NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019889

Metagenome / Metatranscriptome Family F019889

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019889
Family Type Metagenome / Metatranscriptome
Number of Sequences 227
Average Sequence Length 45 residues
Representative Sequence HDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV
Number of Associated Samples 195
Number of Associated Scaffolds 227

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.76 %
% of genes near scaffold ends (potentially truncated) 95.59 %
% of genes from short scaffolds (< 2000 bps) 93.39 %
Associated GOLD sequencing projects 188
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.595 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.894 % of family members)
Environment Ontology (ENVO) Unclassified
(26.872 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.529 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.44%    β-sheet: 0.00%    Coil/Unstructured: 55.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 227 Family Scaffolds
PF03401TctC 10.13
PF09084NMT1 4.41
PF01042Ribonuc_L-PSP 3.96
PF01494FAD_binding_3 3.96
PF03992ABM 2.64
PF08448PAS_4 2.20
PF00106adh_short 1.76
PF13561adh_short_C2 1.76
PF01717Meth_synt_2 1.76
PF00005ABC_tran 1.76
PF02129Peptidase_S15 1.32
PF04828GFA 1.32
PF02698DUF218 0.88
PF02515CoA_transf_3 0.88
PF01039Carboxyl_trans 0.88
PF07883Cupin_2 0.88
PF12071DUF3551 0.88
PF00126HTH_1 0.44
PF00089Trypsin 0.44
PF13188PAS_8 0.44
PF00296Bac_luciferase 0.44
PF04909Amidohydro_2 0.44
PF02630SCO1-SenC 0.44
PF028262-Hacid_dh_C 0.44
PF07238PilZ 0.44
PF04191PEMT 0.44
PF07978NIPSNAP 0.44
PF13430DUF4112 0.44
PF01402RHH_1 0.44
PF16576HlyD_D23 0.44
PF01546Peptidase_M20 0.44
PF05598DUF772 0.44
PF13439Glyco_transf_4 0.44
PF02775TPP_enzyme_C 0.44
PF05139Erythro_esteras 0.44
PF08239SH3_3 0.44
PF00196GerE 0.44
PF00120Gln-synt_C 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 227 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 10.13
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 7.93
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.41
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.41
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.96
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 3.96
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 3.96
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 3.96
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.76
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.32
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.88
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 0.88
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.88
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 0.88
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.88
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.88
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.44
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.44
COG2312Erythromycin esterase homologSecondary metabolites biosynthesis, transport and catabolism [Q] 0.44
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.59 %
UnclassifiedrootN/A4.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1192385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria961Open in IMG/M
2170459023|GZGNO2B01DB4WHAll Organisms → cellular organisms → Bacteria501Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101691254All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300000559|F14TC_100224214All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10011316All Organisms → cellular organisms → Bacteria → Proteobacteria2463Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10076653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii842Open in IMG/M
3300000956|JGI10216J12902_104235132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1460Open in IMG/M
3300000956|JGI10216J12902_114095074All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300001686|C688J18823_10645137All Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
3300001976|JGI24752J21851_1018629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium905Open in IMG/M
3300004052|Ga0055490_10263838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300004114|Ga0062593_102268582All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300004114|Ga0062593_103158082All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300004157|Ga0062590_100045061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2394Open in IMG/M
3300004633|Ga0066395_10206733All Organisms → cellular organisms → Bacteria → Proteobacteria1030Open in IMG/M
3300005177|Ga0066690_10115879All Organisms → cellular organisms → Bacteria → Proteobacteria1735Open in IMG/M
3300005329|Ga0070683_100296895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1537Open in IMG/M
3300005330|Ga0070690_101399091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300005332|Ga0066388_101241934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1278Open in IMG/M
3300005344|Ga0070661_100159849All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300005353|Ga0070669_101798080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni535Open in IMG/M
3300005353|Ga0070669_101929298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300005364|Ga0070673_102249702All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005434|Ga0070709_11650620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300005456|Ga0070678_100036349All Organisms → cellular organisms → Bacteria → Proteobacteria3447Open in IMG/M
3300005457|Ga0070662_100702206All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae856Open in IMG/M
3300005518|Ga0070699_100241795All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300005547|Ga0070693_101365204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales550Open in IMG/M
3300005548|Ga0070665_100217046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1913Open in IMG/M
3300005554|Ga0066661_10505844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria730Open in IMG/M
