| Basic Information | |
|---|---|
| Family ID | F019897 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 227 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ARREKQNPLAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAEMHP |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 227 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.44 % |
| % of genes near scaffold ends (potentially truncated) | 97.36 % |
| % of genes from short scaffolds (< 2000 bps) | 91.19 % |
| Associated GOLD sequencing projects | 148 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.806 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.396 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.159 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.899 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 227 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 62.56 |
| PF13561 | adh_short_C2 | 18.06 |
| PF02585 | PIG-L | 2.64 |
| PF13620 | CarboxypepD_reg | 1.32 |
| PF10633 | NPCBM_assoc | 1.32 |
| PF04014 | MazE_antitoxin | 0.88 |
| PF03807 | F420_oxidored | 0.88 |
| PF00535 | Glycos_transf_2 | 0.44 |
| PF07883 | Cupin_2 | 0.44 |
| PF03544 | TonB_C | 0.44 |
| PF04055 | Radical_SAM | 0.44 |
| PF14534 | DUF4440 | 0.44 |
| PF00561 | Abhydrolase_1 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 227 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 2.64 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.81 % |
| Unclassified | root | N/A | 28.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000178|FW301_c1009162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300001593|JGI12635J15846_10684772 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300002908|JGI25382J43887_10034952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2722 | Open in IMG/M |
| 3300002914|JGI25617J43924_10029890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1932 | Open in IMG/M |
| 3300002914|JGI25617J43924_10110944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300002917|JGI25616J43925_10188073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300004082|Ga0062384_100334759 | Not Available | 953 | Open in IMG/M |
| 3300004092|Ga0062389_101204758 | Not Available | 943 | Open in IMG/M |
| 3300004479|Ga0062595_102077966 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300004635|Ga0062388_100321301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300004635|Ga0062388_101379366 | Not Available | 707 | Open in IMG/M |
| 3300005160|Ga0066820_1018655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300005166|Ga0066674_10280436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300005172|Ga0066683_10190521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
| 3300005179|Ga0066684_10032859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2845 | Open in IMG/M |
| 3300005179|Ga0066684_10425873 | Not Available | 892 | Open in IMG/M |
| 3300005332|Ga0066388_101359436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300005332|Ga0066388_108182881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005526|Ga0073909_10379343 | Not Available | 661 | Open in IMG/M |
| 3300005537|Ga0070730_10468918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300005557|Ga0066704_10682977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300005558|Ga0066698_10114225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1794 | Open in IMG/M |
| 3300005559|Ga0066700_10007754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5369 | Open in IMG/M |
| 3300005591|Ga0070761_10322866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300005602|Ga0070762_10942380 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005921|Ga0070766_10554543 | Not Available | 768 | Open in IMG/M |
| 3300005921|Ga0070766_11075929 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005921|Ga0070766_11082429 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006102|Ga0075015_100213716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300006172|Ga0075018_10474793 | Not Available | 648 | Open in IMG/M |
| 3300006796|Ga0066665_10494941 | Not Available | 1002 | Open in IMG/M |
| 3300006804|Ga0079221_10544459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300006954|Ga0079219_11393853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300007258|Ga0099793_10070278 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300007265|Ga0099794_10611693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300009038|Ga0099829_10115309 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300009088|Ga0099830_10573173 | Not Available | 925 | Open in IMG/M |
| 3300009088|Ga0099830_11236546 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009088|Ga0099830_11812627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300009089|Ga0099828_10505838 | Not Available | 1089 | Open in IMG/M |
| 3300009143|Ga0099792_10800354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300009521|Ga0116222_1413205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300009545|Ga0105237_12630285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300009545|Ga0105237_12738284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300009638|Ga0116113_1162889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300009792|Ga0126374_11466101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300010046|Ga0126384_11080966 | Not Available | 734 | Open in IMG/M |
