300033819 | Soil | DDRANAVTVALGSGTLSITFVAPSNGPTAQGIFDVTGYFVPSGG |
| Ga0334817_097992_3_116 | 3300033820 | Soil | AVTVALGTGGTLSVTYAASTLGPTAQVIFDVTGYFAP |
| Ga0334822_040465_2_130 | 3300034070 | Soil | GDDRANAVTVALSATGTLSITFVAPSSGPTAHAIFDVTGYYQ |
| Ga0370479_0085300_680_820 | 3300034123 | Untreated Peat Soil | FPVGDDRANEVTVALGAGGTLSVTFVAPAPGPVAHVIFDVTGYFQS |
| Ga0370501_0200620_1_135 | 3300034195 | Untreated Peat Soil | RANGVTVALSGAGTLSATYAAPTSGPTTQVIFHVTGYFVPATHP |
| ⦗Top⦘ |