3300005577|Ga0068857_101787108All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Budviciaceae → Budvicia → Budvicia aquatica602Open in IMG/M
3300005718|Ga0068866_10239196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1105Open in IMG/M
3300005719|Ga0068861_100653797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae971Open in IMG/M
3300005764|Ga0066903_101990884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1115Open in IMG/M
3300005764|Ga0066903_107507696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300005764|Ga0066903_108863777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300005841|Ga0068863_100451525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601262Open in IMG/M
3300005842|Ga0068858_100660355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1016Open in IMG/M
3300005842|Ga0068858_102570725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300006038|Ga0075365_10484101All Organisms → cellular organisms → Bacteria → Proteobacteria874Open in IMG/M
3300006041|Ga0075023_100057754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1236Open in IMG/M
3300006173|Ga0070716_100269833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1168Open in IMG/M
3300006237|Ga0097621_100702688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860931Open in IMG/M
3300006237|Ga0097621_101769368All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300006354|Ga0075021_10500816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium769Open in IMG/M
3300006579|Ga0074054_11874076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium827Open in IMG/M
3300006791|Ga0066653_10771612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300006797|Ga0066659_10553795All Organisms → cellular organisms → Bacteria → Proteobacteria929Open in IMG/M
3300006806|Ga0079220_10720466All Organisms → cellular organisms → Bacteria → Proteobacteria737Open in IMG/M
3300006844|Ga0075428_101221615All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300006854|Ga0075425_100856831All Organisms → cellular organisms → Bacteria → Proteobacteria1040Open in IMG/M
3300006854|Ga0075425_101349475All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300006871|Ga0075434_102637370All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300006903|Ga0075426_11155708All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300006904|Ga0075424_100611837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1163Open in IMG/M
3300006969|Ga0075419_10390984All Organisms → cellular organisms → Bacteria → Proteobacteria951Open in IMG/M
3300006969|Ga0075419_10547211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium808Open in IMG/M
3300007788|Ga0099795_10186289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium869Open in IMG/M
3300009012|Ga0066710_100473730Not Available1882Open in IMG/M
3300009089|Ga0099828_10063509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3104Open in IMG/M
3300009092|Ga0105250_10456215Not Available574Open in IMG/M
3300009094|Ga0111539_11833187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria703Open in IMG/M
3300009098|Ga0105245_10452259All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300009098|Ga0105245_11256314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria789Open in IMG/M
3300009100|Ga0075418_10638866All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300009100|Ga0075418_11036340All Organisms → cellular organisms → Bacteria → Proteobacteria888Open in IMG/M
3300009147|Ga0114129_13160972All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300009148|Ga0105243_13103982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300009156|Ga0111538_12787101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300009176|Ga0105242_10838295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria914Open in IMG/M
3300009545|Ga0105237_10955006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium864Open in IMG/M
3300009553|Ga0105249_10875048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria965Open in IMG/M
3300009792|Ga0126374_10977917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300010037|Ga0126304_10691537All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300010043|Ga0126380_10243886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1238Open in IMG/M
3300010043|Ga0126380_12291297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7501Open in IMG/M
3300010045|Ga0126311_10209073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1427Open in IMG/M
3300010048|Ga0126373_10956018All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300010159|Ga0099796_10295334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium685Open in IMG/M
3300010166|Ga0126306_10347937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1151Open in IMG/M
3300010358|Ga0126370_10623250All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300010359|Ga0126376_10409231Not Available1225Open in IMG/M
3300010359|Ga0126376_12464101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300010360|Ga0126372_12727060All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300010361|Ga0126378_13082874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300010362|Ga0126377_10262356All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1687Open in IMG/M
3300010362|Ga0126377_11775563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Starkeya → Starkeya novella692Open in IMG/M
3300010373|Ga0134128_12144461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300010373|Ga0134128_13024603All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300010375|Ga0105239_10750695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1117Open in IMG/M
3300010391|Ga0136847_11618846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria652Open in IMG/M
3300010398|Ga0126383_10902184All Organisms → cellular organisms → Bacteria → Proteobacteria970Open in IMG/M
3300010398|Ga0126383_11208781All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300010403|Ga0134123_13313614Not Available519Open in IMG/M