| 3300010048|Ga0126373_12081133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300010337|Ga0134062_10172987 | Not Available | 971 | Open in IMG/M |
| 3300010358|Ga0126370_12666150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300010360|Ga0126372_10540086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300010361|Ga0126378_10740849 | Not Available | 1093 | Open in IMG/M |
| 3300010361|Ga0126378_11147338 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300010361|Ga0126378_12123170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300010376|Ga0126381_103350357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300010865|Ga0126346_1405277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300010880|Ga0126350_11800693 | Not Available | 1101 | Open in IMG/M |
| 3300011269|Ga0137392_10490814 | Not Available | 1020 | Open in IMG/M |
| 3300011269|Ga0137392_11304135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300011270|Ga0137391_10361072 | Not Available | 1247 | Open in IMG/M |
| 3300011270|Ga0137391_10594591 | Not Available | 928 | Open in IMG/M |
| 3300011270|Ga0137391_10676790 | Not Available | 859 | Open in IMG/M |
| 3300011270|Ga0137391_10978524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300011270|Ga0137391_11089846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300011271|Ga0137393_11587119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300011271|Ga0137393_11715277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300012096|Ga0137389_10054915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3023 | Open in IMG/M |
| 3300012096|Ga0137389_10750941 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300012096|Ga0137389_11164219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012189|Ga0137388_10305513 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300012189|Ga0137388_11900965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012202|Ga0137363_10600263 | Not Available | 929 | Open in IMG/M |
| 3300012202|Ga0137363_11442650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300012203|Ga0137399_10427709 | Not Available | 1106 | Open in IMG/M |
| 3300012205|Ga0137362_10551270 | Not Available | 996 | Open in IMG/M |
| 3300012205|Ga0137362_10738646 | Not Available | 845 | Open in IMG/M |
| 3300012206|Ga0137380_10905114 | Not Available | 758 | Open in IMG/M |
| 3300012207|Ga0137381_10357272 | Not Available | 1274 | Open in IMG/M |
| 3300012349|Ga0137387_10138877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1724 | Open in IMG/M |
| 3300012349|Ga0137387_10565491 | Not Available | 825 | Open in IMG/M |
| 3300012357|Ga0137384_11031685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012359|Ga0137385_10968104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300012362|Ga0137361_10760544 | Not Available | 883 | Open in IMG/M |
| 3300012362|Ga0137361_11195545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300012582|Ga0137358_10063240 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300012683|Ga0137398_11193039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012918|Ga0137396_10119174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1901 | Open in IMG/M |
| 3300012918|Ga0137396_11217114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012923|Ga0137359_10044043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3870 | Open in IMG/M |
| 3300012923|Ga0137359_10069638 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
| 3300012923|Ga0137359_10689689 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300012923|Ga0137359_11566983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300012925|Ga0137419_10192559 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300012925|Ga0137419_10827722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300012925|Ga0137419_11681417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012927|Ga0137416_12025575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012929|Ga0137404_11608174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012931|Ga0153915_11992173 | Not Available | 680 | Open in IMG/M |
| 3300012944|Ga0137410_10007387 | All Organisms → cellular organisms → Bacteria | 7459 | Open in IMG/M |
| 3300012972|Ga0134077_10343206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300014154|Ga0134075_10379537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300014157|Ga0134078_10064715 | Not Available | 1298 | Open in IMG/M |
| 3300015052|Ga0137411_1029123 | Not Available | 1216 | Open in IMG/M |
| 3300015054|Ga0137420_1300536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300015162|Ga0167653_1043287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300015197|Ga0167638_1061045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300015197|Ga0167638_1069032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300015357|Ga0134072_10173619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300016270|Ga0182036_11769464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300016294|Ga0182041_11119713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300017659|Ga0134083_10047184 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300017822|Ga0187802_10103041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300017924|Ga0187820_1334672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300017932|Ga0187814_10430289 | Not Available | 516 | Open in IMG/M |
| 3300017955|Ga0187817_10414629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300018012|Ga0187810_10083089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
| 3300018431|Ga0066655_11366270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300018468|Ga0066662_10132612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1845 | Open in IMG/M |
| 3300019866|Ga0193756_1033345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300020199|Ga0179592_10131822 | Not Available | 1146 | Open in IMG/M |
| 3300020199|Ga0179592_10211290 | Not Available | 878 | Open in IMG/M |
| 3300020580|Ga0210403_10898963 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300020580|Ga0210403_10978332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300020580|Ga0210403_11047063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300020581|Ga0210399_10495031 | Not Available | 1016 | Open in IMG/M |
| 3300020581|Ga0210399_10549948 | Not Available | 957 | Open in IMG/M |
| 3300020583|Ga0210401_11242653 | Not Available | 603 | Open in IMG/M |
| 3300020583|Ga0210401_11364641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300021088|Ga0210404_10036044 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300021170|Ga0210400_10740356 | Not Available | 807 | Open in IMG/M |
| 3300021171|Ga0210405_10955261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300021178|Ga0210408_10580974 | Not Available | 888 | Open in IMG/M |
| 3300021180|Ga0210396_10815965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 800 | Open in IMG/M |
| 3300021405|Ga0210387_10096083 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300021407|Ga0210383_11409988 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021407|Ga0210383_11709573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021420|Ga0210394_11372004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300021432|Ga0210384_10130355 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300021478|Ga0210402_11181576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300021478|Ga0210402_11452608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300021479|Ga0210410_10080514 | All Organisms → cellular organisms → Bacteria | 2863 | Open in IMG/M |
| 3300021560|Ga0126371_11857253 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300021560|Ga0126371_12698503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300022531|Ga0242660_1163822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300024251|Ga0247679_1007852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1833 | Open in IMG/M |
| 3300024286|Ga0247687_1064337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300025509|Ga0208848_1110082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300025939|Ga0207665_10683159 | Not Available | 806 | Open in IMG/M |
| 3300026214|Ga0209838_1015694 | Not Available | 1048 | Open in IMG/M |
| 3300026277|Ga0209350_1006786 | All Organisms → cellular organisms → Bacteria | 3889 | Open in IMG/M |
| 3300026309|Ga0209055_1198983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300026330|Ga0209473_1246864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300026335|Ga0209804_1211530 | Not Available | 790 | Open in IMG/M |
| 3300026482|Ga0257172_1086031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300026536|Ga0209058_1124817 | Not Available | 1263 | Open in IMG/M |
| 3300026538|Ga0209056_10665593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300026547|Ga0209156_10191394 | Not Available | 978 | Open in IMG/M |
| 3300026548|Ga0209161_10494634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300026551|Ga0209648_10492938 | Not Available | 718 | Open in IMG/M |
| 3300026555|Ga0179593_1069845 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300026557|Ga0179587_10517246 | Not Available | 783 | Open in IMG/M |
| 3300026557|Ga0179587_10854782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300026557|Ga0179587_11108684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300026557|Ga0179587_11168916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300027109|Ga0208603_1048351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300027376|Ga0209004_1035043 | Not Available | 828 | Open in IMG/M |
| 3300027629|Ga0209422_1049944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300027643|Ga0209076_1013579 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300027651|Ga0209217_1206345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300027655|Ga0209388_1022857 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300027655|Ga0209388_1109606 | Not Available | 790 | Open in IMG/M |
| 3300027737|Ga0209038_10154210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300027775|Ga0209177_10032177 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300027787|Ga0209074_10433931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300027824|Ga0209040_10405122 | Not Available | 632 | Open in IMG/M |
| 3300027846|Ga0209180_10259668 | Not Available | 999 | Open in IMG/M |
| 3300027857|Ga0209166_10667850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300027862|Ga0209701_10109151 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300027862|Ga0209701_10402964 | Not Available | 762 | Open in IMG/M |
| 3300027867|Ga0209167_10283560 | Not Available | 894 | Open in IMG/M |
| 3300027879|Ga0209169_10561537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300027882|Ga0209590_10075773 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300027882|Ga0209590_10416337 | Not Available | 868 | Open in IMG/M |