3300011003|Ga0138514_100156119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales508Open in IMG/M
3300011270|Ga0137391_10541658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium981Open in IMG/M
3300011271|Ga0137393_11086815All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300012022|Ga0120191_10165529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300012356|Ga0137371_10033607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3960Open in IMG/M
3300012469|Ga0150984_113219216All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300012532|Ga0137373_11238026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7524Open in IMG/M
3300012685|Ga0137397_10140661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1785Open in IMG/M
3300012882|Ga0157304_1084879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300012884|Ga0157300_1043082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300012891|Ga0157305_10288903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300012893|Ga0157284_10330166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300012900|Ga0157292_10062610Not Available1030Open in IMG/M
3300012915|Ga0157302_10255926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300012922|Ga0137394_10741435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales825Open in IMG/M
3300012927|Ga0137416_10190609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1638Open in IMG/M
3300012948|Ga0126375_10941686All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012961|Ga0164302_10937257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300012971|Ga0126369_10705658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1086Open in IMG/M
3300012985|Ga0164308_11258770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria670Open in IMG/M
3300012989|Ga0164305_11566057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7587Open in IMG/M
3300012989|Ga0164305_12122846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300013100|Ga0157373_10090659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2153Open in IMG/M
3300014265|Ga0075314_1144676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria547Open in IMG/M
3300014300|Ga0075321_1039109All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300014301|Ga0075323_1105766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300014325|Ga0163163_10002915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales14465Open in IMG/M
3300014864|Ga0180068_1059461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300014968|Ga0157379_10224816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1701Open in IMG/M
3300015200|Ga0173480_11167791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria518Open in IMG/M
3300015251|Ga0180070_1034186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300015371|Ga0132258_12922562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1187Open in IMG/M
3300015371|Ga0132258_13724395All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300015374|Ga0132255_101207590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1139Open in IMG/M
3300016294|Ga0182041_10582411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium981Open in IMG/M
3300016294|Ga0182041_12133735All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300016319|Ga0182033_10000003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales108949Open in IMG/M
3300016319|Ga0182033_10441749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1108Open in IMG/M
3300016319|Ga0182033_10594283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium961Open in IMG/M
3300016341|Ga0182035_12101683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium513Open in IMG/M
3300016371|Ga0182034_10028779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603440Open in IMG/M
3300016387|Ga0182040_10496408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium975Open in IMG/M
3300016404|Ga0182037_10198628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1554Open in IMG/M
3300016422|Ga0182039_11226455Not Available678Open in IMG/M
3300017965|Ga0190266_10769179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria613Open in IMG/M
3300017974|Ga0187777_11059274All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300017974|Ga0187777_11368569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7522Open in IMG/M
3300018028|Ga0184608_10163766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860964Open in IMG/M
3300018081|Ga0184625_10626336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300018468|Ga0066662_12055990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300019356|Ga0173481_10324144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300019362|Ga0173479_10863317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300021510|Ga0222621_1104303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300021560|Ga0126371_10548153All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300021560|Ga0126371_12445846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300021968|Ga0193698_1035403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M
3300021976|Ga0193742_1167935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300022737|Ga0247747_1040683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300023057|Ga0247797_1000514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3075Open in IMG/M
3300023062|Ga0247791_1035946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium764Open in IMG/M
3300025315|Ga0207697_10498645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300025911|Ga0207654_10014787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4039Open in IMG/M
3300025912|Ga0207707_10230327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1612Open in IMG/M
3300025914|Ga0207671_11379695All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300025916|Ga0207663_10016054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4144Open in IMG/M
3300025925|Ga0207650_11407841Not Available593Open in IMG/M
3300025931|Ga0207644_11342872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300025934|Ga0207686_11572830All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300025939|Ga0207665_10207319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1430Open in IMG/M
3300025939|Ga0207665_10565103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales885Open in IMG/M
3300025941|Ga0207711_10349894Not Available1368Open in IMG/M
3300025941|Ga0207711_11919460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300026067|Ga0207678_10436223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1137Open in IMG/M
3300026312|Ga0209153_1234970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300026895|Ga0207758_1028729All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300027174|Ga0207948_1036053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L103C131B0594Open in IMG/M
3300027428|Ga0207617_105456Not Available525Open in IMG/M
3300027646|Ga0209466_1015163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1621Open in IMG/M
3300027738|Ga0208989_10105507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium958Open in IMG/M
3300027909|Ga0209382_10550443All Organisms → cellular organisms → Bacteria → Proteobacteria1264Open in IMG/M
3300028536|Ga0137415_10464606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1072Open in IMG/M
3300028708|Ga0307295_10165478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300028719|Ga0307301_10241339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300028721|Ga0307315_10186057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300028755|Ga0307316_10347823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300028810|Ga0307294_10031974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1453Open in IMG/M
3300028881|Ga0307277_10141489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71040Open in IMG/M
3300031199|Ga0307495_10200575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300031200|Ga0307496_10039448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria764Open in IMG/M
3300031366|Ga0307506_10344419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300031474|Ga0170818_102673997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4385Open in IMG/M
3300031544|Ga0318534_10601473All Organisms → cellular organisms → Bacteria → Proteobacteria625Open in IMG/M
3300031546|Ga0318538_10105949All Organisms → cellular organisms → Bacteria → Proteobacteria1456Open in IMG/M
3300031546|Ga0318538_10401951All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Kushneria → Kushneria sinocarnis741Open in IMG/M
3300031548|Ga0307408_102429123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300031561|Ga0318528_10281883All Organisms → cellular organisms → Bacteria → Proteobacteria892Open in IMG/M
3300031682|Ga0318560_10062116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1866Open in IMG/M
3300031713|Ga0318496_10197152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1106Open in IMG/M
3300031723|Ga0318493_10303051All Organisms → cellular organisms → Bacteria → Proteobacteria862Open in IMG/M
3300031751|Ga0318494_10463244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L103C131B0738Open in IMG/M
3300031753|Ga0307477_10306354All Organisms → cellular organisms → Bacteria → Proteobacteria1096Open in IMG/M
3300031764|Ga0318535_10029143All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella2196Open in IMG/M
3300031764|Ga0318535_10567004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031765|Ga0318554_10216693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1090Open in IMG/M
3300031770|Ga0318521_10374062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae847Open in IMG/M
3300031792|Ga0318529_10111579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1240Open in IMG/M
3300031833|Ga0310917_10447920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L103C131B0878Open in IMG/M
3300031854|Ga0310904_10162680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1309Open in IMG/M
3300031854|Ga0310904_10966281All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300031859|Ga0318527_10389204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300031890|Ga0306925_10154849All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella2466Open in IMG/M
3300031892|Ga0310893_10052252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1362Open in IMG/M
3300031896|Ga0318551_10070243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1813Open in IMG/M
3300031896|Ga0318551_10819028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7541Open in IMG/M
3300031910|Ga0306923_10604025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71231Open in IMG/M
3300031910|Ga0306923_12460763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300031981|Ga0318531_10265849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium774Open in IMG/M
3300032002|Ga0307416_100583281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1196Open in IMG/M
3300032003|Ga0310897_10122512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1061Open in IMG/M
3300032008|Ga0318562_10396746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium802Open in IMG/M
3300032035|Ga0310911_10922598All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Kushneria → Kushneria sinocarnis503Open in IMG/M
3300032042|Ga0318545_10349040All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300032043|Ga0318556_10105563All Organisms → cellular organisms → Bacteria → Proteobacteria1430Open in IMG/M
3300032055|Ga0318575_10422697All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Kushneria → Kushneria sinocarnis676Open in IMG/M
3300032067|Ga0318524_10274306All Organisms → cellular organisms → Bacteria → Proteobacteria870Open in IMG/M
3300032075|Ga0310890_10646001Not Available823Open in IMG/M
3300032075|Ga0310890_10795265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300032090|Ga0318518_10056842All Organisms → cellular organisms → Bacteria → Proteobacteria1875Open in IMG/M
3300032091|Ga0318577_10601465All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032122|Ga0310895_10062672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1407Open in IMG/M