| 3300027884|Ga0209275_10423664 | Not Available | 753 | Open in IMG/M |
| 3300027889|Ga0209380_10546475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300027895|Ga0209624_10648007 | Not Available | 699 | Open in IMG/M |
| 3300027903|Ga0209488_11004133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300027908|Ga0209006_10116187 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300027915|Ga0209069_11011824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300028072|Ga0247675_1041627 | Not Available | 677 | Open in IMG/M |
| 3300028536|Ga0137415_10643914 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300028536|Ga0137415_11472583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300028731|Ga0302301_1039554 | Not Available | 1319 | Open in IMG/M |
| 3300028792|Ga0307504_10118730 | Not Available | 864 | Open in IMG/M |
| 3300028800|Ga0265338_10985860 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300029636|Ga0222749_10073570 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300029636|Ga0222749_10239405 | Not Available | 920 | Open in IMG/M |
| 3300029636|Ga0222749_10828752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300030746|Ga0302312_10322042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300030813|Ga0265750_1010733 | Not Available | 1052 | Open in IMG/M |
| 3300031240|Ga0265320_10376916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300031708|Ga0310686_106263282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300031718|Ga0307474_10016142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5413 | Open in IMG/M |
| 3300031753|Ga0307477_10111277 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300031753|Ga0307477_10141391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1679 | Open in IMG/M |
| 3300031753|Ga0307477_10953217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300031754|Ga0307475_10131648 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300031754|Ga0307475_11098514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300031768|Ga0318509_10010824 | All Organisms → cellular organisms → Bacteria | 3940 | Open in IMG/M |
| 3300031821|Ga0318567_10192372 | Not Available | 1138 | Open in IMG/M |
| 3300031823|Ga0307478_10524890 | Not Available | 988 | Open in IMG/M |
| 3300031823|Ga0307478_11391995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031823|Ga0307478_11393352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031831|Ga0318564_10521063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031962|Ga0307479_10113105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2642 | Open in IMG/M |
| 3300031962|Ga0307479_10310616 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300031962|Ga0307479_10712066 | Not Available | 982 | Open in IMG/M |
| 3300031962|Ga0307479_11562198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300031962|Ga0307479_12144312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300032064|Ga0318510_10361632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300032174|Ga0307470_10078888 | Not Available | 1809 | Open in IMG/M |
| 3300032174|Ga0307470_10232977 | Not Available | 1203 | Open in IMG/M |
| 3300032174|Ga0307470_10267342 | Not Available | 1140 | Open in IMG/M |
| 3300032174|Ga0307470_11366504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300032180|Ga0307471_102874390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300033513|Ga0316628_100531474 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300034125|Ga0370484_0025786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.32% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.88% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.44% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.44% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.44% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.44% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000178 | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FW301_10091622 | 3300000178 | Groundwater | KILLALAARREKQEELARRLLRELKEEFPASPLFAAEYARSMGFPIPSSITR* |
| JGI12635J15846_106847721 | 3300001593 | Forest Soil | AKVLLALAARREKQDPLAKKLLLELTEEFPDSPLFAAEYAKVIGRPIPAEIKPN* |
| JGI25382J43887_100349522 | 3300002908 | Grasslands Soil | EKQDDLARKLLRELNQEFPASPLFAAEYARLTSRPIPAQIRH* |
| JGI25617J43924_100298901 | 3300002914 | Grasslands Soil | LLALAARREKQDPLARKLLRELSEEYPESPLYAAEYAKVMGQPIPAQMHP* |
| JGI25617J43924_101109442 | 3300002914 | Grasslands Soil | LLALAARREKQDPLARKLLRELSEEYPESPLYAAEYAKVMRRPIPAEMHP* |
| JGI25616J43925_101880732 | 3300002917 | Grasslands Soil | QPFAKILLALAARREKQNPLAQKLFLELSEEFPESALYAAEYAKAMGRPIPAQMRP* |
| Ga0062384_1003347592 | 3300004082 | Bog Forest Soil | EKQNARAEALLKTLTEEFPASPLFAAEYAKVQGRPVPAQLTPAAH* |
| Ga0062389_1012047582 | 3300004092 | Bog Forest Soil | QDEMAKKLLHELTEEFPDSPLFAAEYAKVLGRPIPAEMRPN* |
| Ga0062595_1020779661 | 3300004479 | Soil | AKVLLALAARREKQDVLAKRLLHELTEEFPESPLFAAEYAKVMGRPIPAELKPN* |
| Ga0062388_1003213011 | 3300004635 | Bog Forest Soil | LKGFAEILLALSARREKQNARAEALLKSLTEEYPASPLFAAEYAKVQGRPVPAQLNPAQ* |
| Ga0062388_1013793661 | 3300004635 | Bog Forest Soil | ALSARREKQNARAEALLKTLTEEFPASPLFAAEYAKVQGRPVPAQLTPTAH* |
| Ga0066820_10186551 | 3300005160 | Soil | EKQNELAQKLLKELTDEFPSSDLFAAEYAKAMGLPIPASIRAN* |
| Ga0066674_102804361 | 3300005166 | Soil | PFAKIMLGLAACREKQNKLAQKLFHELSEEFPESQQYAIEHAKAMARTIPPSMHP* |
| Ga0066683_101905212 | 3300005172 | Soil | LLALAARREKKEALAQKLLRELSQEFPESSLYSAEYAKAMGRLAPTQMHP* |