3300033289|Ga0310914_10307839All Organisms → cellular organisms → Bacteria → Proteobacteria1429Open in IMG/M
3300033417|Ga0214471_10779135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria747Open in IMG/M
3300033551|Ga0247830_10219590All Organisms → cellular organisms → Bacteria → Proteobacteria1427Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.01%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.32%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.32%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.32%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.32%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.88%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.88%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.88%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.44%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.44%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.44%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.44%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.44%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300021976Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026895Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes)EnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300027428Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A2-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_049984802124908045SoilPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
FA3_039993202170459023Grass SoilITIYICNPHDVPKARKILATYFAGNPPGSTLCILRGLANPNFLLEIEAIAVV
INPhiseqgaiiFebDRAFT_10169125413300000364SoilKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEATAAV*
F14TC_10022421413300000559SoilPHDVPKARGILQTYFAGQPPASTLCILXGLANPNFLLEIEAIAAV*
AF_2010_repII_A1DRAFT_1001131653300000597Forest SoilARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
AF_2010_repII_A1DRAFT_1007665333300000597Forest SoilRGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
JGI10216J12902_10423513223300000956SoilVPQARTILQEYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV*
JGI10216J12902_11409507413300000956SoilYICNPHDVPKARAILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
C688J18823_1064513713300001686SoilKARGILFDYFGKNPPGSTLCILRGLANPNFLLEIEAIAAV*
JGI24752J21851_101862933300001976Corn, Switchgrass And Miscanthus RhizosphereKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0055490_1026383823300004052Natural And Restored WetlandsCNPHDVPRARGILHTYFGAHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0062593_10226858223300004114SoilPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0062593_10315808213300004114SoilSDVTKVTIYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0062590_10004506113300004157SoilIYICNPHDVTKARRILTDYFGSNPPGSTLCVLRGLANPNFLLEVEAIAAV*
Ga0066395_1020673313300004633Tropical Forest SoilVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0066690_1011587933300005177SoilDVTKITIYICNTHDVPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV*
Ga0070683_10029689513300005329Corn RhizosphereDVPKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0070690_10139909113300005330Switchgrass RhizosphereAKLSDVTKVAIYICNPHDVTKARRILTDYFGSNPPGSTLCVLRGLANPNFLLEVEAIAAV
Ga0066388_10124193433300005332Tropical Forest SoilKITIYICNPHDVPKARGILHTYFAGQPPASTLCILRGLATPFLLEIEAIAAV*
Ga0070661_10015984913300005344Corn RhizosphereICNPHDVPKARFILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0070669_10179808013300005353Switchgrass RhizosphereLCNPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0070669_10192929813300005353Switchgrass RhizosphereDVTKVTIYICNPHDVPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0070673_10224970223300005364Switchgrass RhizosphereVPKARGILKTYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0070709_1165062023300005434Corn, Switchgrass And Miscanthus RhizosphereVPKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0070678_10003634963300005456Miscanthus RhizosphereVPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0070662_10070220623300005457Corn RhizosphereICNPHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV*
Ga0070699_10024179513300005518Corn, Switchgrass And Miscanthus RhizosphereKARSILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0070693_10136520413300005547Corn, Switchgrass And Miscanthus RhizosphereHDVPKARGILQTYFAGAAPASTLCILRGLANPKFLLEIEAIAAV*
Ga0070665_10021704613300005548Switchgrass RhizospherePKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0066661_1050584413300005554SoilICNPHDVPKARGILQTYFAGAAPASTLCILRGLANPHFLLEIEAIAAV*
Ga0068857_10178710813300005577Corn RhizosphereITIYLCNPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0068866_1023919623300005718Miscanthus RhizospherePKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV*
Ga0068861_10065379713300005719Switchgrass RhizosphereDVPKARSILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0066903_10199088443300005764Tropical Forest SoilGVLQTYFAGNAPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0066903_10750769623300005764Tropical Forest SoilITIYICNPHDVPKARGVLQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0066903_10886377723300005764Tropical Forest SoilKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0068863_10045152513300005841Switchgrass RhizosphereVTKITIYICNPHDVPKARAILFDYFGKHPPGSTLCVLRGLANPNFLLEIEAIAAV*
Ga0068858_10066035533300005842Switchgrass RhizosphereICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0068858_10257072513300005842Switchgrass RhizosphereTIYICNPHDVPKARSILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0075365_1048410113300006038Populus EndosphereVTKITIYICSPHDVPKARALLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0075023_10005775443300006041WatershedsHDVPKARAILQDYFGDSPPASTLCVLRGLANPHFLLEVEAIAAV*
Ga0070716_10026983313300006173Corn, Switchgrass And Miscanthus RhizosphereVPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV*
Ga0097621_10070268833300006237Miscanthus RhizosphereTIYICNPHDVPKARAILFDYFGKHPPGSTLCVLRGLANPNFLLEIEAIAAV*