| Ga0066684_100328591 | 3300005179 | Soil | ILLALAARRQKQDDLAQRLLRELSEEFPESPLYAAEYAKAMGRPIPAQMHP* |
| Ga0066684_104258731 | 3300005179 | Soil | ARREKQNPLAQKLFHELSEEFPESTLYATEYAKAMGQPIPAHMHP* |
| Ga0066388_1013594361 | 3300005332 | Tropical Forest Soil | MLALAARREKQNALAQKLLRELKEEFPDNELFASEYAKAMGQPIPTVLTR* |
| Ga0066388_1081828812 | 3300005332 | Tropical Forest Soil | SARREKQNALAQRLLHELSEEFPSSPLFAAEYAKAMGRPIPAELTR* |
| Ga0073909_103793432 | 3300005526 | Surface Soil | RREKQNALAQRLLHELTEEFPSNDTFAAEYAKAMGLPVPAVITR* |
| Ga0070730_104689182 | 3300005537 | Surface Soil | AKILLALAARREKQNPLAQKLLHELTEEFPTSELFASEYAKAMGQPIPAEMHPN* |
| Ga0066704_106829771 | 3300005557 | Soil | EKQNALAQKLLHELTQEFPSNDTFAAEYAKAMGLPVPAVITR* |
| Ga0066698_101142251 | 3300005558 | Soil | QNPTAQKLLHELSEEFPESPLYAAEYAKAMGRPIPAEMYP* |
| Ga0066700_100077544 | 3300005559 | Soil | KQDDLAQRLLRELSEEFPESPLYAAEYAKAMGRPIPAQMHP* |
| Ga0070761_103228661 | 3300005591 | Soil | FAKVLLALAARREKQDPLAKKLLQELTQEFPDSPLFTAEYAKVIGRPIPAEIKRD* |
| Ga0070762_109423801 | 3300005602 | Soil | RYLEPFAKVLLALAARREKQGALAQKLLHELTVEFPDSPLFSAEYAKVMGRPIPAELKPN |
| Ga0070766_105545431 | 3300005921 | Soil | KLLLQLTEEFPSNPTYASEYAKAMGRPIPAEMKSTP* |
| Ga0070766_110759291 | 3300005921 | Soil | LEPFAKVLLALAARREKQDPLAKKLLQELTHEFPDSPLFAAEYAKVIGRPIPAEIKRD* |
| Ga0070766_110824292 | 3300005921 | Soil | LLALAARREKQDALALKLLRELTEEFPDSPLFAAEYAKVQGRPIPAEMKPN* |
| Ga0075015_1002137161 | 3300006102 | Watersheds | PYAKILLALASRREKQNPLAQKLFRELSEEFPESPLYAAEYAKAMGRPIPAEMHP* |
| Ga0075018_104747932 | 3300006172 | Watersheds | TNLRELTEEFPDSPAFAAEYAKVMHRPVPAQIHP* |
| Ga0066665_104949411 | 3300006796 | Soil | REKKDALAQKLLRELSQEFPESSLYSAEYAKAMGRLAPTQMHP* |
| Ga0079221_105444591 | 3300006804 | Agricultural Soil | LAEKLLHELREEFPASPLFAAEYAKIMGQPIPATIQPSPE* |
| Ga0079219_113938532 | 3300006954 | Agricultural Soil | KIMLALAARREKQNALAQKLFRELSEEFPEGTLYAVEYAKAMGRPVPTSMHR* |
| Ga0099793_100702781 | 3300007258 | Vadose Zone Soil | PYAKILLALAARREKQNPLAQKLFHELSVEFPESALYAAEYAKALGRPIPAQMHP* |
| Ga0099794_106116931 | 3300007265 | Vadose Zone Soil | LAQKLLSELSEEFPASPLFATEYAKAMGRPIPAEIGP* |
| Ga0099829_101153094 | 3300009038 | Vadose Zone Soil | ALAQKLLRELSEEFPSNDLFASEYAKAMGRPVPAIIER* |
| Ga0099830_105731731 | 3300009088 | Vadose Zone Soil | LLALAARREKKDALAQKLLRELSQEFPESSLYSAEYAKAMGRLVPTQMHP* |
| Ga0099830_112365461 | 3300009088 | Vadose Zone Soil | LAVKLLKELTEEYPKSPLYAAEYAKALGKPIPAQIHP* |
| Ga0099830_118126272 | 3300009088 | Vadose Zone Soil | PFAKILLALAARREKQNALAQKLFRELSEEFPDSTLYAAEYAKAMGRPVPTQMHPSGRIP |
| Ga0099828_105058382 | 3300009089 | Vadose Zone Soil | ALASRREKQKTVAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAEMHP* |
| Ga0099792_108003542 | 3300009143 | Vadose Zone Soil | LLALAARREKQNPVAQKLLLELSQEFPESPLYAAEYAKAMGRPIPAKMHP* |
| Ga0116222_14132051 | 3300009521 | Peatlands Soil | ILLALAARREKQNPLAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAELRP* |
| Ga0105237_126302851 | 3300009545 | Corn Rhizosphere | RREKQNAEAQKLLLELTQEFPANPLFATEYAKAMGRPIPAEIRP* |
| Ga0105237_127382842 | 3300009545 | Corn Rhizosphere | LSARREKQNAEAQKLLLELTQEFPTNPLFATEYAKAMGRPIPAEIRP* |
| Ga0116113_11628892 | 3300009638 | Peatland | AQILLALSSRREKQNARAEALLKTLTEEFPKSALFAAEYAKVRGRPVPAQLVPAAQ* |
| Ga0126374_114661012 | 3300009792 | Tropical Forest Soil | AQKLLRELTKEFPTSELFASEYAKAMGRPIPAGIRSSEP* |
| Ga0126384_110809661 | 3300010046 | Tropical Forest Soil | EKQNQLAQRLLHDLSQEFPTNQLFAAEYAKAMGWPIPAEMTR* |
| Ga0126373_120811331 | 3300010048 | Tropical Forest Soil | KQKALAQKLLRELTEEFPESPLYPGEYAKAIGRPVPASMHP* |
| Ga0134062_101729872 | 3300010337 | Grasslands Soil | KLLRELTEEFPESPLYPAEYAKAMGRPIPASMHP* |
| Ga0126370_126661501 | 3300010358 | Tropical Forest Soil | KIMLGLAARREKQNKLAQKLFHELSEEFPESQQYAIEYAKAMGRPIPSSMHP* |
| Ga0126372_105400861 | 3300010360 | Tropical Forest Soil | REKQKPLAQKLLRELTEEFPESPLYPAEYAKAMGRPIPASMHP* |
| Ga0126378_107408492 | 3300010361 | Tropical Forest Soil | RREKQNKLAQKLFRELSEEFPETPQYAIEYAKAMGKQVPASMHR* |
| Ga0126378_111473381 | 3300010361 | Tropical Forest Soil | MLALAARREKQKALAQKLLRELTEEFPESPLYPGEYAKAIGRPVPASMHP* |
| Ga0126378_121231702 | 3300010361 | Tropical Forest Soil | KPFAKIMLALAARREKQNKLAQKLFRELSEEFPDTPQYAIEYAKAMGKQVSPSVHR* |
| Ga0126381_1033503571 | 3300010376 | Tropical Forest Soil | KLFHELSEEFPESSQYAVEYAKAMGRPVPAQMRSKDP* |
| Ga0126346_14052771 | 3300010865 | Boreal Forest Soil | DALAQRLLRELSEEFSSSPLFAAEYAKSMGRPVPAVMHP* |
| Ga0126350_118006932 | 3300010880 | Boreal Forest Soil | ALAARREKQGALAQRLLHELTEEFPDSPLFAAEYAKVLGRPIPAELKPN* |
| Ga0137392_104908142 | 3300011269 | Vadose Zone Soil | LAQKLLRELSEEFPSNDTFAAEYAKAMGLPVPAILTR* |
| Ga0137392_113041351 | 3300011269 | Vadose Zone Soil | AQKLLRELSEEFPESPLYAAEYAKAMGRPIPAEMHP* |
| Ga0137391_103610723 | 3300011270 | Vadose Zone Soil | AKILLALAARREKQNGLAQRLLSELSEEFPASPLFTTEYAKAMGRPIPAGIGP* |
| Ga0137391_105945912 | 3300011270 | Vadose Zone Soil | EKQNTLAQKLLHELTEEFPSNDTYAAEYAKAMGLPVPAVITR* |
| Ga0137391_106767901 | 3300011270 | Vadose Zone Soil | CAKILLALAARREKQDPLAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAELRP* |
| Ga0137391_109785241 | 3300011270 | Vadose Zone Soil | AARREKKNALAQKLLGELTAEFPDSSLFAAEYAKAMGRPVPAIMKPN* |
| Ga0137391_110898462 | 3300011270 | Vadose Zone Soil | REKKDALAQKLLRELSQEFPESSLYSAEYAKAMGRLVPTQIHP* |
| Ga0137393_115871191 | 3300011271 | Vadose Zone Soil | EKQNALAQKLFRELSEEFPDSTLYAAEYAKAMGRPVPTQMHPSARIP* |
| Ga0137393_117152771 | 3300011271 | Vadose Zone Soil | RREKQNALAQKMLHELNEEFPASPLFAAEYAKAMGRPAPATMHAANP* |