Ga0097621_10176936813300006237Miscanthus RhizosphereVTIYICNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0075021_1050081613300006354WatershedsKARKILATYFAGNPPGSTLCILRGLANPNFLLEIEAIAVV*
Ga0074054_1187407613300006579SoilILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0066653_1077161213300006791SoilCNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0066659_1055379523300006797SoilVPKARNVLQTYFKGHPPGSTLCILRGLANPNFLLEIEAIAAI*
Ga0079220_1072046633300006806Agricultural SoilYICSPHDVPKARRLLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0075428_10122161523300006844Populus RhizosphereVLQTYFAGNPPGSTLCILRGLVNPNFLLEIEAIAVV*
Ga0075425_10085683133300006854Populus RhizosphereCNPHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV*
Ga0075425_10134947513300006854Populus RhizosphereKVTIYICNPHDVPKARSILQDYFGGDSPVTTLCVLRGLANPNFLLEIEAIAAV*
Ga0075434_10263737013300006871Populus RhizosphereTIYICNPHDVTKARRILTDYFGGNPPGSTLCVLRGLANPNFLLEVEAIAAV*
Ga0075426_1115570813300006903Populus RhizosphereTKITIYICNPHDVPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV*
Ga0075424_10061183713300006904Populus RhizospherePHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV*
Ga0075419_1039098433300006969Populus RhizosphereSPHDVPKARRLLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0075419_1054721123300006969Populus RhizosphereARSILQDYFGSDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0099795_1018628913300007788Vadose Zone SoilICNPHDVPKARGVLQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0066710_10047373013300009012Grasslands SoilRGILQTYFAGAAPASTLCILRGLANPHFLLEIEAIAAV
Ga0099828_1006350953300009089Vadose Zone SoilTICICNPHDVPKARGVLQTYFGGHPPGSTLCVLRGLANPNFLLEIEAIAAC*
Ga0105250_1045621513300009092Switchgrass RhizosphereHDVPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0111539_1183318733300009094Populus RhizosphereMTRSILQDYFGGDSPVTTLCVLRGLANPNFLLEIEAIAAV*
Ga0105245_1045225923300009098Miscanthus RhizosphereKARNILKTYFAGHAPGSTLCVLRGLANPNFLVEIEAIAAV*
Ga0105245_1125631413300009098Miscanthus RhizosphereRAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0075418_1063886613300009100Populus RhizosphereVLQTYFAGNPPGSTLCILRGLVNPNFLLEIEAIAVV
Ga0075418_1103634033300009100Populus RhizosphereHDVPKARGVLQKYFAGNPPGSTLCILRGLAHPHFLLEIEATAVV*
Ga0114129_1316097223300009147Populus RhizospherePHDVPKARNVLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0105243_1310398213300009148Miscanthus RhizosphereKVTIYICNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0111538_1278710113300009156Populus RhizosphereKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0105242_1083829513300009176Miscanthus RhizosphereKVTIYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0105237_1095500613300009545Corn RhizosphereIYLCNPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0105249_1087504813300009553Switchgrass RhizosphereAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0126374_1097791723300009792Tropical Forest SoilYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0126304_1069153723300010037Serpentine SoilIYICNPHDVPKARNILKTYFAGHAPGSTLCILRGLANPNFLVEIEAIAAV*
Ga0126380_1024388623300010043Tropical Forest SoilRGILQTYCAGAAPASTLCGLRGLANPTVILEIEAIAAV*
Ga0126380_1229129723300010043Tropical Forest SoilTKVTLYICNPHDVPKARRVLATYFAGNPPGSTLCILRGLAHPSFLLEIEAIAAV*
Ga0126311_1020907323300010045Serpentine SoilYICNPHDVPKARSILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0126373_1095601813300010048Tropical Forest SoilDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0099796_1029533413300010159Vadose Zone SoilNPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0126306_1034793723300010166Serpentine SoilKARAILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0126370_1062325013300010358Tropical Forest SoilIYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0126376_1040923123300010359Tropical Forest SoilLQEYFGNNPPASTLCVLRGLANPNFLLEIEAIAAL*
Ga0126376_1246410123300010359Tropical Forest SoilYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0126372_1272706013300010360Tropical Forest SoilICNPHDVPKARKVLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0126378_1308287413300010361Tropical Forest SoilPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0126377_1026235613300010362Tropical Forest SoilARKVLQTYFAAHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0126377_1177556333300010362Tropical Forest SoilYICNPHDVPKARGVLQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV*
Ga0134128_1214446113300010373Terrestrial SoilLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0134128_1302460323300010373Terrestrial SoilNVLQTYFKGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0105239_1075069513300010375Corn RhizosphereILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0136847_1161884613300010391Freshwater SedimentYNYFDKHPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0126383_1090218413300010398Tropical Forest SoilPKARGLLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0126383_1120878113300010398Tropical Forest SoilNPHDVPKARNVLKTYFAGHAPGSTLCILRGLANPSFLLEIEAIAAV*
Ga0134123_1331361413300010403Terrestrial SoilVPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0138514_10015611923300011003SoilTHDVPKARKILATHFAGNPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0137391_1054165833300011270Vadose Zone SoilKARGILQTYFAGHPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0137393_1108681523300011271Vadose Zone SoilIYICNPHDVPKARNLLRTYFGEHPPGSTLCILRGLAHPNFLLEIEAIAAV*
Ga0120191_1016552913300012022TerrestrialARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0137371_1003360753300012356Vadose Zone SoilCNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0150984_11321921613300012469Avena Fatua RhizosphereDVPKARNVLQTYFKGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0137373_1123802613300012532Vadose Zone SoilVGDITIYICNPHDVPKARGVLQAYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0137397_1014066113300012685Vadose Zone SoilKARGILQTYFAGHPPGSTLCILRGLANPHFLLEIEAIAAV*