| Ga0137389_100549151 | 3300012096 | Vadose Zone Soil | IMLALAARREKQNELAQKLLRDLSEEFPASPLFAAEYAKAMGRPIPAQMRP* |
| Ga0137389_107509411 | 3300012096 | Vadose Zone Soil | REKLDPVAQKLLRELSEEYPESSLYATEYAKAMGKIIPAEMHP* |
| Ga0137389_111642191 | 3300012096 | Vadose Zone Soil | LAQKLFHELSEEFPQSPLYAAEYAKAMGRPIPAQMHP* |
| Ga0137388_103055131 | 3300012189 | Vadose Zone Soil | LAARREKQNALAQKLLRELSEEFPSNDTFAAEYAKAMGLPVPAILTR* |
| Ga0137388_119009651 | 3300012189 | Vadose Zone Soil | DLAQKLLRELSEEFPESPLYAAEYAKALGRPIPAQLHP* |
| Ga0137363_106002631 | 3300012202 | Vadose Zone Soil | REKQDVVAQKLLRELSEDYPESSLYNAEYAKAMGRIIPAQMHP* |
| Ga0137363_114426501 | 3300012202 | Vadose Zone Soil | EKQDVVAQKLLRELSEEYPGNSLYAAEYAKAMGRIIPAQMHP* |
| Ga0137399_104277091 | 3300012203 | Vadose Zone Soil | DPVAQKLLRELSEEYPESSLYATEYAKAMGKIIPAEMHP* |
| Ga0137362_105512702 | 3300012205 | Vadose Zone Soil | ARREKQNPLAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAEMHP* |
| Ga0137362_107386462 | 3300012205 | Vadose Zone Soil | LAQKLLHELTEEFPSNDTYAAEYAKAMGLPVPAVITR* |
| Ga0137380_109051141 | 3300012206 | Vadose Zone Soil | ASREKQNALAQRLFRELSEEFPEGTLYAVEYAKAMGRPVPASMHR* |
| Ga0137381_103572723 | 3300012207 | Vadose Zone Soil | ASRREKQTPTAQKLLHELSEEFPESPLYAAEYAKALGRPIPAEMHP* |
| Ga0137387_101388771 | 3300012349 | Vadose Zone Soil | KLLRELSQEFPESSLYSAEYAKAMGRLVPTQMHP* |
| Ga0137387_105654911 | 3300012349 | Vadose Zone Soil | LARKLLRELNQEFPASPLFAAEYDRLTGRPIPAQIRH* |
| Ga0137384_110316851 | 3300012357 | Vadose Zone Soil | KDALAQKLLRELSQEFPESSLYSAEYAKAMGRLVPTQMHP* |
| Ga0137385_109681042 | 3300012359 | Vadose Zone Soil | FAKILLALAARREKKDALAQKLLRELSQEFPESSLYSAEYAKAMGRLVPTQIHP* |
| Ga0137361_107605442 | 3300012362 | Vadose Zone Soil | LLALAARREKQNPLAQKLLLELTEEFPESPLYAAEYAKAMGRPIPAQMHP* |
| Ga0137361_111955452 | 3300012362 | Vadose Zone Soil | YAKILLALAARREKQNPLAQKLFHELSVEFPESALYAAEYAKALGRPIPAQMHP* |
| Ga0137358_100632401 | 3300012582 | Vadose Zone Soil | QNALAQKLLHELTQEFPSNSTFATEYAKAMGLPLPAIITR* |
| Ga0137398_111930391 | 3300012683 | Vadose Zone Soil | REKQDPLAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAELRP* |
| Ga0137396_101191743 | 3300012918 | Vadose Zone Soil | REKQNPLAQKLFLELSEEFPESALYAAEYAKAMGRPIPAQMRP* |
| Ga0137396_112171142 | 3300012918 | Vadose Zone Soil | MEQLGNTIEKGRYLQPYAKILLALAARREKQNPLAQKLFHELSEEFPESALYAAEYAKAMGRPIPAQMHP* |
| Ga0137359_100440431 | 3300012923 | Vadose Zone Soil | AARREKKDVVAQKLLRELSEEYPGNSLYAAEYAKAMGRIIPAQMHP* |
| Ga0137359_100696384 | 3300012923 | Vadose Zone Soil | VVAQKLLRELSEEYPGNSLYAAEYAKAMGRIIPAQMHP* |
| Ga0137359_106896892 | 3300012923 | Vadose Zone Soil | AKILLALAARREKLDPVAQKLLRELSEEYPESSLYATEYAKAMGKIIPAEMHP* |
| Ga0137359_115669832 | 3300012923 | Vadose Zone Soil | AARREKQNALAQKLLHELTQEFPSNDTFAAEYAKAMGLPVPAVITR* |
| Ga0137419_101925593 | 3300012925 | Vadose Zone Soil | AQKLFHELSEEFPESALYAAEYAKALGRPIPAQMHP* |
| Ga0137419_108277222 | 3300012925 | Vadose Zone Soil | VVAQKLLRELSEEYPESSLYTTEYAKAMGRIIPAQMHP* |
| Ga0137419_116814172 | 3300012925 | Vadose Zone Soil | AKILLALAARREKQDMVAQKLLRELSEEYPGNSLYAAEYAKAMGRIIPAQMHP* |
| Ga0137416_120255751 | 3300012927 | Vadose Zone Soil | KQDVVAQKLLRELSEDYPESSLYTAEYAKAMGRIIPSQMHP* |
| Ga0137404_116081741 | 3300012929 | Vadose Zone Soil | ARREKQDVVAQKLLRELSEDYPESSLYTAEYAKAMGRIIPAHMHP* |
| Ga0153915_119921732 | 3300012931 | Freshwater Wetlands | ILLALAARREKQDELARRLLRELTEEFPASPLFAAEYARAEGRLP* |
| Ga0137410_100073874 | 3300012944 | Vadose Zone Soil | MREQAIEKDELSQKLLRELTEEFPSGTLFAAECAKAMGRPIPAEMHPN* |
| Ga0134077_103432062 | 3300012972 | Grasslands Soil | AQKLLHELSEEFPESPLYAAEYAKAMGRPIPAEMYP* |
| Ga0134075_103795372 | 3300014154 | Grasslands Soil | REKKDALAQKLLRELSQEFPESSLYSGEYAKAMGRLAPTQMHP* |
| Ga0134078_100647151 | 3300014157 | Grasslands Soil | KILLALAARREKQNPLAQKLFHELSEEFPESTLYATEYAKAMGQPIPAHMHP* |
| Ga0137411_10291231 | 3300015052 | Vadose Zone Soil | REKKDVVAQKLLRELSEEYPGNSLYAAEYAKAMGRIIPAQMHP* |
| Ga0137420_13005362 | 3300015054 | Vadose Zone Soil | QPYAKILLALAARREKQNPLAQKLFHELSVEFPESALYAAEYAKALGRPIPAQMHP* |
| Ga0167653_10432872 | 3300015162 | Glacier Forefield Soil | MLALAARREKQDALAQKLLRELSEEFPESQTFATEYAKAMGRPVPATLHP* |
| Ga0167638_10610451 | 3300015197 | Glacier Forefield Soil | LAQKLLLDLSQEFPGNTLFASEYAKAMGRPIPAEMKPLFAFLLPL* |
| Ga0167638_10690321 | 3300015197 | Glacier Forefield Soil | LLALSARREKQNALAQKLLLNLSQEFPSSQLFAAEYAKSMGRPIPAEITR* |
| Ga0134072_101736192 | 3300015357 | Grasslands Soil | LLALAARRQKQDDLAQRLLRELSEEFPESPLYAAEYAKAMGRPIPAQMHP* |
| Ga0182036_117694642 | 3300016270 | Soil | ARREKQNELAQKLLKDLTDEFPSSQLFAAEYAKAMGRPIPAEMRAN |
| Ga0182041_111197132 | 3300016294 | Soil | KILLALAARREKQNELAQKLLKDLTDEFPSSQLFAAEYAKAMGRPIPAEMRAN |
| Ga0134083_100471843 | 3300017659 | Grasslands Soil | FAKILLALAARREKKDVLAQKLLRELSQEFPESSLYSGEYAKAMGRFAPTQMHP |
| Ga0187802_101030411 | 3300017822 | Freshwater Sediment | AGKLLRELTEESPSSPLFAAEYAKVVGLPISAEVVHP |
| Ga0187820_13346721 | 3300017924 | Freshwater Sediment | QNELAVKLLKELTEEFPECPLYAAEYAKAQGKLIPAEIHP |
| Ga0187814_104302892 | 3300017932 | Freshwater Sediment | ARREKQNELAVKLLKELCDEYPDSPLYAAEYAKAQGKLIPAEVHP |
| Ga0187817_104146291 | 3300017955 | Freshwater Sediment | KQNELAVKLLKELTEEFPECPLYAAEYAKAQGKLIPAEIHP |
| Ga0187810_100830891 | 3300018012 | Freshwater Sediment | KILLALSARREKQNELAVKLLKELTEEFPECPLYAAEYAKAQGKLIPAEIHP |
| Ga0066655_113662701 | 3300018431 | Grasslands Soil | EPLAKIRLALGAQREKQKALAQKLLQEFTEEFPESPLYPAEYAKAMGRPIPASMHP |
| Ga0066662_101326121 | 3300018468 | Grasslands Soil | RREKQNALAQKLFRELSEEFPDSTLYAAEYAKAMGRPVPTQMHPSARIP |
| Ga0193756_10333451 | 3300019866 | Soil | NPLAQKLFHELSEEFPESALYAAEYAKTMGRPIPARMHP |
| Ga0179592_101318222 | 3300020199 | Vadose Zone Soil | LAARREKQNPLAQKLLLELREEFPGSPLFAAEYAKAMGRPIPAQMHP |
| Ga0179592_102112902 | 3300020199 | Vadose Zone Soil | KQNPLAQKLLRELTEEFPESPLYAAEYAKAMGLPIPSRMHP |
| Ga0210403_108989632 | 3300020580 | Soil | NPLAQKLFLELSEEFPESALYAAEYAKAMGRPIPAQMRP |
| Ga0210403_109783321 | 3300020580 | Soil | KLLHELTEEFPDSPLFAAEYAKVIGRPIPAEIKPD |
| Ga0210403_110470632 | 3300020580 | Soil | AARREKQNVLAQKLLGELKNEFPSNDTFAAEYAKAMGLPVPAVLTR |
| Ga0210399_104950312 | 3300020581 | Soil | AQKLLLELSEEYPESSLFAAEYAKSMGRIIPAQMHP |
| Ga0210399_105499482 | 3300020581 | Soil | LALAARREKQDPLAQKLLRELREEFPESPLYAAEYAKAMGRPIPAQMHP |
| Ga0210401_112426532 | 3300020583 | Soil | RREKQNTLAQKLLLELSEEFPSSPLFAAEYAKAMGRPIPAELKKAEP |
| Ga0210401_113646412 | 3300020583 | Soil | LAARREKQEALAQKLFRELTEEFPESPLFAAEYAKVMGRPIPAELKPN |
| Ga0210404_100360443 | 3300021088 | Soil | LAWAARREKQNALAQKLLHELTQEFPSNDTFAAEYAKAMGLPVPAIVTR |
| Ga0210400_107403562 | 3300021170 | Soil | KQNARAEILLKELTEEFPASPLFAAEYAKVQGRPVPAVMNP |
| Ga0210405_109552612 | 3300021171 | Soil | VLLALAAQREKQDPLAKKLLHELTEEFPDSPLFAAEYAKVIGRPIPAEIKPH |
| Ga0210408_105809741 | 3300021178 | Soil | EKQNALAQKLLLELTEEFPDSPLFAAEYAKAMGRPIPAEMKP |
| Ga0210396_108159652 | 3300021180 | Soil | AKIMLALAARREKKNVLAQKLLRELSEEFPTNDTFAAEYAKAMGLPVPAVITR |
| Ga0210387_100960831 | 3300021405 | Soil | ARREKQNALAQKLLLELTREFPSNTTYATEYAKAMGRPIPAAIEAAP |
| Ga0210383_114099881 | 3300021407 | Soil | AQKNLKELTEEFPGNSTYAAEYAKAMGRPIPSAMVPAN |
| Ga0210383_117095731 | 3300021407 | Soil | LAQKLFRELTEEFPESPLFAAEYAKVMGRPIPAELKPN |
| Ga0210394_113720041 | 3300021420 | Soil | VGKTAEKGRYLEPFAKVLLALAARREKQDPLAKKLLQELTQEFPDSPLFTAEYAKVIGRPIPAEMKRD |
| Ga0210384_101303551 | 3300021432 | Soil | LAQKNLKELTEEFPGNSTYAAEYAKAMGRPIPSAMVPAN |
| Ga0210402_111815761 | 3300021478 | Soil | KILLALAARREKQDALAQKLLLELSEEYPESSLFAAEYAKSMGRIIPAQMHP |
| Ga0210402_114526082 | 3300021478 | Soil | ARREKQDALAKKLLHELTEEFPDSPLFAAEYAKVMGRPIPAEMKPN |
| Ga0210410_100805141 | 3300021479 | Soil | EKQNPLAQKLFHELSEEFPESPLYAAEYAKAMGRPIPAQMHP |
| Ga0126371_118572532 | 3300021560 | Tropical Forest Soil | FAKIMLGLAARREKQNKLAQKLFHELTEEFPENPQYAIEYAKAMGKPIPATMHP |
| Ga0126371_126985032 | 3300021560 | Tropical Forest Soil | KIMLALAARREKQNKLAQKLFRELSEEFPETQQYAIEYAKAMGKQVPPSVHR |
| Ga0242660_11638221 | 3300022531 | Soil | LAARREKQDAVAQKLLHELSEEYPESSLFAAEYAKAMGHIIPAKMHP |
| Ga0247679_10078523 | 3300024251 | Soil | ARREKKNELAQKLLRELTEEFPSSTLFASEYAKAMGRPIPAEMHTN |
| Ga0247687_10643372 | 3300024286 | Soil | AARREKQDVLAKKLLHELTEEYPESPLFAAEYAKVMGRPIPAELKPN |
| Ga0208848_11100822 | 3300025509 | Arctic Peat Soil | REKQNVLAQRLLHELSEEFPSSPLFAAEYAKAMGQPIPATIQSGTNP |
| Ga0207665_106831592 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RREKQNALAQKLLHELTEEFPTNDTFAAEYAKAMGLPVPAVLTR |
| Ga0209838_10156941 | 3300026214 | Soil | EKQNALAQRLLLELSQEFPSSPLFAAEYAKAMGRPIPAEMTR |
| Ga0209350_10067861 | 3300026277 | Grasslands Soil | QKLFHELSEEFPESTLYATEYAKAMGQPIPAHMHP |
| Ga0209055_11989831 | 3300026309 | Soil | AARRQKQNDLAQKLLRELSEEFPESPLYTAEYAKAMGWPIPAQMHP |
| Ga0209473_12468642 | 3300026330 | Soil | KQNPLAQKLFHELSEEFPESTLYATEYAKAMGQPIPAHMHP |
| Ga0209804_12115302 | 3300026335 | Soil | ARREKQNPLAQKLFHELSEEFPESTLYATEYAKAMGRPIPAQMHP |
| Ga0257172_10860312 | 3300026482 | Soil | ILLALAARREKQNPLAQKLFLELSEEFPESALYAAEYAKAMGRPIPAQMRP |
| Ga0209058_11248173 | 3300026536 | Soil | HNPTAQNLLHELSEEFPESPLYAAEYAKAMGRPIPAEMYP |
| Ga0209056_106655932 | 3300026538 | Soil | ILLALAARREKQNPLAQKLFHELSEEFPESTLYATEYAKAMGQPIPAHMHP |
| Ga0209156_101913942 | 3300026547 | Soil | KQRALAQKLLQQLTEEFPESPLYPAEYAKAMGRPIPASIHP |
| Ga0209161_104946341 | 3300026548 | Soil | ILLALSARREKQNAEAQKLLLELTQEFPANPLFATEYAKAMGRPIPAELRP |
| Ga0209648_104929381 | 3300026551 | Grasslands Soil | LAARREKQNALAQKLLRELKEEFPSNDTFAAEYAKAMGLPVPAVITR |
| Ga0179593_10698453 | 3300026555 | Vadose Zone Soil | MLALAARREKQNTLAQKLLHELTEEFPSNDTYAAEYAKAMGLPVPAIITR |
| Ga0179587_105172462 | 3300026557 | Vadose Zone Soil | NALAQKLLHDLTQEFPSNDTFAAEYAKAMGLPVPAVITR |
| Ga0179587_108547822 | 3300026557 | Vadose Zone Soil | ILLALAARREKQDVVAQKLLRELSEEYPESSLYSAEYAKAMGRIIPAQMHP |
| Ga0179587_111086841 | 3300026557 | Vadose Zone Soil | LQPYAKILLALAARREKQNPLAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAEMHP |
| Ga0179587_111689161 | 3300026557 | Vadose Zone Soil | LALAARREKQNTLAQKLLHELTEEFPSNDTYAAEYAKAMGLPVPAVITR |
| Ga0208603_10483512 | 3300027109 | Forest Soil | RLLLELTQEFPSNATFATEYAKAMGRPIPAAIEAAP |
| Ga0209004_10350432 | 3300027376 | Forest Soil | MLALAARREKKAEVAQKLFRELSEEFPESSQYAVEYAKAKGSPVLSRADP |
| Ga0209422_10499441 | 3300027629 | Forest Soil | QKLLRELTEEFPSNDLFASEYAKAMGRPIPAVIER |
| Ga0209076_10135791 | 3300027643 | Vadose Zone Soil | ARREKQDPLAQKLLRELSEEFPESPLYAAEYAKAMGRPIPADIHP |
| Ga0209217_12063452 | 3300027651 | Forest Soil | AQKLLRELSEEFPSNDTFAAEYAKAMGLPVPATLTR |
| Ga0209388_10228573 | 3300027655 | Vadose Zone Soil | AQKLLRELSEEFPESPLYAAEYAKAMGRPIPADMHP |
| Ga0209388_11096061 | 3300027655 | Vadose Zone Soil | QKLLRELSEDYPESSLYTTEYAKAMGRIIPAHMHP |
| Ga0209038_101542102 | 3300027737 | Bog Forest Soil | KILLALSARREKQNPLAQKLLLELTQEFPSNATFATEYAKAMGRPIPAAIEAAP |
| Ga0209177_100321773 | 3300027775 | Agricultural Soil | AARREKQNALAQRLFRELSEEFPEGTLYAVEYAKAMGRPVPASMHR |