Ga0157304_108487923300012882SoilVTIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0157300_104308213300012884SoilVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0157305_1028890323300012891SoilDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAVAAV*
Ga0157284_1033016623300012893SoilPKARGILSDYFGDTPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0157292_1006261023300012900SoilLQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0157302_1025592613300012915SoilILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0137394_1074143513300012922Vadose Zone SoilAKISDVVKITIYICSPHDVPKARNLLQTYFAGNPPGSTLCILRGLANPNFLLEVEAIAAV
Ga0137416_1019060923300012927Vadose Zone SoilMAKITIYLCNPHDVPKARGILQTYFAGHPSGSTLCIPRGLANPNFLLEIEAIAAV*
Ga0126375_1094168613300012948Tropical Forest SoilNILKTWFAGHAPGSTLCILRGLANPNFLVEIEAIAAV*
Ga0164302_1093725723300012961SoilCNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0126369_1070565813300012971Tropical Forest SoilICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0164308_1125877013300012985SoilTKVTIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0164305_1156605713300012989SoilTIYICNPHDVPKARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0164305_1212284623300012989SoilHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV*
Ga0157373_1009065913300013100Corn RhizosphereARSILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0075314_114467613300014265Natural And Restored WetlandsPKARALIQTWFGEHPPGSTLCVLRGLANPNFLLEIEAIAAV*
Ga0075321_103910913300014300Natural And Restored WetlandsKITIYICNPHDVPKARGILQTYFSDHPPGSTLCVLRGLANPNFLVEIEAIAAV*
Ga0075323_110576613300014301Natural And Restored WetlandsRGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0163163_1000291513300014325Switchgrass RhizosphereQDYFGDHPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0180068_105946123300014864SoilSDVTKVTIYICHPHDVPKARGILYEYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0157379_1022481613300014968Switchgrass RhizosphereTIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0173480_1116779113300015200SoilKARRILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0180070_103418623300015251SoilVPKARGILYEYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0132258_1292256243300015371Arabidopsis RhizosphereSDVTKVTIYICNPHDVTKARRILTDYFGSNPPGSTLCVLRGLANPNFLLEVEAIAAV*
Ga0132258_1372439513300015371Arabidopsis RhizosphereARSILQGYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV*
Ga0132255_10120759013300015374Arabidopsis RhizosphereARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV*
Ga0182041_1058241113300016294SoilDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0182041_1213373513300016294SoilLETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0182033_100000031023300016319SoilAILQEYFGDSPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0182033_1044174923300016319SoilYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANSNFLLEIEAIAAV
Ga0182033_1059428323300016319SoilYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0182035_1210168323300016341SoilRGVLQTYFAGNPPGSTLCILRGLANPNLLLEIEAIAAV
Ga0182034_1002877963300016371SoilVTKITIYICNPHDVPKARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0182040_1049640813300016387SoilPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0182037_1019862813300016404SoilKARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0182039_1122645513300016422SoilKVTIYICNPHDVAKARRILETYFGGHPPGSTLCIVRGLANPNFLLEIEAIAAV
Ga0190266_1076917913300017965SoilNPHDVPKARAILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0187777_1105927413300017974Tropical PeatlandNPHDVPKARAILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0187777_1136856913300017974Tropical PeatlandIYICNPHDVPKARAILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0184608_1016376613300018028Groundwater SedimentNPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0184625_1062633613300018081Groundwater SedimentKVTIYICNPHDVPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV
Ga0066662_1205599013300018468Grasslands SoilDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV
Ga0173481_1032414433300019356SoilVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0173479_1086331723300019362SoilPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0222621_110430313300021510Groundwater SedimentKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0126371_1054815323300021560Tropical Forest SoilLQTYFAGQPPASTLCILRGLANPNFLLEIEAIAWV
Ga0126371_1244584623300021560Tropical Forest SoilHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0193698_103540313300021968SoilHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0193742_116793513300021976SoilVNPHDVPKARAVLQTYFEGNPPGSTLCILRGLAHPDFLLEIEAIAAV
Ga0247747_104068313300022737SoilNPHDVRKARGVLKQYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0247797_100051413300023057SoilRSILRDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0247791_103594633300023062SoilIYLCNPHDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0207697_1049864523300025315Corn, Switchgrass And Miscanthus RhizosphereMPPVSSKARAILSDYFGEHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0207654_1001478713300025911Corn RhizosphereHDVPKARSILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0207707_1023032713300025912Corn RhizosphereFILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0207671_1137969523300025914Corn RhizosphereTIYICNPHDVPKARGILNDYFGENPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0207663_1001605433300025916Corn, Switchgrass And Miscanthus RhizosphereNDVPKARAILQEYFGDNPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0207650_1140784113300025925Switchgrass RhizosphereICNPHDVPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0207644_1134287223300025931Switchgrass RhizospherePHDVPKARGILQSYFGSNPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0207686_1157283023300025934Miscanthus RhizosphereIYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0207665_1020731913300025939Corn, Switchgrass And Miscanthus RhizosphereRNILHTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV
Ga0207665_1056510333300025939Corn, Switchgrass And Miscanthus RhizosphereVPKARGILQTYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0207711_1034989413300025941Switchgrass RhizosphereVTIYICDPHDVPKARSILQDYFGDDPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0207711_1191946023300025941Switchgrass RhizosphereVTIYICNPHDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0207678_1043622313300026067Corn RhizosphereKARGILFDHFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0209153_123497013300026312SoilCNPHDVPKARGILQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV
Ga0207758_102872913300026895Tropical Forest SoilTKITIYICNPHDVAKARRILERYFGDHPPGSTLCVVRGLANPNFLLEIEAIAAV
Ga0207948_103605313300027174Forest SoilKILATYFAGNPPGSTLCILRGLANPNFLLEIEAIAVV
Ga0207617_10545623300027428SoilSILQDYFGNDPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0209466_101516313300027646Tropical Forest SoilLQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0208989_1010550713300027738Forest SoilKARSLLQTYFGEHPPGSTLCILRGLAHPNLLLEIEAIAAV
Ga0209382_1055044343300027909Populus RhizosphereNVLQTYFAGHPPASTLCILRGLANPNFLLEIEAIAAV
Ga0137415_1046460623300028536Vadose Zone SoilMAKITIYLCNPHDVSKARCILQTYFSGHPPGSTLCIPRGLANPNFLLEIEAIAAV
Ga0307295_1016547823300028708SoilHDVPKARGIMQTYFAGHPRGSTLCILRGLANPNFLLEIEAIAAV
Ga0307301_1024133913300028719SoilARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307315_1018605733300028721SoilLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307316_1034782313300028755SoilDVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307294_1003197433300028810SoilPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307277_1014148913300028881SoilVKITIYICSPHDVPKARGLLQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307495_1020057513300031199SoilPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307496_1003944823300031200SoilILHDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307506_1034441923300031366SoilVTIYICNPHDVPKARGILKDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0170818_10267399753300031474Forest SoilIYICNPHDVPKARSILQDYFGGDPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0318534_1060147313300031544SoilNQHDVPKARGILETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0318538_1010594933300031546SoilPKARAILQEYFGDSPPASTLCMLRGLANPNFLLEIEAIAAV
Ga0318538_1040195113300031546SoilCNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0307408_10242912313300031548RhizosphereRAILSDYFGEHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0318528_1028188313300031561SoilLERYFGGHPPGSTLCVVRGLANPNFLLEIEAIAAV
Ga0318560_1006211623300031682SoilLQTYFVGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318496_1019715213300031713SoilTIYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318493_1030305123300031723SoilRRILETYFAGNPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0318494_1046324433300031751SoilKARGLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307477_1030635413300031753Hardwood Forest SoilARGILQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0318535_1002914313300031764SoilIYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANSNFLLEIEAIAAV
Ga0318535_1056700423300031764SoilLQTYFAGAAPASTLCILRGLANPNFLLEIEAIAAV
Ga0318554_1021669313300031765SoilPKARGILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0318521_1037406223300031770SoilVPKARGILQTYFAGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0318529_1011157923300031792SoilPHDVPKARGILQTYFVGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0310917_1044792023300031833SoilGLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0310904_1016268013300031854SoilRAILQEHFGDNPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0310904_1096628123300031854SoilKVTIYICNPHDVPKARGILSDYFGETPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318527_1038920423300031859SoilQHDVPKARGVLQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0306925_1015484913300031890SoilITIYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0310893_1005225223300031892SoilLQEYFRDNPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0318551_1007024333300031896SoilIYICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318551_1081902823300031896SoilVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0306923_1060402513300031910SoilAILQTYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0306923_1246076313300031910SoilRGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318531_1026584933300031981SoilVPKARGLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0307416_10058328123300032002RhizosphereDVSKARGVLKQYFGKHPPGSTLCILRGLAHPNFLLEIEAIAAV
Ga0310897_1012251223300032003SoilHDVPKARGILFDYFGETPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318562_1039674623300032008SoilIYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0310911_1092259813300032035SoilICNPHDVPKARGILHTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318545_1034904023300032042SoilIYICNPHDVAKARRILERYFGGHPPGSTLCVVRGLANPNFLLEIEAIAAV
Ga0318556_1010556323300032043SoilQHDVPKARGILETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0318575_1042269713300032055SoilITIYICNPHDVPKARGILQTYFAGQPPASTLCILRGLANPNFLLEIEAIAAV
Ga0318524_1027430613300032067SoilTKITIYICNPHDVPKARGLLQKYFAGNPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0310890_1064600113300032075SoilPKARGILQSYFGSNPPGSTLCVLRGLANPNFLLEIEATAAV
Ga0310890_1079526513300032075SoilYLCNPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0318518_1005684213300032090SoilIYICNQHDVPKARGVLQTYFAGHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0318577_1060146523300032091SoilVPKARAILQEYFGDSPPASTLCVLRGLANPNFLLEIEAIAAV
Ga0310895_1006267233300032122SoilDVPKARGILFDYFGKHPPGSTLCILRGLANPNFLLEIEAIAAV
Ga0310914_1030783923300033289SoilVPKARGILETYFGAHPPGSTLCVLRGLANPNFLLEIEAIAAV
Ga0214471_1077913513300033417SoilFIVNPHDVPKARGILQNYFAGNPPGSTLCVLRGLANANFLVEVEAIAAV
Ga0247830_1021959023300033551SoilIYLCNPHDVPKARGLLQTYFEGHPPGSTLCILRGLANPNFLLEIEAIAAV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.