| Ga0209074_104339311 | 3300027787 | Agricultural Soil | FAKIMLALAARREKQNKLAQKLFHELSEEFPESPQYAIEYAKAMARPVPASVHR |
| Ga0209040_104051222 | 3300027824 | Bog Forest Soil | EKQNARAEALLKTLREEFPKSPLFAAEYAKVQGRPVPAEIVPAH |
| Ga0209180_102596681 | 3300027846 | Vadose Zone Soil | KQNALAQKLLRELSEEFPSNDTFAAEYAKAMGLPVPAILTR |
| Ga0209166_106678501 | 3300027857 | Surface Soil | KKNELAQKLLRELTEEFPSSTLFASEYAKAMGRPIPAEMHPN |
| Ga0209701_101091511 | 3300027862 | Vadose Zone Soil | EKQNLLAQKLLLELSEEFPESPLYAAEYAKAMGRPIPAEIHP |
| Ga0209701_104029641 | 3300027862 | Vadose Zone Soil | AQKLLHELTEEFPSNDTYAAEYAKAMGLPVPAVITR |
| Ga0209167_102835602 | 3300027867 | Surface Soil | AARREKQDALAQRLLHELTEEFPDSPLFAAEYAKVMGRPIPAVIKPN |
| Ga0209169_105615371 | 3300027879 | Soil | ALKLLHELTEEFPDSPLFAAEYAKVQGRPIPAEMKPN |
| Ga0209590_100757731 | 3300027882 | Vadose Zone Soil | AQKLFHELSEEFPESTLYATEYAKAMGRPIPAQMHP |
| Ga0209590_104163372 | 3300027882 | Vadose Zone Soil | QKLLLELSEEFPESPLYAAEYAKAMGRPIPAEMHP |
| Ga0209275_104236642 | 3300027884 | Soil | FLLALAARREKQGALATRLLHELTEEFPDSPLFAAEYAKVLGRPIPAEMKPNPE |
| Ga0209380_105464751 | 3300027889 | Soil | KLLLQLTEEFPSNPTYASEYAKAMGRPIPAEMKSTP |
| Ga0209624_106480071 | 3300027895 | Forest Soil | RREKQNALAQKLLLELTQEFPANPTFATEYAKAMGRPIPAELKPTP |
| Ga0209488_110041331 | 3300027903 | Vadose Zone Soil | ILLALAARREKQNPVAQKLLLELSQEFPESPLYAAEYAKAMGRPIPAKMHP |
| Ga0209006_101161871 | 3300027908 | Forest Soil | KGFAQILLALSLRREKQNAHAEVVLKELTEEYPRSPLFAAEYAKVRGLRVPAQLNH |
| Ga0209069_110118242 | 3300027915 | Watersheds | VAQKLLRELSEEYPESSLYAAEYAKAMGRIIPSEMHP |
| Ga0247675_10416272 | 3300028072 | Soil | KNELAQKLLRELTEEFPSSTLFAAEYAKAMGRPIPAEMHPN |
| Ga0137415_106439142 | 3300028536 | Vadose Zone Soil | PLAQKLFHELSEEFPESALYAAEYAKALGRPIPAQMHP |
| Ga0137415_114725831 | 3300028536 | Vadose Zone Soil | LAARREKQNALAQKLLGELKSEFPSNDTFAAEYAKAMGLPVPAVITR |
| Ga0302301_10395541 | 3300028731 | Palsa | LALSARREKQNALAQKLLLNLSQEFPSSPLFAAEYAKAMGRPIPAEITP |
| Ga0307504_101187301 | 3300028792 | Soil | QDVVAQKLLRELSEDYPESSLYTAEYSKAMGRIIPAQMHP |
| Ga0265338_109858601 | 3300028800 | Rhizosphere | AEKGRYLEPFAKVLLALAARREKQDALAKKLLYELTQEFPDSPLFAAEYAKVIGRPIPAEMKPN |
| Ga0222749_100735703 | 3300029636 | Soil | EKQDPLAKKLLHELTEEFPDSPLFAAEYARVIGRPIPAEIKPD |
| Ga0222749_102394052 | 3300029636 | Soil | ARREKQNALAQKLLHELTEEFPSNATYAAEYAKAMGLPVPAIISR |
| Ga0222749_108287521 | 3300029636 | Soil | QNPLAQKLLRELSEEFPESPLYAAEYAKAMGQPIPAQMHP |
| Ga0302312_103220422 | 3300030746 | Palsa | EILLALSARREKQNALAQKLLLNLSQEFPSSPLFAAEYAKAMGRPIPAEITP |
| Ga0265750_10107332 | 3300030813 | Soil | AKVLLALAARREKQDALALKLLHELTEEFPDSPLFAAEYAKVQGRPIPAEMKPN |
| Ga0265320_103769162 | 3300031240 | Rhizosphere | ALAKKLLLELTQEFPDSPLFAAEYAKVIGRPIPAEMKPN |
| Ga0310686_1062632822 | 3300031708 | Soil | LLALSARREKQNALAQQLLRELSEEFPSNQLSAAEYAKAMGRPIPAEMTR |
| Ga0307474_100161425 | 3300031718 | Hardwood Forest Soil | LAQKLLLELTQEFPANPTFATEYAKAMGRPIPAELKPTP |
| Ga0307477_101112771 | 3300031753 | Hardwood Forest Soil | LAQKLLRELTEEFPESPLYPAEYAKAMGRPIPASMHP |
| Ga0307477_101413911 | 3300031753 | Hardwood Forest Soil | PLAQKLLLELSREFPESPLYAAEYAKAMGWPIPAEMRP |
| Ga0307477_109532172 | 3300031753 | Hardwood Forest Soil | QKLLRELSEEFPSNNTFAAEYAKAMGLPIPAVMTR |
| Ga0307475_101316481 | 3300031754 | Hardwood Forest Soil | QKLLLELTEEFPESPLYAAEYAKAMGRPIPTQMHP |
| Ga0307475_110985142 | 3300031754 | Hardwood Forest Soil | LAQKLLRELSEEFPESPLYAAEYAKAMGRPIPAEIHP |
| Ga0318509_100108241 | 3300031768 | Soil | MLALAARREKQKALAQKLLRELTEEFPESPLYPGEYAKAMGRPVPASMHP |
| Ga0318567_101923722 | 3300031821 | Soil | AARREKQKALAQKLLRELTEEFPESPLYPGEYAKAMGRPVPASMHP |
| Ga0307478_105248902 | 3300031823 | Hardwood Forest Soil | EKQDALAQKLLHELTEEFPDSPLFAAEYAKVMRRPIPAVIKPN |
| Ga0307478_113919951 | 3300031823 | Hardwood Forest Soil | AQKLLLELTREFPSNTTYATEYAKAMGRPIPAEIEAAP |
| Ga0307478_113933521 | 3300031823 | Hardwood Forest Soil | REKQNVLAQKLLRELSEEFPSNDTFAAEYAKAMGLPVPAVMTR |
| Ga0318564_105210631 | 3300031831 | Soil | AKIMLALAARREKQKALAQKLLRELTEEFPESPLYPGEYAKAMGRPVPASMHP |
| Ga0307479_101131053 | 3300031962 | Hardwood Forest Soil | QKLLLQLTEEFPSNPTYASEYAKAMGRPIPAEMKSTP |
| Ga0307479_103106161 | 3300031962 | Hardwood Forest Soil | ARREKQNALAQKLLRELSEEFPSNDTFAAEYAKAMGLPVPAILTR |
| Ga0307479_107120661 | 3300031962 | Hardwood Forest Soil | KILLALAARREKQDPLAQKLLRELREEFPESPLYAAEYAKAMRRPIPAQMHP |
| Ga0307479_115621982 | 3300031962 | Hardwood Forest Soil | NVLAQRLLRELKDEFPSNDTFAAEYAKAMGLPIPSVITR |
| Ga0307479_121443122 | 3300031962 | Hardwood Forest Soil | AARREKQNPVAQKLLLELSEEFPESPLYAAEYAKAMGQLIPARVHP |
| Ga0318510_103616322 | 3300032064 | Soil | QKALAQKLLRELTEQFPESPLYPGEYAKAMGRPVPASMHP |
| Ga0307470_100788881 | 3300032174 | Hardwood Forest Soil | LALSARREKQNALAQKLLLQLSEEFPSSPLFAAEYAKAMGRPIPAELRNSTP |
| Ga0307470_102329771 | 3300032174 | Hardwood Forest Soil | AQKLLHELTQEFPSNDTFAAEYAKAMGLPVPAVITR |
| Ga0307470_102673422 | 3300032174 | Hardwood Forest Soil | LAARREKQNPLAQKLLRELTEEFPSSTLFASEYAKVMGLPIPAEMRPN |
| Ga0307470_113665041 | 3300032174 | Hardwood Forest Soil | ALAQRLLHELTEEFPSNDTFAAEYAKAMGLPVPAVITR |
| Ga0307471_1028743901 | 3300032180 | Hardwood Forest Soil | ARREKQNPLAQKLLRELTEEFPSSTLFASEYAKVMGLPIPAEMRPN |
| Ga0316628_1005314742 | 3300033513 | Soil | ARREGQEDLARRLLLELTLEFPASPLFAAEYARVTDRPIPAASR |
| Ga0370484_0025786_1176_1328 | 3300034125 | Untreated Peat Soil | MLALAARREKQNVLAQKLLHELSEEFPSSPLFAAEYAKAMGQPIPATIHP |
| ⦗Top⦘ |